$form->{valid_from} = '';
};
+ $query = '
+ SELECT
+ accno
+ FROM chart
+ WHERE accno = ?';
+ my ($accno) = selectrow_query($form, $dbh, $query, $form->{accno});
+
+ if ($accno) {
+ $form->error($::locale->text('Account number not unique!'));
+ }
+
$query = qq|UPDATE chart SET
accno = ?,
description = ?,
}
sub add_stylesheet {
- $::form->use_stylesheet('lx-office-erp/background_jobs.css');
+ $::request->{layout}->use_stylesheet('lx-office-erp/background_jobs.css');
}
1;
} else {
$::form->{title} = $locals{title} if $locals{title};
- $::form->header;
+ $::form->header(no_menu => $options->{no_menu});
}
}
sub action_header {
my ($self) = @_;
- delete $::form->{stylesheet};
$::form->use_stylesheet('frame_header/header.css');
- $self->render('menu/header',
+ $self->render('menu/header', { partial => 1, no_output => 1 },
now => DateTime->now_local,
is_fastcgi => scalar($::dispatcher->interface_type =~ /fastcgi/i),
is_links => scalar($ENV{HTTP_USER_AGENT} =~ /links/i));
--- /dev/null
+package SL::Controller::Layout;
+
+use strict;
+use parent qw(SL::Controller::Base);
+
+use JSON ();
+
+sub action_empty {
+ my ($self) = @_;
+
+ if ($::form->{format} eq 'json') {
+ my $layout = {
+ pre_content => $::request->{layout}->pre_content,
+ start_content => $::request->{layout}->start_content,
+ end_content => $::request->{layout}->end_content,
+ post_content => $::request->{layout}->post_content,
+ javascripts => [ $::request->{layout}->javascripts ],
+ javascripts_inline => [ $::request->{layout}->javascripts_inline ],
+ stylesheets => [ $::request->{layout}->stylesheets ],
+ stylesheets_inline => [ $::request->{layout}->stylesheets_inline ],
+ };
+
+ $self->render(\ JSON::to_json($layout), { type => 'js', raw => 1 });
+ }
+}
+
+1;
use SL::Dispatcher::AuthHandler::User;
use SL::User;
+__PACKAGE__->run_before('set_layout');
#
# actions
#
return if $self->_redirect_to_main_script_if_already_logged_in;
# Otherwise show the login form.
- $self->render('login_screen/user_login');
+ $self->render('login_screen/user_login', { no_menu => 1 }, error => error_state($::form->{error}));
}
sub action_logout {
$::auth->destroy_session;
$::auth->create_or_refresh_session;
- $self->render('login_screen/user_login', error => $::locale->text('You are logged out!'));
+ $self->render('login_screen/user_login', { no_menu => 1 }, error => $::locale->text('You are logged out!'));
}
sub action_login {
$::form->{login} = $::myconfig{login};
$::locale = Locale->new($::myconfig{countrycode}) if $::myconfig{countrycode};
my $user = User->new(login => $::myconfig{login});
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => $user->{menustyle});
# if we get an error back, bale out
my $result = $user->login($::form);
# Other login errors.
if (0 > $result) {
$::auth->punish_wrong_login;
- return $self->render('login_screen/user_login', error => $::locale->text('Incorrect username or password!'));
+ return $self->render('login_screen/user_login', { no_menu => 1 }, error => $::locale->text('Incorrect username or password!'));
}
# Everything is fine.
return $self->redirect_to($::form->{callback}) if $::form->{callback};
- my %style_to_script_map = (
- v3 => 'v3',
- neu => 'new',
- v4 => 'v4',
- );
-
- my $menu_script = $style_to_script_map{$user->{menustyle}} || '';
-
- $self->redirect_to(controller => "menu${menu_script}.pl", action => 'display');
+ $self->redirect_to(controller => "login.pl", action => 'company_logo');
}
sub _redirect_to_main_script_if_already_logged_in {
return 1;
}
+sub error_state {
+ return {
+ session => $::locale->text('The session is invalid or has expired.'),
+ password => $::locale->text('Incorrect password!'),
+ }->{$_[0]};
+}
+
+sub set_layout {
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => 'login');
+}
+
1;
});
}
- return $self->{report}->generate_with_headers;
+ return $self->{report}->generate_with_headers(no_layout => 1);
}
sub link_to {
sub action_show {
my ($self) = @_;
- $::form->use_stylesheet('lx-office-erp/background_jobs.css');
+ $::request->{layout}->use_stylesheet('background_jobs.css');
flash('warning', $::locale->text('The task server does not appear to be running.')) if !$self->task_server->is_running;
use SL::Helper::DateTime;
use SL::InstanceConfiguration;
use SL::Template::Plugin::HTMLFixes;
+use SL::Layout::None;
# Trailing new line is added so that Perl will not add the line
# number 'die' was called in.
$::form->{error} = $::locale->text('The session is invalid or has expired.') if ($error_type eq 'session');
$::form->{error} = $::locale->text('Incorrect password!') if ($error_type eq 'password');
- $::form->header;
+ $::form->header(no_menu => 1);
print $::form->parse_html_template($template, \%params);
$::lxdebug->leave_sub;
$::locale = Locale->new($::lx_office_conf{system}->{language});
$::form = Form->new;
$::instance_conf = SL::InstanceConfiguration->new;
- $::request = { cgi => CGI->new({}) };
+ $::request = {
+ cgi => CGI->new({}),
+ layout => SL::Layout::None->new,
+ };
my $session_result = $::auth->restore_session;
$::auth->create_or_refresh_session;
::run($session_result);
} else {
- show_error('login_screen/user_login', 'session') if SL::Auth::SESSION_EXPIRED == $session_result;
+ if (SL::Auth::SESSION_EXPIRED == $session_result) {
+ print $::request->{cgi}->redirect('controller.pl?action=LoginScreen/user_login&error=session');
+ }
my %auth_result = $self->{auth_handler}->handle(
routing_type => $routing_type,
}
};
+ $::form->footer;
+
# cleanup
$::auth->save_session;
$::auth->expire_sessions;
-package SL::Dispatcher::AuthHandler;
+ package SL::Dispatcher::AuthHandler;
use strict;
my ($self, %param) = @_;
my $auth_level = $self->get_auth_level(%param);
+
my $handler_name = "SL::Dispatcher::AuthHandler::" . ucfirst($auth_level);
$self->{handlers} ||= {};
$self->{handlers}->{$handler_name} ||= $handler_name->new;
package SL::Dispatcher::AuthHandler::Admin;
use strict;
-
use parent qw(Rose::Object);
+use SL::Layout::Dispatcher;
+
sub handle {
%::myconfig = ();
return if $::form->{'{AUTH}admin_password'} && ($::auth->authenticate_root($::form->{'{AUTH}admin_password'}) == $::auth->OK());
return if !$::form->{'{AUTH}admin_password'} && ($::auth->authenticate_root($::auth->get_session_value('admin_password')) == $::auth->OK());
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => 'admin');
+
$::auth->punish_wrong_login;
$::auth->delete_session_value('admin_password');
SL::Dispatcher::show_error('admin/adminlogin', 'password');
package SL::Dispatcher::AuthHandler::User;
use strict;
-
use parent qw(Rose::Object);
+use SL::Layout::Dispatcher;
+
sub handle {
my ($self, %param) = @_;
$self->_error(%param) unless $::myconfig{login};
$::locale = Locale->new($::myconfig{countrycode});
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => $::myconfig{menustyle});
my $ok = $::form->{'{AUTH}login'} && (SL::Auth::OK() == $::auth->authenticate($::myconfig{login}, $::form->{'{AUTH}password'}));
$ok ||= !$::form->{'{AUTH}login'} && (SL::Auth::OK() == $::auth->authenticate($::myconfig{login}, undef));
my $self = shift;
$::auth->punish_wrong_login;
- SL::Dispatcher::show_error('login_screen/user_login', 'password', @_);
+ print $::request->{cgi}->redirect('controller.pl?action=LoginScreen/user_login&error=password');
}
1;
return ($module, $submodule);
}
-my @dont_save = qw(login password stylesheet action);
+my @dont_save = qw(login password action);
sub save {
$main::lxdebug->enter_sub();
use SL::DO;
use SL::IC;
use SL::IS;
+use SL::Layout::Dispatcher;
use SL::Locale;
use SL::Mailer;
use SL::Menu;
return $output;
}
-sub use_stylesheet {
- my $self = shift;
-
- $self->{stylesheet} = [ $self->{stylesheet} ] unless ref $self->{stylesheet} eq 'ARRAY';
- $self->{stylesheet} = [ grep { -f }
- map { m:^css/: ? $_ : "css/$_" }
- grep { $_ }
- (@{ $self->{stylesheet} }, @_)
- ];
-
- return @{ $self->{stylesheet} };
-}
-
-sub get_stylesheet_for_user {
- my $css_path = 'css';
- if (my $user_style = $::myconfig{stylesheet}) {
- $user_style =~ s/\.css$//; # nuke trailing .css, this is a remnand of pre 2.7.0 stylesheet handling
- if (-d "$css_path/$user_style" &&
- -f "$css_path/$user_style/main.css") {
- $css_path = "$css_path/$user_style";
- } else {
- $css_path = "$css_path/lx-office-erp";
- }
- } else {
- $css_path = "$css_path/lx-office-erp";
- }
- $::myconfig{css_path} = $css_path; # needed for menunew, FIXME: don't do this here
-
- return $css_path;
-}
-
sub header {
$::lxdebug->enter_sub;
- # extra code is currently only used by menuv3 and menuv4 to set their css.
- # it is strongly deprecated, and will be changed in a future version.
my ($self, %params) = @_;
my $db_charset = $::lx_office_conf{system}->{dbcharset} || Common::DEFAULT_CHARSET;
my @header;
$::lxdebug->leave_sub and return if !$ENV{HTTP_USER_AGENT} || $self->{header}++;
- my $css_path = $self->get_stylesheet_for_user;
+ if ($params{no_layout}) {
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => 'none');
+ }
+
+ my $layout = $::request->{layout};
+
+ # standard css for all
+ # this should gradually move to the layouts that need it
+ $layout->use_stylesheet("$_.css") for qw(
+ main menu tabcontent list_accounts jquery.autocomplete
+ jquery.multiselect2side frame_header/header
+ ui-lightness/jquery-ui-1.8.12.custom
+ js/jscalendar/calendar-win2k-1
+ );
+
+ $layout->use_javascript("$_.js") for qw(
+ jquery common jscalendar/calendar jscalendar/lang/calendar-de
+ jscalendar/calendar-setup part_selection jquery-ui jquery.cookie jqModal
+ switchmenuframe
+ );
$self->{favicon} ||= "favicon.ico";
- $self->{titlebar} = "$self->{title} - $self->{titlebar}" if $self->{title};
+ $self->{titlebar} = join ' - ', grep $_, $self->{title}, $self->{login}, $::myconfig{dbname}, $self->{version} if $self->{title};
# build includes
if ($self->{refresh_url} || $self->{refresh_time}) {
push @header, "<meta http-equiv='refresh' content='$refresh_time;$refresh_url'>";
}
- push @header, map { qq|<link rel="stylesheet" href="$_" type="text/css" title="Stylesheet">| } $self->use_stylesheet;
-
- push @header, "<style type='text/css'>\@page { size:landscape; }</style>" if $self->{landscape};
- push @header, "<link rel='shortcut icon' href='$self->{favicon}' type='image/x-icon'>" if -f $self->{favicon};
- push @header, map { qq|<script type="text/javascript" src="js/$_.js"></script>| }
- qw(jquery common jscalendar/calendar jscalendar/lang/calendar-de jscalendar/calendar-setup part_selection jquery-ui jqModal switchmenuframe);
+ push @header, map { qq|<link rel="stylesheet" href="$_" type="text/css" title="Stylesheet">| } $layout->stylesheets;
+ push @header, "<style type='text/css'>\@page { size:landscape; }</style> " if $self->{landscape};
+ push @header, "<link rel='shortcut icon' href='$self->{favicon}' type='image/x-icon'>" if -f $self->{favicon};
+ push @header, map { qq|<script type="text/javascript" src="$_"></script>| } $layout->javascripts;
push @header, $self->{javascript} if $self->{javascript};
- push @header, map { qq|<link rel="stylesheet" type="text/css" href="$css_path/$_.css">| }
- qw(main menu tabcontent list_accounts jquery.autocomplete jquery.multiselect2side frame_header/header ui-lightness/jquery-ui-1.8.12.custom);
- push @header, map { qq|<link rel="stylesheet" type="text/css" href="js/jscalendar/calendar-win2k-1.css">| }
push @header, map { $_->show_javascript } @{ $self->{AJAX} || [] };
- push @header, "<script type='text/javascript'>function fokus(){ document.$self->{fokus}.focus(); }</script>" if $self->{fokus};
- push @header, sprintf "<script type='text/javascript'>top.document.title='%s';</script>",
- join ' - ', grep $_, $self->{title}, $self->{login}, $::myconfig{dbname}, $self->{version} if $self->{title};
-
- # if there is a title, we put some JavaScript in to the page, wich writes a
- # meaningful title-tag for our frameset.
- my $title_hack = '';
- if ($self->{title}) {
- $title_hack = qq|
- <script type="text/javascript">
- <!--
- // Write a meaningful title-tag for our frameset.
- top.document.title="| . $self->{"title"} . qq| - | . $self->{"login"} . qq| - | . $::myconfig{dbname} . qq| - V| . $self->{"version"} . qq|";
- //-->
- </script>|;
- }
my %doctypes = (
strict => qq|<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01//EN" "http://www.w3.org/TR/html4/strict.dtd">|,
transitional => qq|<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN" "http://www.w3.org/TR/html4/loose.dtd">|,
frameset => qq|<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.01 Frameset//EN" "http://www.w3.org/TR/html4/frameset.dtd">|,
+ html5 => qq|<!DOCTYPE html>|,
);
# output
***********************************************/
</script>
- $params{extra_code}
- $title_hack
</head>
+ <body>
EOT
+ print $::request->{layout}->pre_content;
+ print $::request->{layout}->start_content;
+
+ $layout->header_done;
$::lxdebug->leave_sub;
}
+sub footer {
+ return unless $::request->{layout}->need_footer;
+
+ print $::request->{layout}->end_content;
+ print $::request->{layout}->post_content;
+
+ if (my @inline_scripts = $::request->{layout}->javascripts_inline) {
+ print "<script type='text/javascript'>@inline_scripts</script>\n";
+ }
+
+ print <<EOL
+ </body>
+</html>
+EOL
+}
+
sub ajax_response_header {
$main::lxdebug->enter_sub();
UNLINK => ($::lx_office_conf{debug} && $::lx_office_conf{debug}->{keep_temp_files})? 0 : 1,
);
close $temp_fh;
+ (undef, undef, $self->{template_meta}{tmpfile}) = File::Spec->splitpath( $self->{tmpfile} );
if ($template->uses_temp_file() || $self->{media} eq 'email') {
$out = $self->{OUT};
$amounts{invtotal} = $self->{invtotal};
$amounts{total} = $self->{total};
}
- $amounts{skonto_in_percent} = 100.0 * $self->{percent_skonto};
-
map { $amounts{$_} = $self->parse_amount($myconfig, $amounts{$_}) } keys %amounts;
+ $amounts{skonto_in_percent} = 100.0 * $self->{percent_skonto};
$amounts{skonto_amount} = $amounts{invtotal} * $self->{percent_skonto};
$amounts{invtotal_wo_skonto} = $amounts{invtotal} * (1 - $self->{percent_skonto});
$amounts{total_wo_skonto} = $amounts{total} * (1 - $self->{percent_skonto});
$::myconfig{numberformat} = $saved_numberformat;
}
+sub layout {
+ my ($self) = @_;
+ $::lxdebug->enter_sub;
+
+ my %style_to_script_map = (
+ v3 => 'v3',
+ neu => 'new',
+ v4 => 'v4',
+ );
+
+ my $menu_script = $style_to_script_map{$::myconfig{menustyle}} || '';
+
+ package main;
+ require "bin/mozilla/menu$menu_script.pl";
+ package Form;
+ require SL::Controller::FrameHeader;
+
+
+ my $layout = SL::Controller::FrameHeader->new->action_header . ::render();
+
+ $::lxdebug->leave_sub;
+ return $layout;
+}
+
1;
__END__
my @apoe_filters = qw(transdate);
my @like_filters = (@simple_filters, @invoice_oi_filters);
my @all_columns = (@simple_filters, @makemodel_filters, @apoe_filters, @project_filters, qw(serialnumber));
- my @simple_l_switches = (@all_columns, qw(listprice sellprice lastcost priceupdate weight unit bin rop image));
+ my @simple_l_switches = (@all_columns, qw(notes listprice sellprice lastcost priceupdate weight unit bin rop image));
my @oe_flags = qw(bought sold onorder ordered rfq quoted);
my @qsooqr_flags = qw(invnumber ordnumber quonumber trans_id name module qty);
my @deliverydate_flags = qw(deliverydate);
if ($form->{searchitems} eq 'assembly' && $form->{bom}) {
$query =
qq|SELECT p.id, p.partnumber, p.description, a.qty AS onhand,
- p.unit, p.bin,
+ p.unit, p.bin, p.notes,
p.sellprice, p.listprice, p.lastcost,
p.rop, p.weight, p.priceupdate,
p.image, p.drawing, p.microfiche,
{ name => "Digest::SHA", url => "http://search.cpan.org/~mshelor/", debian => 'libdigest-sha-perl' },
{ name => "IO::Socket::SSL", url => "http://search.cpan.org/~sullr/", debian => 'libio-socket-ssl-perl' },
{ name => "Net::LDAP", url => "http://search.cpan.org/~gbarr/", debian => 'libnet-ldap-perl' },
- # Net::LDAP is core since 5.7.3
+ # Net::SMTP is core since 5.7.3
{ name => "Net::SMTP::SSL", version => '1.01', url => "http://search.cpan.org/~cwest/", debian => 'libnet-smtp-ssl-perl' },
{ name => "Net::SMTP::TLS", version => '0.12', url => "http://search.cpan.org/~awestholm/", debian => 'libnet-smtp-tls-perl' },
);
{ name => "Moose::Role", url => "http://search.cpan.org/~doy/", debian => 'libmoose-role-perl' },
{ name => "Perl::Tags", url => "http://search.cpan.org/~osfameron/", debian => 'libperl-tags-perl' },
{ name => "Test::Deep", url => "http://search.cpan.org/~rjbs/", debian => 'libtest-deep-perl' },
+ { name => "GD", version => '2.00', url => "http://search.cpan.org/~lds/", debian => 'libgd-perl' },
);
$_->{fullname} = join ' ', grep $_, @$_{qw(name version)}
--- /dev/null
+package SL::Layout::Admin;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+sub init_sub_layouts {
+ [ SL::Layout::None->new ]
+}
+
+sub start_content {
+ "<div id='admin' class='admin'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+1;
--- /dev/null
+package SL::Layout::Base;
+
+use strict;
+use parent qw(SL::Controller::Base);
+
+use List::MoreUtils qw(uniq);
+
+use Rose::Object::MakeMethods::Generic (
+ 'scalar --get_set_init' => qw(menu),
+ 'scalar' => qw(focus),
+ 'array' => [
+ 'add_stylesheets_inline' => { interface => 'add', hash_key => 'stylesheets_inline' },
+ 'add_javascripts_inline' => { interface => 'add', hash_key => 'javascripts_inline' },
+ 'sub_layouts', => { interface => 'get_set_init' },
+ 'add_sub_layouts' => { interface => 'add', hash_key => 'sub_layouts' },
+ ],
+);
+
+use SL::Menu;
+
+my %menu_cache;
+
+sub new {
+ my ($class, @slurp) = @_;
+
+ my $self = $class->SUPER::new(@slurp);
+}
+
+sub init_menu {
+ Menu->new('menu.ini');
+}
+
+##########################################
+# inheritable/overridable
+##########################################
+
+sub pre_content {
+ join '', map { $_->pre_content } $_[0]->sub_layouts;
+}
+
+sub start_content {
+ join '', map { $_->start_content } $_[0]->sub_layouts;
+}
+
+sub end_content {
+ join '', map { $_->end_content } $_[0]->sub_layouts;
+}
+
+sub post_content {
+ join '', map { $_->post_content } $_[0]->sub_layouts;
+}
+
+sub stylesheets_inline {
+ uniq ( map { $_->stylesheets_inline } $_[0]->sub_layouts ),
+ @{ $_[0]->{stylesheets_inline} || [] };
+}
+
+sub javascripts_inline {
+ uniq ( map { $_->javascripts_inline } $_[0]->sub_layouts ),
+ @{ $_[0]->{javascripts_inline} || [] };
+}
+
+sub init_sub_layouts { [] }
+
+
+#########################################
+# Interface
+########################################
+
+sub add_stylesheets {
+ &use_stylesheet;
+}
+
+sub use_stylesheet {
+ my $self = shift;
+ push @{ $self->{stylesheets} ||= [] }, @_ if @_;
+ @{ $self->{stylesheets} ||= [] };
+}
+
+sub stylesheets {
+ my ($self) = @_;
+ my $css_path = $self->get_stylesheet_for_user;
+
+ return uniq grep { $_ } map { $self->_find_stylesheet($_, $css_path) }
+ $self->use_stylesheet, map { $_->stylesheets } $self->sub_layouts;
+}
+
+sub _find_stylesheet {
+ my ($self, $stylesheet, $css_path) = @_;
+
+ return "$css_path/$stylesheet" if -f "$css_path/$stylesheet";
+ return "css/$stylesheet" if -f "css/$stylesheet";
+ return $stylesheet if -f $stylesheet;
+}
+
+sub get_stylesheet_for_user {
+ my $css_path = 'css';
+ if (my $user_style = $::myconfig{stylesheet}) {
+ $user_style =~ s/\.css$//; # nuke trailing .css, this is a remnand of pre 2.7.0 stylesheet handling
+ if (-d "$css_path/$user_style" &&
+ -f "$css_path/$user_style/main.css") {
+ $css_path = "$css_path/$user_style";
+ } else {
+ $css_path = "$css_path/lx-office-erp";
+ }
+ } else {
+ $css_path = "$css_path/lx-office-erp";
+ }
+ $::myconfig{css_path} = $css_path; # needed for menunew, FIXME: don't do this here
+
+ return $css_path;
+}
+
+sub add_javascripts {
+ &use_javascript
+}
+
+sub use_javascript {
+ my $self = shift;
+ push @{ $self->{javascripts} ||= [] }, @_ if @_;
+ @{ $self->{javascripts} ||= [] };
+}
+
+sub javascripts {
+ my ($self) = @_;
+
+ return uniq map { $self->_find_javascript($_) }
+ $self->use_javascript, map { $_->javascripts } $self->sub_layouts;
+}
+
+sub _find_javascript {
+ my ($self, $javascript) = @_;
+
+ return "js/$javascript" if -f "js/$javascript";
+ return $javascript if -f $javascript;
+}
+
+
+############################################
+# track state of form header
+############################################
+
+sub header_done {
+ $_[0]{_header_done} = 1;
+}
+
+sub need_footer {
+ $_[0]{_header_done};
+}
+
+1;
--- /dev/null
+package SL::Layout::Classic;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+use SL::Layout::Top;
+use SL::Layout::MenuLeft;
+use SL::Layout::None;
+
+sub init_sub_layouts {
+ [
+ SL::Layout::Top->new,
+ SL::Layout::MenuLeft->new,
+ SL::Layout::None->new,
+ ]
+}
+
+1;
--- /dev/null
+package SL::Layout::Css;
+
+use strict;
+
+use List::Util qw(max);
+use Exporter qw(import);
+
+our @EXPORT = qw(clock_line print_menu menuitem_v3);
+
+sub clock_line {
+ my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
+ $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
+ = localtime(time);
+ $Monat += 1;
+ $Jahrestag += 1;
+ $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
+ $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
+ $Jahr += 1900;
+ my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
+ "Donnerstag", "Freitag", "Samstag");
+ my @Monatsnamen = ("", "Januar", "Februar", "März",
+ "April", "Mai", "Juni", "Juli",
+ "August", "September", "Oktober", "November",
+ "Dezember");
+ return
+ $Wochentage[$Wochentag] . ", der "
+ . $Monatstag . "."
+ . $Monat . "."
+ . $Jahr . " - ";
+}
+
+sub print_menu {
+ my ($self, $parent, $depth) = @_;
+
+ my $html;
+
+ die if ($depth * 1 > 5);
+
+ my @menuorder;
+ my $menu = $self->menu;
+
+ @menuorder = $menu->access_control(\%::myconfig, $parent);
+
+ $parent .= "--" if ($parent);
+
+ foreach my $item (@menuorder) {
+ substr($item, 0, length($parent)) = "";
+ next if (($item eq "") || ($item =~ /--/));
+
+ my $menu_item = $menu->{"${parent}${item}"};
+ my $menu_title = $::locale->text($item);
+ my $menu_text = $menu_title;
+
+ if ($menu_item->{"submenu"} || !defined($menu_item->{"module"})) {
+
+ my $h = $self->print_menu("${parent}${item}", $depth * 1 + 1)."\n";
+ if (!$parent) {
+ $html .= qq|<ul><li><h2>${menu_text}</h2><ul>${h}</ul></li></ul>\n|;
+ } else {
+ $html .= qq|<li><div class="x">${menu_text}</div><ul>${h}</ul></li>\n|;
+ }
+ } else {
+ if ($self->{sub_class} && $depth > 1) {
+ $html .= qq|<li class='sub'>|;
+ } else {
+ $html .= qq|<li>|;
+ }
+ $html .= $self->menuitem_v3("${parent}$item", { "title" => $menu_title });
+ $html .= qq|${menu_text}</a></li>\n|;
+ }
+ }
+
+ return $html;
+}
+
+sub menuitem_v3 {
+ $main::lxdebug->enter_sub();
+
+ my ($self, $item, $other) = @_;
+ my $menuitem = $self->menu->{$item};
+
+ my $action = "section_menu";
+ my $module;
+
+ if ($menuitem->{module}) {
+ $module = $menuitem->{module};
+ }
+ if ($menuitem->{action}) {
+ $action = $menuitem->{action};
+ }
+
+ my $level = $::form->escape($item);
+
+ my $str = qq|<a href="$module?action=| . $::form->escape($action) . qq|&level=| . $::form->escape($level);
+
+ my @vars = qw(module action target href);
+
+ if ($menuitem->{href}) {
+ $str = qq|<a href=$menuitem->{href}|;
+ @vars = qw(module target href);
+ }
+
+ map { delete $menuitem->{$_} } @vars;
+
+ # add other params
+ foreach my $key (keys %{ $menuitem }) {
+ $str .= "&" . $::form->escape($key, 1) . "=";
+ my ($value, $conf) = split(/=/, $menuitem->{$key}, 2);
+ $value = $::myconfig{$value} . "/$conf" if ($conf);
+ $str .= $::form->escape($value, 1);
+ }
+
+ $str .= '"';
+
+ if ($other) {
+ foreach my $key (keys(%{$other})) {
+ $str .= qq| ${key}="| . $::form->quote($other->{$key}) . qq|"|;
+ }
+ }
+
+ $str .= ">";
+
+ $main::lxdebug->leave_sub();
+
+ return $str;
+}
+
+1;
--- /dev/null
+package SL::Layout::Dispatcher;
+
+use strict;
+
+use SL::Layout::Admin;
+use SL::Layout::Login;
+use SL::Layout::Classic;
+use SL::Layout::V3;
+use SL::Layout::V4;
+use SL::Layout::Javascript;
+
+sub new {
+ my ($class, %params) = @_;
+
+ return SL::Layout::Classic->new if $params{style} eq 'old';
+ return SL::Layout::V3->new if $params{style} eq 'v3';
+ return SL::Layout::V4->new if $params{style} eq 'v4';
+ return SL::Layout::Javascript->new if $params{style} eq 'neu';
+ return SL::Layout::Admin->new if $params{style} eq 'admin';
+ return SL::Layout::Login->new if $params{style} eq 'login';
+ return SL::Layout::None->new;
+}
+
+1;
--- /dev/null
+package SL::Layout::Javascript;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+use List::Util qw(max);
+use URI;
+
+sub init_sub_layouts {
+ [ SL::Layout::None->new ]
+}
+
+sub pre_content {
+ &display
+}
+
+sub start_content {
+ "<div id='content'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+sub stylesheets {
+ $_[0]->add_stylesheets(qw(
+ dhtmlsuite/menu-item.css
+ dhtmlsuite/menu-bar.css
+ menu.css
+ ));
+ $_[0]->SUPER::stylesheets;
+}
+
+sub display {
+ my ($self) = @_;
+ my $form = $main::form;
+
+ my $callback = $form->unescape($form->{callback});
+ $callback = URI->new($callback)->rel($callback) if $callback;
+ $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
+
+ $self->render("menu/menunew", { partial => 1, no_output => 1 },
+ force_ul_width => 1,
+ date => $self->clock_line,
+ menu_items => $self->acc_menu,
+ callback => $callback,
+ );
+}
+
+sub clock_line {
+ my $form = $main::form;
+
+ my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
+ $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
+ = localtime(time);
+ $Monat += 1;
+ $Jahrestag += 1;
+ $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
+ $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
+ $Jahr += 1900;
+ my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
+ "Donnerstag", "Freitag", "Samstag");
+ my @Monatsnamen = ("", "Januar", "Februar", "März",
+ "April", "Mai", "Juni", "Juli",
+ "August", "September", "Oktober", "November",
+ "Dezember");
+ return
+ $Wochentage[$Wochentag] . ", der "
+ . $Monatstag . "."
+ . $Monat . "."
+ . $Jahr . " - ";
+}
+
+sub acc_menu {
+ my ($self) = @_;
+
+ my $menu = $self->menu;
+
+ my $all_items = [];
+ $self->create_menu($menu, $all_items);
+
+ my $item = { 'subitems' => $all_items };
+ calculate_width($item);
+
+ return $all_items;
+}
+
+sub calculate_width {
+ my $item = shift;
+
+ $item->{max_width} = max map { length $_->{title} } @{ $item->{subitems} };
+
+ foreach my $subitem (@{ $item->{subitems} }) {
+ calculate_width($subitem) if ($subitem->{subitems});
+ }
+}
+
+sub create_menu {
+ my ($self, $menu, $all_items, $parent, $depth) = @_;
+ my $html;
+
+ my $form = $main::form;
+ my %myconfig = %main::myconfig;
+
+ die if ($depth * 1 > 5);
+
+ my @menuorder = $menu->access_control(\%myconfig, $parent);
+ $parent .= "--" if ($parent);
+
+ foreach my $name (@menuorder) {
+ substr($name, 0, length($parent), "");
+ next if (($name eq "") || ($name =~ /--/));
+
+ my $menu_item = $menu->{"${parent}${name}"};
+ my $item = { 'title' => $::locale->text($name) };
+ push @{ $all_items }, $item;
+
+ if ($menu_item->{submenu} || !defined($menu_item->{module})) {
+ $item->{subitems} = [];
+ $item->{image} = _icon_path("$name.png");
+ $self->create_menu($menu, $item->{subitems}, "${parent}${name}", $depth * 1 + 1);
+
+ } else {
+ $item->{image} = _icon_path("${parent}${name}.png");
+ $menu->menuitem_new("${parent}${name}", $item);
+ }
+ }
+}
+
+sub _icon_path {
+ my ($label, $size) = @_;
+
+ $size ||= 16;
+
+ my $img = "image/icons/${size}x${size}/$label";
+
+ return unless -f $img;
+ return $img;
+}
+
+1;
--- /dev/null
+package SL::Layout::Login;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+sub new {
+ my ($class, @slurp) = @_;
+
+ my $self = $class->SUPER::new(@slurp);
+
+ $self->add_sub_layouts([
+ SL::Layout::None->new,
+ ]);
+
+ $self;
+}
+
+sub start_content {
+ "<div id='login' class='login'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+1;
--- /dev/null
+package SL::Layout::MenuLeft;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+use URI;
+
+use List::MoreUtils qw(apply);
+
+sub stylesheets {
+ qw(icons16.css icons24.css menu.css)
+}
+
+sub javascripts_inline {
+ my $self = shift;
+ my $sections = [ section_menu($self->menu) ];
+ $self->render('menu/menu', { partial => 1, no_output => 1 },
+ sections => $sections,
+ )
+}
+
+sub javascripts {
+ 'js/jquery.cookie.js';
+}
+
+sub pre_content {
+ "<div id='html-menu'></div>\n";
+}
+
+sub start_content {
+ "<div id='content' class='html-menu'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+sub section_menu {
+ $::lxdebug->enter_sub(2);
+ my ($menu, $level, $id_prefix) = @_;
+ my @menuorder = $menu->access_control(\%::myconfig, $level);
+ my @items;
+
+ my $id = 0;
+
+ for my $item (@menuorder) {
+ my $menuitem = $menu->{$item};
+ my $olabel = apply { s/.*--// } $item;
+ my $ml = apply { s/--.*// } $item;
+ my $icon_class = apply { y/ /-/ } $item;
+ my $spacer = "s" . (0 + $item =~ s/--/--/g);
+
+ next if $level && $item ne "$level--$olabel";
+
+ my $label = $::locale->text($olabel);
+
+ $menuitem->{module} ||= $::form->{script};
+ $menuitem->{action} ||= "section_menu";
+ $menuitem->{href} ||= "$menuitem->{module}?action=$menuitem->{action}";
+
+ # add other params
+ foreach my $key (keys %$menuitem) {
+ next if $key =~ /target|module|action|href/;
+ $menuitem->{href} .= "&" . $::form->escape($key, 1) . "=";
+ my ($value, $conf) = split(/=/, $menuitem->{$key}, 2);
+ $value = $::myconfig{$value} . "/$conf" if ($conf);
+ $menuitem->{href} .= $::form->escape($value, 1);
+ }
+
+ my $anchor = $menuitem->{href};
+
+ my @common_args = ($label, $spacer, "$id_prefix\_$id");
+
+ if (!$level) { # toplevel
+ push @items, [ @common_args, "icon24 $icon_class", 'm' ];
+ # make_image(size => 24, label => $item),
+ push @items, section_menu($menu, $item, "$id_prefix\_$id");
+ } elsif ($menuitem->{submenu}) {
+ push @items, [ @common_args, "icon16 submenu", 'sm' ];
+ #make_image(label => 'submenu'),
+ push @items, section_menu($menu, $item, "$id_prefix\_$id");
+ } elsif ($menuitem->{module}) {
+ push @items, [ @common_args, "icon16 $icon_class", 'i', $anchor ];
+ #make_image(size => 16, label => $item),
+ }
+ } continue {
+ $id++;
+ }
+
+ $::lxdebug->leave_sub(2);
+ return @items;
+}
+
+sub _calc_framesize {
+ my $is_lynx_browser = $ENV{HTTP_USER_AGENT} =~ /links/i;
+ my $is_mobile_browser = $ENV{HTTP_USER_AGENT} =~ /mobile/i;
+ my $is_mobile_style = $::form->{stylesheet} =~ /mobile/i;
+
+ return $is_mobile_browser && $is_mobile_style ? 130
+ : $is_lynx_browser ? 240
+ : 200;
+}
+
+sub _show_images {
+ # don't show images in links
+ _calc_framesize() != 240;
+}
+
+1;
+
+__END__
+
+=encoding utf-8
+
+=head1 NAME
+
+SL::Layout::MenuLeft - ex html meanu, now only left menu
+
+=head1 DOM MODEL
+
+Data will be embedded into the page as a json array of entries.
+Each entry is another array with the following fields:
+
+ 0: title
+ 1: indentation classes
+ 2: unique id
+ 3: icon classes
+ 4: role classes
+
+From each entry the following dom will be generated, with [0] being entry 0 of
+the data array:
+
+ <div id="mi[2]" class="mi [4] [1]">
+ <a class="ml">
+ <span class="mii ms">
+ <div class="[3]"></div>
+ </span>
+ <span class="mic">[0]</span>
+ </a>
+ </div>
+
+The classes are minified to keep the json somewhat in check, their meaning is as follows:
+
+=over 4
+
+=item Indentation Classes
+
+ s0: No indentation
+ s1: One level of indentation
+ s2: Two levels of indentation
+
+=item Icon Classes
+
+Each icon consists of two classes, one for the icon, and one for the size.
+The icon classes are taken from the file names, for example C<Master-Data> is
+the icon for master data, and refers to Master-Icon.png.
+
+ icon16: 16x16 icon
+ icon24: 24x24 icon
+ icon32: 32x32 icon
+
+=item Role Classes
+
+Role classes may be used to style types of links differently. Currently used:
+
+ ml: menu link, any <a> tag will have this
+ mi: menu item, the enclosing div for each entry has this
+ mii: menu item icon, the enclosing div for the icons has this
+ ms: menu spacer, the first <span> in the link will have this
+ m: menu, only top level entries have this
+ i: item, only leaf entries have this
+ sm: sub menu, eveything that is not top nor leaf has this
+ mic: menu item content, the span with the human readable description has this
+
+=back
+
+=head1 BUGS
+
+none yet
+
+=head1 AUTHOR
+
+Sven Schoeling E<lt>s.schoeling@linet-services.deE<gt>
+
+=cut
--- /dev/null
+package SL::Layout::None;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+sub javascripts_inline {
+ _setup_formats(),
+ _setup_focus(),
+}
+
+sub use_javascript {
+ my $self = shift;
+ qw(
+ js/jquery.js
+ js/common.js
+ ),
+ $self->SUPER::use_javascript(@_);
+}
+
+sub use_stylesheet {
+ my $self = shift;
+ qw(
+ main.css
+ ),
+ $self->SUPER::use_stylesheet(@_);
+}
+
+sub _setup_formats {
+ $::form->parse_html_template('layout/javascript_setup')
+}
+
+sub _setup_focus {
+ if ($::request->{layout}->focus) {
+ return $::form->parse_html_template('layout/focus_setup', {
+ focus => $::request->{layout}->focus,
+ })
+ } else {
+ return ();
+ }
+}
+
+1;
--- /dev/null
+package SL::Layout::Top;
+
+use strict;
+use parent qw(SL::Layout::Base);
+
+sub pre_content {
+ my ($self) = @_;
+
+ $self->SUPER::render('menu/header', { partial => 1, no_output => 1 },
+ now => DateTime->now_local,
+ is_fastcgi => scalar($::dispatcher->interface_type =~ /fastcgi/i),
+ is_links => scalar($ENV{HTTP_USER_AGENT} =~ /links/i));
+}
+
+sub stylesheets {
+ 'frame_header/header.css';
+}
+
+1;
+
+__END__
+
+=encoding utf-8
+
+=head1 NAME
+
+SL::Layout::Top - Top line in classic and v4 menu.
+
+=head1 DOM MODEL
+
+The entire top line is rendered into a div with id C<frame-header>. The following classes are used:
+
+ frame-header-element: any continuous block of entries
+ frame-header-left: the left floating part
+ frame-header-right: the right floating part
+ frame-header-center: the centered part
+
+=head1 BUGS
+
+none yet. :)
+
+=head1 AUTHOR
+
+Sven Schoeling E<lt>s.schoeling@linet-services.deE<gt>
+
+=cut
--- /dev/null
+package SL::Layout::V3;
+
+use strict;
+use parent qw(SL::Layout::Base);
+use SL::Layout::Css;
+
+use URI;
+
+sub init_sub_layouts {
+ [ SL::Layout::None->new ]
+}
+
+sub pre_content {
+ &render;
+}
+
+sub start_content {
+ "<div id='content'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+sub render {
+ my ($self) = @_;
+
+ my $callback = $::form->unescape($::form->{callback});
+ $callback = URI->new($callback)->rel($callback) if $callback;
+ $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
+
+ $self->SUPER::render('menu/menuv3', { no_menu => 1, no_output => 1 },
+ force_ul_width => 1,
+ date => $self->clock_line,
+ menu => $self->print_menu,
+ callback => $callback,
+ );
+}
+
+1;
--- /dev/null
+package SL::Layout::V4;
+
+use strict;
+use parent qw(SL::Layout::Base);
+use SL::Layout::Css;
+use SL::Layout::Top;
+
+use URI;
+
+sub init_sub_layouts {
+ [
+ SL::Layout::Top->new,
+ SL::Layout::None->new,
+ ]
+}
+
+sub start_content {
+ "<div id='content'>\n";
+}
+
+sub end_content {
+ "</div>\n";
+}
+
+sub pre_content {
+ my ($self) = @_;
+
+ $self->{sub_class} = 1;
+
+ my $callback = $::form->unescape($::form->{callback});
+ $callback = URI->new($callback)->rel($callback) if $callback;
+ $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
+
+ $self->SUPER::pre_content .
+
+ $self->SUPER::render('menu/menuv4', { no_menu => 1, no_output => 1 },
+ force_ul_width => 1,
+ date => $self->clock_line,
+ menu => $self->print_menu,
+ callback => $callback,
+ );
+}
+
+1;
return $self;
}
-sub menuitem {
- $main::lxdebug->enter_sub();
-
- my ($self, $myconfig, $form, $item) = @_;
-
- my $module = $self->{$item}{module} || $form->{script};
- my $action = $self->{$item}{action} || "section_menu";
- my $target = $self->{$item}{target} || "";
-
- my $level = $form->escape($item);
-
- my $style = 'style="vertical-align:top"';
- my $target_token = ($target)
- ? "target='$target'" : '';
-
- my $href = ($self->{$item}{href})
- ? $form->escape($self->{$item}{href})
- : "$module?action=$action&level=$level";
-
- my @vars = ($self->{$item}{href})
- ? qw(module target href)
- : qw(module action target href);
-
-# map { delete $self->{$item}{$_} } @vars;
-
- # add other params
- foreach my $key (keys %{ $self->{$item} }) {
- $href .= "&" . $form->escape($key, 1) . "=";
- my ($value, $conf) = split(/=/, $self->{$item}{$key}, 2);
- $value = $myconfig->{$value} . "/$conf" if ($conf);
- $href .= $form->escape($value, 1);
- }
-
- my $str = "<a href='$href' $target_token $style>";
-
- $main::lxdebug->leave_sub();
-
- return $str;
-}
-
-sub menuitem_js {
- my ($self, $myconfig, $form, $item) = @_;
-
- my $module = $form->{script};
- my $action = "section_menu";
-
- #if ($self->{$item}{module}) {
- $module = $self->{$item}{module};
-
- #}
- if ($self->{$item}{action}) {
- $action = $self->{$item}{action};
- }
-
- my $level = $form->escape($item);
- my $str = qq|$module?action=$action&level=$level|;
- my @vars = qw(module action target href);
-
- if ($self->{$item}{href}) {
- $str = qq|$self->{$item}{href}|;
- @vars = qw(module target href);
- }
-
- map { delete $self->{$item}{$_} } @vars;
-
- # add other params
- foreach my $key (keys %{ $self->{$item} }) {
- $str .= "&" . $form->escape($key, 1) . "=";
- my ($value, $conf) = split(/=/, $self->{$item}{$key}, 2);
- $value = $myconfig->{$value} . "/$conf" if ($conf);
- $str .= $form->escape($value, 1);
- }
-
- $str .= " ";
-
-}
-
sub menuitem_new {
$main::lxdebug->enter_sub();
$main::lxdebug->leave_sub();
}
-sub menuitem_v3 {
- $main::lxdebug->enter_sub();
-
- my ($self, $myconfig, $form, $item, $other) = @_;
-
- my $module = $form->{script};
- my $action = "section_menu";
- my $target = "";
-
- if ($self->{$item}{module}) {
- $module = $self->{$item}{module};
- }
- if ($self->{$item}{action}) {
- $action = $self->{$item}{action};
- }
- if ($self->{$item}{target}) {
- $target = $self->{$item}{target};
- }
-
- my $level = $form->escape($item);
-
- my $str = qq|<a href="$module?action=| . $form->escape($action) . qq|&level=| . $form->escape($level);
-
- my @vars = qw(module action target href);
-
- if ($self->{$item}{href}) {
- $str = qq|<a href=$self->{$item}{href}|;
- @vars = qw(module target href);
- }
-
- map { delete $self->{$item}{$_} } @vars;
-
- # add other params
- foreach my $key (keys %{ $self->{$item} }) {
- $str .= "&" . $form->escape($key, 1) . "=";
- my ($value, $conf) = split(/=/, $self->{$item}{$key}, 2);
- $value = $myconfig->{$value} . "/$conf" if ($conf);
- $str .= $form->escape($value, 1);
- }
-
- $str .= '"';
-
- if ($target) {
- $str .= qq| target="| . $form->quote($target) . qq|"|;
- }
-
- if ($other) {
- foreach my $key (keys(%{$other})) {
- $str .= qq| ${key}="| . $form->quote($other->{$key}) . qq|"|;
- }
- }
-
- $str .= ">";
-
- $main::lxdebug->leave_sub();
-
- return $str;
-}
-
-sub menuitem_XML {
- $main::lxdebug->enter_sub();
-
- my ($self, $myconfig, $form, $item, $other) = @_;
-
- my $module = $form->{script};
- my $action = "section_menu";
- my $target = "";
-
- if ($self->{$item}{module}) {
- $module = $self->{$item}{module};
- }
- if ($self->{$item}{action}) {
- $action = $self->{$item}{action};
- }
- if ($self->{$item}{target}) {
- $target = $self->{$item}{target};
- }
-
- my $level = $form->escape($item);
-
- my $str = qq| link="$module?action=| . $form->escape($action) .
- qq|&level=| . $form->escape($level);
-
- my @vars = qw(module action target href);
-
- if ($self->{$item}{href}) {
- $str = qq| link=$self->{$item}{href}|;
- @vars = qw(module target href);
- }
-
- map { delete $self->{$item}{$_} } @vars;
-
- # add other params
- foreach my $key (keys %{ $self->{$item} }) {
- $str .= "&" . $form->escape($key, 1) . "=";
- my ($value, $conf) = split(/=/, $self->{$item}{$key}, 2);
- $value = $myconfig->{$value} . "/$conf" if ($conf);
- $str .= $form->escape($value, 1);
- }
-
- $str .= '"';
-
-
-
- if ($other) {
- foreach my $key (keys(%{$other})) {
- $str .= qq| ${key}="| . $form->quote($other->{$key}) . qq|"|;
- }
- }
-
-
- $main::lxdebug->leave_sub();
-
- return $str;
-}
-
sub access_control {
$main::lxdebug->enter_sub(2);
foreach my $column (values %{ $self->{columns} }) {
$column->{visible} = $self->{options}->{std_column_visibility} unless defined $column->{visible};
}
-
+
if( $::form->{report_generator_csv_options_for_import} ) {
foreach my $key (keys %{ $self->{columns} }) {
$self->{columns}{$key}{text} = $key;
}
sub generate_with_headers {
- my $self = shift;
+ my ($self, %params) = @_;
my $format = lc $self->{options}->{output_format};
my $form = $self->{form};
if ($format eq 'html') {
my $title = $form->{title};
$form->{title} = $self->{title} if ($self->{title});
- $form->header();
+ $form->header(no_layout => $params{no_layout});
$form->{title} = $title;
print $self->generate_html_content();
my $self = shift;
my $variables = $self->prepare_html_content();
- return $self->{form}->parse_html_template($self->{options}->{html_template}, $variables);
+ my $stuff = $self->{form}->parse_html_template($self->{options}->{html_template}, $variables);
+ return $stuff;
}
sub _cm2bp {
$dbh->disconnect;
if ($update_available) {
- $form->{"stylesheet"} = "lx-office-erp.css";
$form->{"title"} = $main::locale->text("Dataset upgrade");
$form->header();
print $form->parse_html_template("dbupgrade/header");
# remove lock file
unlink($::lx_office_conf{paths}->{userspath} . "/nologin");
- my $menufile =
- $self->{"menustyle"} eq "v3" ? "menuv3.pl" :
- $self->{"menustyle"} eq "neu" ? "menunew.pl" :
- $self->{"menustyle"} eq "js" ? "menujs.pl" :
- "menu.pl";
-
- print $form->parse_html_template("dbupgrade/footer", { "menufile" => $menufile });
+ print $form->parse_html_template("dbupgrade/footer");
$rc = -2;
}
$locale = $::locale;
$auth = $::auth;
- $form->{stylesheet} = "lx-office-erp.css";
+ $::request->{layout} = SL::Layout::Dispatcher->new(style => 'admin');
+ $::request->{layout}->use_stylesheet("lx-office-erp.css");
$form->{favicon} = "favicon.ico";
if ($form->{action}) {
my $form = $main::form;
my $locale = $main::locale;
- $form->{stylesheet} = "lx-office-erp.css";
+ $::request->{layout}->use_stylesheet("lx-office-erp.css");
$form->{title} = $locale->text("Dataset upgrade");
$form->header();
# account where AR_tax or AP_tax is set are not orphaned if they are used as
# tax-o-matic account
- if ( $form->{id} && !$form->{orphaned} && ($form->{link} =~ m/(AP_tax|AR_tax)/) ) {
+ if ( $form->{id} && $form->{orphaned} && ($form->{link} =~ m/(AP_tax|AR_tax)/) ) {
if (SL::DB::Manager::Tax->find_by(chart_id => $form->{id})) {
$form->{orphaned} = 0;
}
$ca->{link_edit_account} = $link_edit_account . '&id=' . E($ca->{id});
}
- $form->use_stylesheet("list_accounts.css");
+ $::request->{layout}->use_stylesheet("list_accounts.css");
$form->{title} = $locale->text('Chart of Accounts');
$form->header;
$form->{title} = $locale->text('Add Price Factor');
$form->{callback} ||= build_std_url('action=add_price_factor');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_price_factor');
$form->{title} = $locale->text('Edit Price Factor');
$form->{callback} ||= build_std_url('action=add_price_factor');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
AM->get_price_factor(\%myconfig, $form);
$form->{title} = $locale->text('Add Warehouse');
$form->{callback} ||= build_std_url('action=add_warehouse');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_warehouse');
$form->{title} = $locale->text('Edit Warehouse');
$form->{callback} ||= build_std_url('action=list_warehouses');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_warehouse');
$options{"CAN_EDIT"} = $form->{"edit"};
if ($form->{edit}) {
- $form->{fokus} = "Form.content";
+ $::request->{layout}->focus("#edit_content");
} else {
$options{"content"} = "\n\n" if (!$options{"content"});
'-default' => $form->{"globalproject_id"} ));
$form->header;
- my $onload = qq|;setupDateFormat('|. $myconfig{dateformat} .qq|', '|. $locale->text("Falsches Datumsformat!") .qq|')|;
- $onload .= qq|;setupPoints('|. $myconfig{numberformat} .qq|', '|. $locale->text("wrongformat") .qq|')|;
print qq|
-<body onLoad="$onload">
-
<form method=post action=$form->{script}>
<input type=hidden name=id value=$form->{id}>
delete $form->{header};
print qq|
-<body>
-
<form method=post action=$form->{script}>
|;
<input name=action class=submit type=submit value="|
. $locale->text('Yes') . qq|">
</form>
-
-</body>
-</html>
|;
$main::lxdebug->leave_sub();
$form->all_vc(\%myconfig, "vendor", "AP");
$form->{title} = $locale->text('AP Transactions');
- $form->{fokus} = "search.vendor";
+ $::request->{layout}->focus('#vendor');
$form->{jsscript} = 1;
$form->get_lists("projects" => { "key" => "ALL_PROJECTS", "all" => 1 },
$form->error($locale->text("Transaction has already been cancelled!"));
}
+ $form->error($locale->text('Cannot post storno for a closed period!'))
+ if ( $form->date_closed($form->{transdate}, \%myconfig));
+
AP->storno($form, \%myconfig, $form->{id});
# saving the history
my ($title, $readonly, $exchangerate, $rows);
my ($notes, $department, $customer, $employee, $amount, $project);
- my ($onload);
my ($ARselected);
$taxcharts{$item->{id}} = $item;
}
- $form->{fokus} = "arledger.customer";
+ $::request->{layout}->focus("#customer");
my $follow_up_vc = $form->{customer};
$follow_up_vc =~ s/--.*?//;
qq|<script type="text/javascript" src="js/show_vc_details.js"></script>| .
qq|<script type="text/javascript" src="js/follow_up.js"></script>|;
- $onload = qq|focus()|;
- $onload .= qq|;setupPoints('|. $myconfig{numberformat} .qq|', '|. $locale->text("wrongformat") .qq|')|;
-
# $amount = $locale->text('Amount');
# $project = $locale->text('Project');
project_labels => \%project_labels,
rows => $rows,
ARselected => $ARselected,
- onload => $onload,
title_str => $title,
follow_up_trans_info => $follow_up_trans_info,
});
}
}
- if ($form->{menubar}) {
- require "bin/mozilla/menu.pl";
- &menubar;
- }
# button for saving history
if($form->{id} ne "") {
print qq| <input type=button class=submit onclick=set_history_window($form->{id}); name=history id=history value=| . $locale->text('history') . qq|> |;
print "
</form>
-
-</body>
-</html>
";
$main::lxdebug->leave_sub();
delete $form->{header};
print qq|
-<body>
-
<form method=post action=$form->{script}>
|;
<input name=action class=submit type=submit value="|
. $locale->text('Yes') . qq|">
</form>
-
-</body>
-</html>
|;
$main::lxdebug->leave_sub();
my $cgi = $::request->{cgi};
my ($customer, $department);
- my ($jsscript, $button1, $button2, $onload);
+ my ($jsscript, $button1, $button2);
# setup customer selection
$form->all_vc(\%myconfig, "customer", "AR");
my $title = $locale->text('Select from one of the names below');
print qq|
-<body>
-
<form method=post action=$form->{script}>
<table width=100%>
<input class=submit type=submit name=action value="|
. $locale->text('Continue') . qq|">
</form>
-
-</body>
-</html>
|;
$main::lxdebug->leave_sub();
$::form->{title} = $::locale->text('List Transactions') . " - " . $::locale->text('Account') . " $::form->{accno}";
- my $onload = qq|focus()|;
- $onload .= qq|;setupDateFormat('$::myconfig{dateformat}', '|. $::locale->text("Falsches Datumsformat!") .qq|')|;
- $onload .= qq|;setupPoints('$::myconfig{numberformat}', '|. $::locale->text("wrongformat") .qq|')|;
-
$::form->header;
print $::form->parse_html_template('ca/list', {
- onload => $onload,
year => DateTime->today->year,
cash => $::instance_conf->get_accounting_method eq 'cash',
});
map { $form->{$_} = $options{$_} if ($options{$_}) } qw(no_services no_assemblies assemblies click_button);
my $parts = Common->retrieve_parts(\%myconfig, $form, $order_by, $order_dir);
- my $onload;
if (0 == scalar(@{$parts})) {
$form->show_generic_information($locale->text("No part was found matching the search parameters."));
} elsif (1 == scalar(@{$parts})) {
- $onload = "part_selected('1')";
+ $::request->{layout}->add_javascripts_inline("part_selected('1')");
}
map { $parts->[$_]->{selected} = $_ ? 0 : 1; } (0..$#{$parts});
$form->{formname} ||= 'Form';
$form->{title} = $locale->text("Select a part");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("generic/part_selection", { "HEADER" => \@header,
- "PARTS" => $parts,
- "onload" => $onload });
+ "PARTS" => $parts, });
$main::lxdebug->leave_sub();
}
my $delivery = Common->retrieve_delivery_customer(\%myconfig, $form, $order_by, $order_dir);
map({ $delivery->[$_]->{"selected"} = $_ ? 0 : 1; } (0..$#{$delivery}));
- my $onload;
if (0 == scalar(@{$delivery})) {
$form->show_generic_information($locale->text("No Customer was found matching the search parameters."));
} elsif (1 == scalar(@{$delivery})) {
- $onload = "customer_selected('1')";
+ $::request->{layout}->add_javascripts_inline("customer_selected('1')");
}
my $callback = "$form->{script}?action=delivery_customer_selection&";
@header_sort);
$form->{"title"} = $locale->text("Select a Customer");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("generic/select_delivery_customer", { "HEADER" => \@header,
- "DELIVERY" => $delivery,
- "onload" => $onload });
+ "DELIVERY" => $delivery, });
$main::lxdebug->leave_sub();
}
my $vendor = Common->retrieve_vendor(\%myconfig, $form, $order_by, $order_dir);
map({ $vendor->[$_]->{"selected"} = $_ ? 0 : 1; } (0..$#{$vendor}));
- my $onload;
if (0 == scalar(@{$vendor})) {
$form->show_generic_information($locale->text("No Vendor was found matching the search parameters."));
} elsif (1 == scalar(@{$vendor})) {
- $onload = "vendor_selected('1')";
+ $::request->{layout}->add_javascripts_inline("vendor_selected('1')");
}
my $callback = "$form->{script}?action=vendor_selection&";
@header_sort);
$form->{"title"} = $locale->text("Select a Customer");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("generic/select_vendor", { "HEADER" => \@header,
- "VENDOR" => $vendor,
- "onload" => $onload });
+ "VENDOR" => $vendor, });
$main::lxdebug->leave_sub();
}
my ($variable_string, $formel) = split /###/,$form->{formel};
my @variable;
- my $onload; # note! this sub is mostly called over a javascript invocation, and it's unlikey that onload is set.
foreach my $item (split m/;/, $variable_string) {
next unless $item =~ m/^ \s* (\w+) \s* = \s* (\w+) \s* (\w+) \s* $/x;
$form->{formel} = $formel;
$form->{title} = $locale->text("Please enter values");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("generic/calculate_qty", { "HEADER" => \@header,
- "VARIABLES" => \@variable,
- "onload" => $onload });
+ "VARIABLES" => \@variable, });
$main::lxdebug->leave_sub();
}
my $locale = $main::locale;
$form->{title} = $locale->text("Enter longdescription");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("generic/set_longdescription");
$main::lxdebug->leave_sub();
$sort =~ s/.*\.(.*)/$1/;
$form->{title} = $locale->text("History");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template( "common/show_history", {
"DATEN" => $form->get_history($dbh,$form->{input_name},"",$form->{order}),
"SUCCESS" => ($form->get_history($dbh,$form->{input_name}) ne "0"),
uc($sort) => 1,
- uc($sort)."BY" => $sortby
+ uc($sort)."BY" => $sortby,
} );
$dbh->disconnect();
$form->{title} = $form->{vc} eq "customer" ?
$locale->text("Customer details") : $locale->text("Vendor details");
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template("common/show_vc_details", { "is_customer" => $form->{vc} eq "customer" });
$main::lxdebug->leave_sub();
}
$referer = $script . "?action=mark_as_paid&mark_as_paid=1&id=$form->{id}" . $callback;
$form->header();
- print qq|<body>|;
print qq|<p><b>|.$locale->text('Mark as paid?').qq|</b></p>|;
print qq|<input type="button" value="|.$locale->text('yes').qq|" onclick="document.location.href='|.$referer.qq|'"> |;
print qq|<input type="button" value="|.$locale->text('no').qq|" onclick="javascript:history.back();">|;
- print qq|</body></html>|;
}
$main::lxdebug->leave_sub();
my $covs = Common->retrieve_customers_or_vendors(\%myconfig, $form, $order_by, $order_dir, $form->{"is_vendor"}, $form->{"allow_both"});
map({ $covs->[$_]->{"selected"} = $_ ? 0 : 1; } (0..$#{$covs}));
- my $onload;
if (0 == scalar(@{$covs})) {
$form->show_generic_information(sprintf($locale->text("No %s was found matching the search parameters."), $type));
} elsif (1 == scalar(@{$covs})) {
- $onload = "cov_selected('1')";
+ $::request->{layout}->add_javascripts_inline("cov_selected('1')");
}
my $callback = "$form->{script}?action=cov_selection_internal&";
$form->{"title"} = $form->{is_vendor} ? $locale->text("Select a vendor") : $locale->text("Select a customer");
$form->header();
print($form->parse_html_template("generic/cov_selection", { "HEADER" => \@header,
- "COVS" => $covs,
- "onload" => $onload }));
+ "COVS" => $covs, }));
$main::lxdebug->leave_sub();
}
# Standard Konto für Umlaufvermögen
my $accno_arap = IS->get_standard_accno_current_assets(\%myconfig, \%$form);
- # Entsprechend präventiv die Auswahlliste für Kontonummer
+ # Entsprechend präventiv die Auswahlliste für Kontonummer
# auch mit value= zusammenbauen (s.a. oben bugfix 1771)
# Wichtig: Auch das Template anpassen, damit hidden input korrekt die "
# escaped.
$form->{defaultcurrency} = $form->{currency} = $form->{oldcurrency} =
$curr[0];
- # Entsprechend präventiv die Auswahlliste für Währungen
+ # Entsprechend präventiv die Auswahlliste für Währungen
# auch mit value= zusammenbauen (s.a. oben bugfix 1771)
$form->{selectcurrency} = "";
map { $form->{selectcurrency} .= "<option value=\"$_\">$_</option>\n" } @curr;
$auth->assert('cash');
my ($vc, $arap, $exchangerate);
- my ($onload);
if ($form->{ $form->{vc} } eq "") {
map { $form->{"addr$_"} = "" } (1 .. 4);
$form->header;
$arap = lc $form->{ARAP};
- $onload = qq|focus()|;
- $onload .= qq|;setupDateFormat('|. $myconfig{dateformat} .qq|', '|. $locale->text("Falsches Datumsformat!") .qq|')|;
- $onload .= qq|;setupPoints('|. $myconfig{numberformat} .qq|', '|. $locale->text("wrongformat") .qq|')|;
print $::form->parse_html_template('cp/form_header', {
is_customer => $form->{vc} eq 'customer',
is_receipt => $form->{type} eq 'receipt',
- onload => $onload,
arap => $arap,
vccontent => $vc,
});
$form->{customer_id} = $form->{AR}[0]{customer_id};
}
- # search by invoicenumber,
- if ($form->{invnumber}) {
+ # search by invoicenumber,
+ if ($form->{invnumber}) {
$form->{open} ='Y'; # only open invoices
if ($form->{ARAP} eq 'AR'){
# ar_transactions automatically searches by $form->{customer_id} or else
$form->{jsscript} = 1;
$form->{title} = $form->{IS_CUSTOMER} ? $locale->text('Customers') : $locale->text('Vendors');
- $form->{fokus} = 'Form.name';
+ $::request->{layout}->focus('#name');
$form->header();
print $form->parse_html_template('ct/search');
$form->{contacts_label} = \&_contacts_label;
$form->{taxzone_id} = 0 if !$form->{id};
$form->{jsscript} = 1;
- $form->{fokus} = "ct.greeting";
$form->{SHIPTO_ALL} = [ +{ shipto_id => '0', shiptoname => $::locale->text('All') }, @{ $form->{SHIPTO} } ];
+ $::request->{layout}->focus("#greeting");
$form->{title} = $form->{title_save}
|| $locale->text("$form->{title} " . ucfirst $form->{db}) . ($form->{title} eq "Edit" ? " $form->{name}" : '');
$form->{title} = $locale->text('Start Dunning Process');
$form->{jsscript} = 1;
- $form->{fokus} = "search.customer";
+ $::request->{layout}->focus('#customer');
$form->header();
print $form->parse_html_template("dunning/add");
'no_opendocument' => 1,);
$form->header();
- $form->{onload} = "document.getElementsByName('language_id')[0].disabled =
- !document.getElementsByName('force_lang')[0].checked;";
print $form->parse_html_template("dunning/show_invoices");
$main::lxdebug->leave_sub();
$main::auth->assert('dunning_edit');
$form->{"title"} = $locale->text("Set eMail text");
- $form->header();
+ $form->header(no_layout => 1);
print($form->parse_html_template("dunning/set_email"));
$main::lxdebug->leave_sub();
$form->{jsscript} = 1;
$form->{title} = $locale->text('Dunnings');
- $form->{fokus} = "search.customer";
+ $::request->{layout}->focus('#customer');
$form->header();
- $form->{onload} = qq|focus()|
- . qq|;setupDateFormat('|. $myconfig{dateformat} .qq|', '|. $locale->text("Falsches Datumsformat!") .qq|')|
- . qq|;setupPoints('|. $myconfig{numberformat} .qq|', '|. $locale->text("wrongformat") .qq|')|;
-
print $form->parse_html_template("dunning/search");
$main::lxdebug->leave_sub();
$report->set_options_from_form();
- $form->{onload} = "document.getElementsByName('language_id')[0].disabled =
- !document.getElementsByName('force_lang')[0].checked;";
$report->generate_with_headers();
$main::lxdebug->leave_sub();
$form->{oldvcname} = $form->{"old$form->{vc}"};
$form->{oldvcname} =~ s/--.*//;
- $form->{onload} = "";
if ($form->{resubmit}) {
+ my $dispatch_to_popup = '';
if ($form->{format} eq "html") {
- $form->{onload} = "window.open('about:blank','Beleg'); document.do.target = 'Beleg';";
+ $dispatch_to_popup .= "window.open('about:blank','Beleg'); document.do.target = 'Beleg';";
}
# emulate click for resubmitting actions
- $form->{onload} .= "document.do.${_}.click(); " for grep { /^action_/ } keys %$form;
- $form->{onload} .= "document.do.submit();"
+ $dispatch_to_popup .= "document.do.${_}.click(); " for grep { /^action_/ } keys %$form;
+ $dispatch_to_popup .= "document.do.submit();";
+ $::request->{layout}->add_javascripts_inline("\$(function(){$dispatch_to_popup)");
}
my $follow_up_vc = $form->{ $form->{vc} eq 'customer' ? 'customer' : 'vendor' };
get_basic_bin_wh_info($stock_info);
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template('do/stock_in_form', { 'UNITS' => $units_data,
'STOCK_INFO' => $stock_info,
'PART_INFO' => $part_info, });
}
}
- $form->header();
+ $form->header(no_layout => 1);
print $form->parse_html_template('do/stock_out_form', { 'UNITS' => $units_data,
'WHCONTENTS' => $form->{delivered} ? $stock_info : \@contents,
'PART_INFO' => $part_info, });
restore_form($form->{SAVED_FORM}, 1) if ($form->{SAVED_FORM});
delete $form->{SAVED_FORM};
- $form->{SAVED_FORM} = save_form(qw(stylesheet login password));
+ $form->{SAVED_FORM} = save_form(qw(login password));
$form->{remove_draft} = 1;
$form->header();
$draft_nextsub = "add" unless ($draft_nextsub);
delete $form->{action};
- my $saved_form = save_form(qw(stylesheet login password));
+ my $saved_form = save_form(qw(login password));
$form->header();
print($form->parse_html_template("drafts/load",
$form->{draft_description} = $description;
$form->{remove_draft} = 'checked';
}
- # Ich vergesse bei Rechnungsentwürfe das Rechnungsdatum zu ändern. Dadurch entstehen
+ # Ich vergesse bei Rechnungsentwürfe das Rechnungsdatum zu ändern. Dadurch entstehen
# ungültige Belege. Vielleicht geht es anderen ähnlich jan 19.2.2011
$form->{invdate} = $form->current_date(\%myconfig); # Aktuelles Rechnungsdatum ...
$form->{duedate} = $form->current_date(\%myconfig); # Aktuelles Fälligkeitsdatum ...
$form->{jsscript} = 1;
- $form->header();
+ $form->header(no_layout => $::form->{POPUP_MODE});
print $form->parse_html_template('fu/add_edit');
$main::lxdebug->leave_sub();
);
$::form->{ALL_EMPLOYEES} = SL::DB::Manager::Employee->get_all(query => [ deleted => 0 ]);
- my $onload = "focus()"
- . qq|;setupDateFormat('|. $::myconfig{dateformat} . qq|', '| . $::locale->text("Falsches Datumsformat!") . qq|')|
- . qq|;setupPoints('|. $::myconfig{numberformat} . qq|', '| . $::locale->text("wrongformat") . qq|')|;
-
$::form->header;
print $::form->parse_html_template('gl/search', {
- onload => $onload,
department_label => sub { ("$_[0]{description}--$_[0]{id}")x2 },
employee_label => sub { "$_[0]{id}--$_[0]{name}" },
});
$data .= $sh;
$row->{balance}->{data} = $data;
-
+
if ( !$form->{report_generator_csv_options_for_import} ) {
$report->add_separator();
$report->add_data($row);
s/option>\Q$::form->{department}\E/option selected>$::form->{department}/;
if ($init) {
- $::form->{fokus} = "gl.reference";
+ $::request->{layout}->focus("#reference");
$::form->{taxincluded} = "1";
} else {
- $::form->{fokus} = qq|gl.accno_$::form->{rowcount}|;
+ $::request->{layout}->focus("#accno_$::form->{rowcount}");
}
$::form->{previous_id} ||= "--";
$form->header;
print qq|
-<body>
-
<form method=post action=gl.pl>
|;
# $form->header;
#
# print qq|
-#<body>
# <form method=post action=ic.pl>
# <table width=100%>
# <tr>
# . $locale->text('TOP100') . qq|">
#
#</form>
-#</body>
-#</html>
#|;
# $lxdebug->leave_sub();
#} #end list()
my $colspan = $#column_index + 1;
print qq|
-<body>
-
<table width=100%>
<tr>
<th class=listtop colspan=$colspan>$form->{title}</th>
. $locale->text('choice') . qq|">
</form>
-
-</body>
-</html>
|;
$lxdebug->leave_sub();
'bin' => { 'text' => $locale->text('Bin'), },
'deliverydate' => { 'text' => $locale->text('deliverydate'), },
'description' => { 'text' => $locale->text('Part Description'), },
+ 'notes' => { 'text' => $locale->text('Notes'), },
'drawing' => { 'text' => $locale->text('Drawing'), },
'ean' => { 'text' => $locale->text('EAN'), },
'image' => { 'text' => $locale->text('Image'), },
IC->all_parts(\%myconfig, \%$form);
my @columns = qw(
- partnumber description partsgroup bin onhand rop soldtotal unit listprice
+ partnumber description notes partsgroup bin onhand rop soldtotal unit listprice
linetotallistprice sellprice linetotalsellprice lastcost linetotallastcost
priceupdate weight image drawing microfiche invnumber ordnumber quonumber
transdate name serialnumber deliverydate ean projectnumber projectdescription
$form->{defaults} = AM->get_defaults();
- $form->{fokus} = "ic.partnumber";
+ $::request->{layout}->focus("#partnumber");
$form->{CUSTOM_VARIABLES} = CVar->get_custom_variables('module' => 'IC', 'trans_id' => $form->{id});
} @{ $::form->{item_list} };
# delete action variable
- delete @{$::form}{qw(action item_list header)};
+ delete @{$::form}{qw(action item_list)};
print $::form->parse_html_template('io/select_item', { PREVIOUS_FORM => $previous_form,
MODE => $mode,
my $attachment_filename = $form->generate_attachment_filename();
my $subject = $form->{subject} || $form->generate_email_subject();
- $form->{"fokus"} = $form->{"email"} ? "Form.subject" : "Form.email";
+ $::request->{layout}->focus($form->{"email"} ? "#subject" : "#email");
$form->header;
my (@dont_hide_key_list, %dont_hide_key, @hidden_keys);
$TMPL_VAR{creditwarning} = ($form->{creditlimit} != 0) && ($form->{creditremaining} < 0) && !$form->{update};
$TMPL_VAR{is_credit_remaining_negativ} = $form->{creditremaining} =~ /-/;
- $form->{fokus} = "invoice.vendor";
+ $::request->{layout}->focus('#vendor');
my $follow_up_vc = $form->{vendor};
$follow_up_vc =~ s/--\d*\s*$//;
$form->error($locale->text("Invoice has already been storno'd!"));
}
+ $form->error($locale->text('Cannot post storno for a closed period!'))
+ if ( $form->date_closed($form->{invdate}, \%myconfig));
+
my $employee_id = $form->{employee_id};
invoice_links();
prepare_invoice();
$form->header;
print qq|
-<body>
-
<form method=post action=$form->{script}>
|;
$TMPL_VAR{creditwarning} = ($form->{creditlimit} != 0) && ($form->{creditremaining} < 0) && !$form->{update};
$TMPL_VAR{is_credit_remaining_negativ} = $form->{creditremaining} =~ /-/;
- $form->{fokus} = "invoice.customer";
+ $::request->{layout}->focus('#customer');
my $follow_up_vc = $form->{customer};
$follow_up_vc =~ s/--\d*\s*$//;
$form->error($locale->text("Invoice has already been storno'd!"));
}
- map({ my $key = $_; delete($form->{$key}) unless (grep({ $key eq $_ } qw(id login password stylesheet type))); } keys(%{ $form }));
+ map({ my $key = $_; delete($form->{$key}) unless (grep({ $key eq $_ } qw(id login password type))); } keys(%{ $form }));
invoice_links();
prepare_invoice();
$form->header;
print qq|
-<body>
-
<form method="post" action="$form->{script}">
|;
+++ /dev/null
-#=====================================================================
-# LX-Office ERP
-# Copyright (C) 2004
-# Based on SQL-Ledger Version 2.1.9
-# Web http://www.lx-office.org
-#
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 1998-2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors: Christopher Browne
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#######################################################################
-#
-# the frame layout with refractured menu
-#
-# CHANGE LOG:
-# DS. 2002-03-25 Created
-# 2004-12-14 - New Optik - Marco Welter <mawe@linux-studio.de>
-# 2010-08-19 - Icons for sub entries and single click behavior, unlike XUL-Menu
-# JS switchable HTML-menu - Sven Donath <lxo@dexo.de>
-#######################################################################
-
-use strict;
-
-use SL::Menu;
-use Data::Dumper;
-use URI;
-
-use List::MoreUtils qw(apply);
-
-my $menufile = "menu.ini";
-my $nbsp = ' ';
-my $mainlevel;
-
-# end of main
-
-sub display {
- $::lxdebug->enter_sub;
-
- my $callback = $::form->unescape($::form->{callback});
- $callback = URI->new($callback)->rel($callback) if $callback;
- $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
- my $framesize = _calc_framesize();
-
- $::form->header(doctype => 'frameset');
-
- print qq|
-<frameset rows="28px,*" cols="*" framespacing="0" frameborder="0">
- <frame src="controller.pl?action=FrameHeader/header" scrolling="NO">
- <frameset cols="$framesize,*" framespacing="0" frameborder="0" border="0" id="menuframe" name="menuframe">
- <frame src="$::form->{script}?action=acc_menu" name="acc_menu" scrolling="auto" noresize marginwidth="0">
- <frame src="$callback" name="main_window" scrolling="auto">
- </frameset>
- <noframes>
- You need a browser that can read frames to see this page.
- </noframes>
-</frameset>
-</HTML>
-|;
-
- $::lxdebug->leave_sub;
-}
-
-sub acc_menu {
- $::lxdebug->enter_sub;
-
- my $framesize = _calc_framesize() - 2;
- my $menu = Menu->new("menu.ini");
- $mainlevel = $::form->{level};
- $::form->{title} = $::locale->text('kivitendo');
- $::form->header;
-
- print qq|
-<body class="menu">
-
-<div align="left">\n<table width="$framesize" border="0">\n|;
-
- section_menu($menu);
-
- print qq|</table></div>
-</body>
-</html>
-|;
-
- $::lxdebug->leave_sub;
-}
-
-sub section_menu {
- $::lxdebug->enter_sub;
- my ($menu, $level) = @_;
- my @menuorder = $menu->access_control(\%::myconfig, $level);
-
- for my $item (@menuorder) {
- my $menuitem = $menu->{$item};
- my $label = apply { s/.*--// } $item;
- my $ml = apply { s/--.*// } $item;
- my $show = $ml eq $mainlevel;
- my $spacer = $nbsp x (($item =~ s/--/--/g) * 2);
- my $label_icon = $level . "--" . $label . ".png";
-
- next if $level && $item ne "$level--$label";
-
- $label = $::locale->text($label);
-
- $menuitem->{target} ||= "main_window";
-
- my $anchor = $menu->menuitem(\%::myconfig, $::form, $item, $level);
-
- if (!$level) { # toplevel
- my $ml_ = $::form->escape($ml);
- my $image = make_image(icon => $item . '.png', size => 24, label => $label, valign => 'middle');
- my $anchor = "<a href='menu.pl?action=acc_menu&level=$ml_' class='nohover' title='$label'>";
-
- print make_item(a => $anchor, img => $image, label => $label, height => 24);
- section_menu($menu, $item);
-
- } elsif ($menuitem->{submenu}) {
- my $image = make_image(submenu => 1);
- if ($mainlevel && $item =~ /^\Q$mainlevel\E/) {
- print make_item(spacer => $spacer, bold => 1, img => $image, label => $label) if $show;
- section_menu($menu, $item);
- } else {
- print make_item(spacer => $spacer, a => $anchor, img => $image, label => $label . ' ...') if $show;
- }
- } elsif ($menuitem->{module}) {
- my $image = make_image(label => $label, icon => $label_icon);
- print make_item(img => $image, a => $anchor, spacer => $spacer, label => $label) if $show;
- section_menu($menu, $item) if $show && $::form->{$item} && $::form->{level} eq $item;
- }
- }
- $::lxdebug->leave_sub;
-}
-
-sub make_item {
- my %params = @_;
- my $anchor = $params{a} || '';
- my @chunks = multiline($params{label});
- my $spacer = $params{spacer} || '';
- my $image = $params{img};
- my $height = $params{height} || 16;
- my $a_end = $anchor ? '</a>' : '';
- my $bold = $params{bold} ? '<b>' : '';
- my $b_end = $bold ? '</b>' : '';
- my $hidden_image = make_image(hidden => 1);
- return join "\n",
- "<tr><td class='hover' height='$height'>$bold$spacer$anchor$image$chunks[0]$a_end$b_end</td></tr>\n",
- map "<tr style='vertical-align:top'><td class='hover'>$bold$spacer$hidden_image$anchor$chunks[$_]$a_end$b_end</td></tr>\n",
- 1..$#chunks;
-}
-
-# multi line hack, sschoeling jul06
-# if a label is too long, try to split it at whitespaces, then join it to chunks of less
-# than 20 chars and store it in an array.
-# use this array later instead of the -ed label
-sub multiline {
- my ($label) = @_;
- my @chunks;
- my $l = 20;
- for (split / /, $label) {
- $l += length $_;
- if ($l < 20) {
- $chunks[-1] .= " $_";
- } else {
- $l = length $_;
- push @chunks, $_;
- }
- }
- return @chunks;
-}
-
-sub make_image {
- my (%params) = @_;
-
- my $label = $params{label};
- my $icon = $params{icon};
- my $hidden = $params{hidden};
- my $size = $params{size} || 16;
- my $valign = $params{valign} || 'text-top';
-
- return unless _show_images();
-
- my $icon_found = $icon && -f _icon_path($icon, $size);
-
- my $image_url = $icon_found ? _icon_path($icon, $size) : "image/unterpunkt.png";
- my $style = $hidden ? "visibility:hidden" : "vertical-align:$valign";
- my $width = $hidden ? "width='$size'" : '';
-
- my $padding = $size == 16 && $icon_found || $hidden ? $nbsp x 2
- : $size == 24 ? $nbsp
- : '';
-
- return "<img src='$image_url' border='0' style='$style' title='$label' $width>$padding";
-}
-
-sub _calc_framesize {
- my $is_lynx_browser = $ENV{HTTP_USER_AGENT} =~ /links/i;
- my $is_mobile_browser = $ENV{HTTP_USER_AGENT} =~ /mobile/i;
- my $is_mobile_style = $::form->{stylesheet} =~ /mobile/i;
-
- return $is_mobile_browser && $is_mobile_style ? 130
- : $is_lynx_browser ? 240
- : 200;
-}
-
-sub _show_images {
- # don't show images in links
- _calc_framesize() != 240;
-}
-
-sub _icon_path {
- my ($label, $size) = @_;
-
- $size ||= 16;
-
- return "image/icons/${size}x${size}/$label";
-}
-
-1;
-
-__END__
+++ /dev/null
-#=====================================================================
-# LX-Office ERP
-# Copyright (C) 2004
-# Based on SQL-Ledger Version 2.1.9
-# Web http://www.lx-office.org
-#
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 1998-2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors: Christopher Browne
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#######################################################################
-#
-# thre frame layout with refractured menu
-#
-# CHANGE LOG:
-# DS. 2002-03-25 Created
-# 2004-12-14 - Holger Lindemann
-#######################################################################
-
-use utf8;
-use strict;
-
-use SL::Menu;
-use CGI::Carp qw(fatalsToBrowser);
-
-1;
-
-# end of main
-
-sub display {
-
- my $form = $main::form;
-
- $form->{callback} = $form->unescape($form->{callback});
- $form->{callback} ||= "login.pl?action=company_logo";
-
- $form->header;
-
- &clock_line;
-
- &acc_menu;
-
- print qq|
-<iframe id="win1" src="$form->{callback}" width="100%" height="93%" name="main_window" style="position: absolute; border:0px;">
-<p>Ihr Browser kann leider keine eingebetteten Frames anzeigen.
-</p>
-</iframe>
-</body>
-</html>
-
-|;
-
-}
-
-sub clock_line {
-
- my $form = $main::form;
-
- my $fensterlink="menujs.pl?action=display";
- my $fenster = "["."<a href=\"$fensterlink\" target=\"_blank\">neues Fenster</a>]";
-
- my $login = "[Nutzer "
- . $form->{login}
- . " - <a href=\"controller.pl?action=LoginScreen/logout\" target=\"_top\">"
- . $::locale->text('Logout')
- . "</a>] ";
- my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
- $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
- = localtime(time);
- my $CTIME_String = localtime(time);
- $Monat += 1;
- $Jahrestag += 1;
- $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
- $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
- $Jahr += 1900;
- my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
- "Donnerstag", "Freitag", "Samstag");
- my @Monatsnamen = ("", "Januar", "Februar", "März",
- "April", "Mai", "Juni", "Juli",
- "August", "September", "Oktober", "November",
- "Dezember");
- my $datum =
- $Wochentage[$Wochentag] . ", der "
- . $Monatstag . "."
- . $Monat . "."
- . $Jahr . " - ";
-
- #$zeit="<div id='Uhr'>".$Stunden.":".$Minuten.":".$Sekunden."</div>";
- my $zeit = "<div id='Uhr'>" . $Stunden . ":" . $Minuten . "</div>";
- print qq|
-<script type="text/javascript">
-<!--
-function clockon() {
- var now = new Date();
- var h = now.getHours();
- var m = now.getMinutes();
- document.getElementById('clock_id').innerHTML = (h<10?'0'+h:h)+":"+(m<10?'0'+m:m);
- var timer=setTimeout("clockon()", 10000);
-}
-window.onload=clockon
-//-->
-</script>
-<table border="0" width="100%" background="image/bg_titel.gif" cellpadding="0" cellspacing="0">
- <tr>
- <td style="color:white; font-family:verdana,arial,sans-serif; font-size: 12px;"> $fenster [<a href="JavaScript:top.main_window.print()">drucken</a>]</td>
- <td align="right" style="vertical-align:middle; color:white; font-family:verdana,arial,sans-serif; font-size: 12px;" nowrap>
- $login $datum <span id='clock_id' style='position:relative'></span>
- </td>
- </tr>
-</table>
-|;
-}
-
-sub acc_menu {
-
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $mainlevel = $form->{level};
- $mainlevel =~ s/$mainlevel--//g;
- my $menu = Menu->new("menu.ini");
-
- $| = 1;
-
- print qq|
-<style>
-<!--
-
-.itemBorder {
- border: 1px solid black
-}
-
-.itemText {
- text-decoration: none;
- color: #000000;
- font: 12px Arial, Helvetica
-}
-
-.rootItemText {
- text-decoration: none;
- color: #ffffff;
- font: 12px Arial, Helvetica
-}
-
-.menu {
- color:#ffffff;
- background:url(image/bg_css_menu.png) repeat bottom;
- border:1px solid;
- border-color:#ccc #888 #555 #bbb;
-}
-
--->
-</style>
-
-<script type="text/javascript">
-<!--
-var isDOM = (document.getElementById ? true : false);
-var isIE4 = ((document.all && !isDOM) ? true : false);
-var isNS4 = (document.layers ? true : false);
-//var KO = (navigator.appName=="Konqueror" \|\| navigator.appName=="Opera") ;
-var KO = ((navigator.userAgent.indexOf('Opera',0) != -1) \|\| (navigator.userAgent.indexOf('Konqueror',0) != -1));
-function getRef(id) {
- if (isDOM) return document.getElementById(id);
- if (isIE4) return document.all[id];
- if (isNS4) return document.layers[id];
-}
-function getSty(id) {
- return (isNS4 ? getRef(id) : getRef(id).style);
-}
-var popTimer = 0;
-var litNow = new Array();
-function popOver(menuNum, itemNum) {
- if (KO) document.getElementById("win1").style.visibility = "hidden";
- clearTimeout(popTimer);
- hideAllBut(menuNum);
- litNow = getTree(menuNum, itemNum);
- changeCol(litNow, true);
- targetNum = menu[menuNum][itemNum].target;
- if (targetNum > 0) {
- thisX = parseInt(menu[menuNum][0].ref.left) + parseInt(menu[menuNum][itemNum].ref.left);
- thisY = parseInt(menu[menuNum][0].ref.top) + parseInt(menu[menuNum][itemNum].ref.top);
- with (menu[targetNum][0].ref) {
- left = parseInt(thisX + menu[targetNum][0].x);
- top = parseInt(thisY + menu[targetNum][0].y);
- visibility = 'visible';
- }
- }
-}
-function popOut(menuNum, itemNum) {
- if ((menuNum == 0) && !menu[menuNum][itemNum].target)
- hideAllBut(0)
- if (KO) document.getElementById("win1").style.visibility = "visible";
- else
- popTimer = setTimeout('hideAllBut(0)', 500);
-}
-function getTree(menuNum, itemNum) {
- itemArray = new Array(menu.length);
- while(1) {
- itemArray[menuNum] = itemNum;
- if (menuNum == 0) return itemArray;
- itemNum = menu[menuNum][0].parentItem;
- menuNum = menu[menuNum][0].parentMenu;
- }
-}
-function changeCol(changeArray, isOver) {
- for (menuCount = 0; menuCount < changeArray.length; menuCount++) {
- if (changeArray[menuCount]) {
- newCol = isOver ? menu[menuCount][0].overCol : menu[menuCount][0].backCol;
- with (menu[menuCount][changeArray[menuCount]].ref) {
- if (isNS4) bgColor = newCol;
- else backgroundColor = newCol;
- }
- }
- }
-}
-function hideAllBut(menuNum) {
- var keepMenus = getTree(menuNum, 1);
- for (count = 0; count < menu.length; count++)
- if (!keepMenus[count])
- menu[count][0].ref.visibility = 'hidden';
- changeCol(litNow, false);
-}
-
-function Menu(isVert, popInd, x, y, width, overCol, backCol, borderClass, textClass) {
- this.isVert = isVert;
- this.popInd = popInd
- this.x = x;
- this.y = y;
- this.width = width;
- this.overCol = overCol;
- this.backCol = backCol;
- this.borderClass = borderClass;
- this.textClass = textClass;
- this.parentMenu = null;
- this.parentItem = null;
- this.ref = null;
-}
-function Item(text, href, frame, length, spacing, target) {
- this.text = text;
- this.href = href;
- this.frame = frame;
- this.length = length;
- this.spacing = spacing;
- this.target = target;
- this.ref = null;
-}
-function go(link,frame) {
- tmp=eval("top."+frame);
- tmp.location=link;
- //top.main_window.location=link;
-}
-function writeMenus() {
- if (!isDOM && !isIE4 && !isNS4) return;
- for (currMenu = 0; currMenu < menu.length; currMenu++) with (menu[currMenu][0]) {
- var str = '', itemX = 0, itemY = 0;
- for (currItem = 1; currItem < menu[currMenu].length; currItem++) with (menu[currMenu][currItem]) {
- var itemID = 'menu' + currMenu + 'item' + currItem;
- var w = (isVert ? width : length);
- var h = (isVert ? length : width);
- if (isDOM \|\| isIE4) {
- str += '<div id="' + itemID + '" style="position: absolute; left: ' + itemX + '; top: ' + itemY + '; width: ' + w + '; height: ' + h + '; visibility: inherit; ';
- if (backCol) str += 'background: ' + backCol + '; ';
- str += '" ';
- }
- if (isNS4) {
- str += '<layer id="' + itemID + '" left="' + itemX + '" top="' + itemY + '" width="' + w + '" height="' + h + '" visibility="inherit" ';
- if (backCol) str += 'bgcolor="' + backCol + '" ';
- }
- if (borderClass) str += 'class="' + borderClass + '" "';
- str += 'onMouseOver="popOver(' + currMenu + ',' + currItem + ')" onMouseOut="popOut(' + currMenu + ',' + currItem + ')">';
- str += '<table width="' + (w - 8) + '" border="0" cellspacing="0" cellpadding="' + (!isNS4 && borderClass ? 3 : 0) + '">';
- str +='<tr><td class="' + textClass + '" style="cursor:pointer;" align="left" height="' + (h - 7) + '" onClick=\\'go("' + href + '","' + frame + '")\\'>' + text + '</a></td>';
- if (target > 0) {
- menu[target][0].parentMenu = currMenu;
- menu[target][0].parentItem = currItem;
- if (popInd) str += '<td class="' + textClass + '" align="right">' + popInd + '</td>';
- }
- str += '</tr></table>' + (isNS4 ? '</layer>' : '</div>');
- if (isVert) itemY += length + spacing;
- else itemX += length + spacing;
- }
- if (isDOM) {
- var newDiv = document.createElement('div');
- document.getElementsByTagName('body').item(0).appendChild(newDiv);
- newDiv.innerHTML = str;
- ref = newDiv.style;
- ref.position = 'absolute';
- ref.visibility = 'hidden';
- }
- if (isIE4) {
- document.body.insertAdjacentHTML('beforeEnd', '<div id="menu' + currMenu + 'div" ' + 'style="position: absolute; visibility: hidden">' + str + '</div>');
- ref = getSty('menu' + currMenu + 'div');
- }
- if (isNS4) {
- ref = new Layer(0);
- ref.document.write(str);
- ref.document.close();
- }
- for (currItem = 1; currItem < menu[currMenu].length; currItem++) {
- itemName = 'menu' + currMenu + 'item' + currItem;
- if (isDOM \|\| isIE4) menu[currMenu][currItem].ref = getSty(itemName);
- if (isNS4) menu[currMenu][currItem].ref = ref.document[itemName];
- }
- }
- with(menu[0][0]) {
- ref.left = x;
- ref.top = y;
- ref.visibility = 'visible';
- }
-}
-var menu = new Array();
-var defOver = '#cccccc';
-var defBack = '#dddddd';
-var defLength = 22;
-menu[0] = new Array();
-menu[0][0] = new Menu(false, '', 5, 18, 19, '#cccccc', '', '', 'rootItemText');
-
-|;
-
- §ion_menu($menu);
-
- print qq|
-var popOldWidth = window.innerWidth;
-nsResizeHandler = new Function('if (popOldWidth != window.innerWidth) location.reload()');
-if (isNS4) document.captureEvents(Event.CLICK);
-document.onclick = clickHandle;
-function clickHandle(evt) {
- if (isNS4) document.routeEvent(evt);
- hideAllBut(0);
- if (KO) document.getElementById("win1").style.visibility = "visible";
-}
-function moveRoot() {
- with(menu[0][0].ref) left = ((parseInt(left) < 100) ? 100 : 5);
-}
-// End -->
-</script>
-
-<BODY scrolling="no" topmargin="0" leftmargin="0" marginwidth="0" marginheight="0" style="margin: 0" onLoad="writeMenus(); clockon();" onResize="if (isNS4) nsResizeHandler()">
-
-
-<table class="menu" width="100%" border="0" cellpadding="0" cellspacing="0">
-<tr><td height="21"><font size="1"> </font></td></tr></table>
-
-
-|;
-
- print qq|
-
-|;
-
-}
-
-sub section_menu {
- my ($menu, $level) = @_;
-
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- # build tiered menus
- my @menuorder = $menu->access_control(\%myconfig, $level);
- my $main = 0;
-
- #$pm=0;
- my $shlp=0;
- my (%mlz, $sm, $z, $pm, $mm);
- while (@menuorder) {
- my $item = shift @menuorder;
- my $label = $item;
- my $ml = $item;
- $label =~ s/$level--//g;
- $ml =~ s/--.*//;
- $label = $::locale->text($label);
- $label =~ s/ / /g;
- $menu->{$item}{target} = "main_window" unless $menu->{$item}{target};
-
- if ($menu->{$item}{submenu}) {
- $menu->{$item}{$item} = !$form->{$item};
-
- # Untermen
- if ($mlz{"s$ml"} > 1) {
- $z++;
- $sm = 1;
- } else {
- $z = $sm;
- $mlz{"s$ml"}++;
- }
- print
- qq|menu[$mlz{$ml}][$z] = new Item('$label', '#', '', defLength, 0, |
- . ++$pm
- . qq|);\n|;
- $sm = 1;
- print qq|menu[$pm] = new Array();\n|;
- print
- qq|menu[$pm][0] = new Menu(true, '', 85, 0, 180, defOver, defBack, 'itemBorder', 'itemText');\n|;
- map { shift @menuorder } grep /^$item/, @menuorder;
- §ion_menu($menu, $item);
- map { shift @menuorder } grep /^$item/, @menuorder;
- } else {
- if ($menu->{$item}{module}) {
-
- #Untermenüpunkte
- my $target = $menu->{$item}{target};
- my $uri = $menu->menuitem_js(\%myconfig, \%$form, $item, $level);
-
- print
- qq|menu[$pm][$sm] = new Item('$label', '$uri', '$target', defLength, 0, 0);\n|;
- $sm++;
- } else { # Hauptmenu
- my $ml_ = $form->escape($ml);
- $mm++;
- $pm++;
- %mlz = ($ml, $pm, "s$ml", 1);
- $shlp = $sm;
- $sm = 1;
- my $breit = 15 + length($label) * 6;
- print
- qq|menu[0][$mm] = new Item(' $label', '#', '', $breit, 10, $pm); \n|;
- print qq|menu[$pm] = new Array();\n|;
- print
- qq|menu[$pm][0] = new Menu(true, '>', 0, 20, 180, defOver, defBack, 'itemBorder', 'itemText');\n|;
-
- §ion_menu($menu, $item);
-
- #print qq|<br>\n|;
- }
- }
- }
-}
+++ /dev/null
-#=====================================================================
-# LX-Office ERP
-# Copyright (C) 2004
-# Based on SQL-Ledger Version 2.1.9
-# Web http://www.lx-office.org
-#
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 1998-2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors: Christopher Browne
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#######################################################################
-#
-# thre frame layout with refractured menu
-#
-#######################################################################
-
-use English qw(-no_match_vars);
-use List::Util qw(max);
-use URI;
-
-use SL::Menu;
-
-use strict;
-
-1;
-
-# end of main
-
-sub display {
- my $form = $main::form;
-
- $form->header();
-
-# $form->{force_ul_width} = $ENV{HTTP_USER_AGENT} =~ m/MSIE\s+6\./;
-# $form->{force_ul_width} = $ENV{HTTP_USER_AGENT} !~ m/Opera/;
- $form->{force_ul_width} = 1;
- $form->{date} = clock_line();
- $form->{menu_items} = acc_menu();
- my $callback = $form->unescape($form->{callback});
- $callback = URI->new($callback)->rel($callback) if $callback;
- $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
- $form->{callback} = $callback;
-
- print $form->parse_html_template("menu/menunew");
-}
-
-sub clock_line {
- my $form = $main::form;
-
- my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
- $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
- = localtime(time);
- $Monat += 1;
- $Jahrestag += 1;
- $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
- $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
- $Jahr += 1900;
- my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
- "Donnerstag", "Freitag", "Samstag");
- my @Monatsnamen = ("", "Januar", "Februar", "März",
- "April", "Mai", "Juni", "Juli",
- "August", "September", "Oktober", "November",
- "Dezember");
- return
- $Wochentage[$Wochentag] . ", der "
- . $Monatstag . "."
- . $Monat . "."
- . $Jahr . " - ";
-}
-
-sub acc_menu {
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $mainlevel = $form->{level};
- $mainlevel =~ s/\Q$mainlevel\E--//g;
- my $menu = Menu->new('menu.ini');
-
- $English::AUTOFLUSH = 1;
-
- my $all_items = [];
- create_menu($menu, $all_items);
-
- my $item = { 'subitems' => $all_items };
- calculate_width($item);
-
- return $all_items;
-}
-
-sub calculate_width {
- my $item = shift;
-
- $item->{max_width} = max map { length $_->{title} } @{ $item->{subitems} };
-
- foreach my $subitem (@{ $item->{subitems} }) {
- calculate_width($subitem) if ($subitem->{subitems});
- }
-}
-
-sub create_menu {
- my ($menu, $all_items, $parent, $depth) = @_;
- my $html;
-
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- die if ($depth * 1 > 5);
-
- my @menuorder = $menu->access_control(\%myconfig, $parent);
- $parent .= "--" if ($parent);
-
- foreach my $name (@menuorder) {
- substr($name, 0, length($parent), "");
- next if (($name eq "") || ($name =~ /--/));
-
- my $menu_item = $menu->{"${parent}${name}"};
- my $item = { 'title' => $::locale->text($name) };
- push @{ $all_items }, $item;
-
- if ($menu_item->{submenu} || !defined($menu_item->{module}) || ($menu_item->{module} eq "menu.pl")) {
- $item->{subitems} = [];
- $item->{image} = _icon_path("$name.png");
- create_menu($menu, $item->{subitems}, "${parent}${name}", $depth * 1 + 1);
-
- } else {
- $item->{image} = _icon_path("${parent}${name}.png");
- $menu->menuitem_new("${parent}${name}", $item);
- }
- }
-}
-
-sub _icon_path {
- my ($label, $size) = @_;
-
- $size ||= 16;
-
- my $img = "image/icons/${size}x${size}/$label";
-
- return unless -f $img;
- return $img;
-}
-
+++ /dev/null
-#=====================================================================
-# LX-Office ERP
-# Copyright (C) 2004
-# Based on SQL-Ledger Version 2.1.9
-# Web http://www.lx-office.org
-#
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 1998-2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors: Christopher Browne
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#######################################################################
-#
-# thre frame layout with refractured menu
-#
-#######################################################################
-
-use SL::Menu;
-use URI;
-
-use strict;
-
-1;
-
-# end of main
-
-sub display {
- my $form = $main::form;
-
- $form->header(extra_code => qq|<link rel="stylesheet" href="css/menuv3.css?id=" type="text/css">|);
-
- $form->{date} = clock_line();
- $form->{menu} = acc_menu();
- my $callback = $form->unescape($form->{callback});
- $callback = URI->new($callback)->rel($callback) if $callback;
- $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
- $form->{callback} = $callback;
-
- print $form->parse_html_template("menu/menuv3");
-
-}
-
-sub clock_line {
- my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
- $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
- = localtime(time);
- $Monat += 1;
- $Jahrestag += 1;
- $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
- $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
- $Jahr += 1900;
- my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
- "Donnerstag", "Freitag", "Samstag");
- my @Monatsnamen = ("", "Januar", "Februar", "März",
- "April", "Mai", "Juni", "Juli",
- "August", "September", "Oktober", "November",
- "Dezember");
- return
- $Wochentage[$Wochentag] . ", der "
- . $Monatstag . "."
- . $Monat . "."
- . $Jahr . " - ";
-}
-
-sub acc_menu {
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $mainlevel = $form->{level};
- $mainlevel =~ s/\Q$mainlevel\E--//g;
- my $menu = Menu->new("menu.ini");
-
- $| = 1;
-
- return print_menu($menu);
-}
-
-sub print_menu {
- my ($menu, $parent, $depth) = @_;
-
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $html;
-
- die if ($depth * 1 > 5);
-
- my @menuorder;
-
- @menuorder = $menu->access_control(\%myconfig, $parent);
-
- $parent .= "--" if ($parent);
-
- foreach my $item (@menuorder) {
- substr($item, 0, length($parent)) = "";
- next if (($item eq "") || ($item =~ /--/));
-
- my $menu_item = $menu->{"${parent}${item}"};
- my $menu_title = $::locale->text($item);
- my $menu_text = $menu_title;
-
- my $target = "main_window";
- $target = $menu_item->{"target"} if ($menu_item->{"target"});
-
- if ($menu_item->{"submenu"} || !defined($menu_item->{"module"}) ||
- ($menu_item->{"module"} eq "menu.pl")) {
-
- my $h = print_menu($menu, "${parent}${item}", $depth * 1 + 1)."\n";
- if (!$parent) {
- $html .= qq|<ul><li><h2>${menu_text}</h2><ul>${h}</ul></li></ul>\n|;
- } else {
- $html .= qq|<li><div class="x">${menu_text}</div><ul>${h}</ul></li>\n|;
- }
- } else {
- $html .= qq|<li>|;
- $html .= $menu->menuitem_v3(\%myconfig, $form, "${parent}$item",
- { "title" => $menu_title,
- "target" => $target });
- $html .= qq|${menu_text}</a></li>\n|;
- }
- }
-
- return $html;
-}
+++ /dev/null
-#=====================================================================
-# LX-Office ERP
-# Copyright (C) 2004
-# Based on SQL-Ledger Version 2.1.9
-# Web http://www.lx-office.org
-#
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 1998-2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors: Christopher Browne
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#######################################################################
-#
-# thre frame layout with refractured menu
-#
-#######################################################################
-
-use SL::Menu;
-use URI;
-
-use strict;
-
-1;
-
-# end of main
-
-sub display {
- my $form = $main::form;
-
- $form->header(extra_code => qq|<link rel="stylesheet" href="css/menuv4.css?id=" type="text/css">|);
-
- $form->{date} = clock_line();
- $form->{menu} = acc_menu();
- my $callback = $form->unescape($form->{callback});
- $callback = URI->new($callback)->rel($callback) if $callback;
- $callback = "login.pl?action=company_logo" if $callback =~ /^(\.\/)?$/;
- $form->{callback} = $callback;
-
- print $form->parse_html_template("menu/menuv4");
-
-}
-
-sub clock_line {
- my $form = $main::form;
-
- my ($Sekunden, $Minuten, $Stunden, $Monatstag, $Monat,
- $Jahr, $Wochentag, $Jahrestag, $Sommerzeit)
- = localtime(time);
- $Monat += 1;
- $Jahrestag += 1;
- $Monat = $Monat < 10 ? $Monat = "0" . $Monat : $Monat;
- $Monatstag = $Monatstag < 10 ? $Monatstag = "0" . $Monatstag : $Monatstag;
- $Jahr += 1900;
- my @Wochentage = ("Sonntag", "Montag", "Dienstag", "Mittwoch",
- "Donnerstag", "Freitag", "Samstag");
- my @Monatsnamen = ("", "Januar", "Februar", "März",
- "April", "Mai", "Juni", "Juli",
- "August", "September", "Oktober", "November",
- "Dezember");
- return
- $Wochentage[$Wochentag] . ", der "
- . $Monatstag . "."
- . $Monat . "."
- . $Jahr . " - ";
-}
-
-sub acc_menu {
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $mainlevel = $form->{level};
- $mainlevel =~ s/\Q$mainlevel\E--//g;
- my $menu = Menu->new("menu.ini");
-
- $| = 1;
-
- return print_menu($menu);
-}
-
-sub print_menu {
- my ($menu, $parent, $depth) = @_;
-
- my $form = $main::form;
- my %myconfig = %main::myconfig;
-
- my $html;
-
- die if ($depth * 1 > 5);
-
- my @menuorder;
-
- @menuorder = $menu->access_control(\%myconfig, $parent);
-
- $parent .= "--" if ($parent);
-
- foreach my $item (@menuorder) {
- substr($item, 0, length($parent)) = "";
- next if (($item eq "") || ($item =~ /--/));
-
- my $menu_item = $menu->{"${parent}${item}"};
- my $menu_title = $::locale->text($item);
- my $menu_text = $menu_title;
-
- my $target = "main_window";
- $target = $menu_item->{"target"} if ($menu_item->{"target"});
-
- if ($menu_item->{"submenu"} || !defined($menu_item->{"module"}) ||
- ($menu_item->{"module"} eq "menu.pl")) {
-
- my $h = print_menu($menu, "${parent}${item}", $depth * 1 + 1)."\n";
- if (!$parent) {
- $html .= qq|<ul><li><h2> ${menu_text} </h2><ul>${h}</ul></li></ul>\n|;
- } else {
- $html .= qq|<li><div class="x">${menu_text}</div><ul>${h}</ul></li>\n|;
- }
- } else {
- if ($depth>1) {
- $html .= qq|<li class='sub'>|;
- } else {
- $html .= qq|<li>|;
- }
- $html .= $menu->menuitem_v3(\%myconfig, $form, "${parent}$item",
- { "title" => $menu_title,
- "target" => $target });
- $html .= qq|${menu_text}</a></li>\n|;
- }
- }
-
- return $html;
-}
}
}
- my $onload = "";
+ my $dispatch_to_popup = '';
if ($form->{resubmit} && ($form->{format} eq "html")) {
- $onload = "window.open('about:blank','Beleg'); document.oe.target = 'Beleg';";
- $onload .= "document.do.submit();";
+ $dispatch_to_popup = "window.open('about:blank','Beleg'); document.oe.target = 'Beleg';";
+ $dispatch_to_popup .= "document.do.submit();";
} elsif ($form->{resubmit}) {
# emulate click for resubmitting actions
- $onload = "document.oe.${_}.click(); " for grep { /^action_/ } keys %$form;
- $onload .= "document.oe.submit();";
+ $dispatch_to_popup = "document.oe.${_}.click(); " for grep { /^action_/ } keys %$form;
+ $dispatch_to_popup .= "document.oe.submit();";
} elsif ($creditwarning) {
- $onload = "alert('$credittext')";
+ $::request->{layout}->add_javascripts_inline("alert('$credittext')");
}
- $TMPL_VAR{onload} = $onload;
+ $::request->{layout}->add_javascripts_inline("\$(function(){$dispatch_to_popup})");
$TMPL_VAR{dateformat} = $myconfig{dateformat};
$TMPL_VAR{numberformat} = $myconfig{numberformat};
$form->{simple_save} = 1;
if(!$form->{print_and_save}) {
- delete @{$form}{ary_diff([keys %{ $form }], [qw(login stylesheet id script type cursor_fokus)])};
+ delete @{$form}{ary_diff([keys %{ $form }], [qw(login id script type cursor_fokus)])};
edit();
::end_of_request();
}
$form->header;
print qq|
-<body>
-
<form method=post action=$form->{script}>
|;
. $locale->text('Continue') . qq|">
</form>
-
-</body>
-</html>
|;
$main::lxdebug->leave_sub();
$::form->{AR} = [ grep { $_->{link} =~ m/(?:^|:)AR(?::|$)/ } @{ $::form->{ALL_CHARTS} } ];
$::form->{title} = $::locale->text('Edit the configuration for periodic invoices');
- $::form->header();
+ $::form->header(no_layout => 1);
print $::form->parse_html_template('oe/edit_periodic_invoices_config', $config);
$::lxdebug->leave_sub();
$form->{CUSTOM_VARIABLES_INCLUSION_CODE}) = CVar->render_search_options('variables' => $form->{CUSTOM_VARIABLES},
'include_prefix' => 'l_',
'include_value' => 'Y');
- $form->{fokus} = 'getElementById("projectnumber")';
+ $::request->{layout}->focus('#projectnumber');
$form->header();
print $form->parse_html_template('projects/search');
$::form->get_lists("projects" => { "key" => "ALL_PROJECTS", "all" => 1 });
- my $onload = qq|focus()|;
-
my $is_projects = $::form->{report} eq "projects";
my $is_income_statement = $::form->{report} eq "income_statement";
my $is_bwa = $::form->{report} eq "bwa";
vc => $vc,
label => $label,
year => DateTime->today->year,
- onload => $onload,
nextsub => $nextsub,
accrual => $::instance_conf->get_accounting_method ne 'cash',
cash => $::instance_conf->get_accounting_method eq 'cash',
$form->header();
-# print qq|
-# <body>
-# |;
-
my $elsterland = '';
my $elster_amt = '';
my $elsterFFFF = '';
$form->{jsscript} = 1;
-# $form->{fokus} = "partnumber";
-# $form->{onload} .= "focus();";
$form->{title} = $locale->text("Report about warehouse contents");
$form->header();
--- /dev/null
+.icon16 { background: url(../image/maps/icons16.png) 16px 0px no-repeat; padding: 0; width: 16px; height: 16px; }
+.icon16.AP--Add-Purchase-Order { background-position: -0px 0px; }
+.icon16.AP--Add-RFQ { background-position: -16px 0px; }
+.icon16.AP { background-position: -32px 0px; }
+.icon16.AP--Reports { background-position: -48px 0px; }
+.icon16.AP--Reports--Purchase-Orders { background-position: -64px 0px; }
+.icon16.AP--Reports--RFQs { background-position: -80px 0px; }
+.icon16.AR--Add-Credit-Note { background-position: -96px 0px; }
+.icon16.AR--Add-Delivery-Order { background-position: -112px 0px; }
+.icon16.AR--Add-Dunning { background-position: -128px 0px; }
+.icon16.AR--Add-Quotation { background-position: -144px 0px; }
+.icon16.AR--Add-Sales-Invoice { background-position: -160px 0px; }
+.icon16.AR--Add-Sales-Order { background-position: -176px 0px; }
+.icon16.AR { background-position: -192px 0px; }
+.icon16.AR--Reports--Delivery-Orders { background-position: -208px 0px; }
+.icon16.AR--Reports--Dunnings { background-position: -224px 0px; }
+.icon16.AR--Reports--Invoices { background-position: -240px 0px; }
+.icon16.AR--Reports { background-position: -256px 0px; }
+.icon16.AR--Reports--Quotations { background-position: -272px 0px; }
+.icon16.AR--Reports--Sales-Orders { background-position: -288px 0px; }
+.icon16.Batch-Printing--Packing-Lists { background-position: -304px 0px; }
+.icon16.Batch-Printing { background-position: -320px 0px; }
+.icon16.Batch-Printing--Purchase-Orders { background-position: -336px 0px; }
+.icon16.Batch-Printing--Quotations { background-position: -352px 0px; }
+.icon16.Batch-Printing--Receipts { background-position: -368px 0px; }
+.icon16.Batch-Printing--RFQs { background-position: -384px 0px; }
+.icon16.Batch-Printing--Sales-Invoices { background-position: -400px 0px; }
+.icon16.Batch-Printing--Sales-Orders { background-position: -416px 0px; }
+.icon16.Cash--Payment { background-position: -432px 0px; }
+.icon16.Cash { background-position: -448px 0px; }
+.icon16.Cash--Receipt { background-position: -464px 0px; }
+.icon16.Cash--Reconciliation { background-position: -480px 0px; }
+.icon16.Cash--Reports--Payments { background-position: -496px 0px; }
+.icon16.Cash--Reports { background-position: -512px 0px; }
+.icon16.Cash--Reports--Receipts { background-position: -528px 0px; }
+.icon16.CRM--Admin--Benutzer { background-position: -544px 0px; }
+.icon16.CRM--Admin--Dokumentvorlage { background-position: -560px 0px; }
+.icon16.CRM--Admin--Etiketten { background-position: -576px 0px; }
+.icon16.CRM--Admin--Gruppen { background-position: -592px 0px; }
+.icon16.CRM--Admin--Mitteilungen { background-position: -608px 0px; }
+.icon16.CRM--Admin { background-position: -624px 0px; }
+.icon16.CRM--Admin--Status { background-position: -640px 0px; }
+.icon16.CRM--Auftragschance { background-position: -656px 0px; }
+.icon16.CRM--eMail { background-position: -672px 0px; }
+.icon16.CRM--Hilfe { background-position: -688px 0px; }
+.icon16.CRM--Kunden { background-position: -704px 0px; }
+.icon16.CRM--Lieferant { background-position: -720px 0px; }
+.icon16.CRM--Notizen { background-position: -736px 0px; }
+.icon16.CRM--Personen { background-position: -752px 0px; }
+.icon16.CRM { background-position: -768px 0px; }
+.icon16.CRM--Schnellsuche { background-position: -784px 0px; }
+.icon16.CRM--Service { background-position: -800px 0px; }
+.icon16.CRM--Termine { background-position: -816px 0px; }
+.icon16.CRM--Wiedervorlage { background-position: -832px 0px; }
+.icon16.CRM--Wissens-DB { background-position: -848px 0px; }
+.icon16.General-Ledger--Add-AP-Transaction { background-position: -864px 0px; }
+.icon16.General-Ledger--Add-AR-Transaction { background-position: -880px 0px; }
+.icon16.General-Ledger--Add-Transaction { background-position: -896px 0px; }
+.icon16.General-Ledger--DATEV---Export-Assistent { background-position: -912px 0px; }
+.icon16.General-Ledger { background-position: -928px 0px; }
+.icon16.General-Ledger--Reports--AP-Aging { background-position: -944px 0px; }
+.icon16.General-Ledger--Reports--AR-Aging { background-position: -960px 0px; }
+.icon16.General-Ledger--Reports--Journal { background-position: -976px 0px; }
+.icon16.General-Ledger--Reports { background-position: -992px 0px; }
+.icon16.Master-Data--Add-Assembly { background-position: -1008px 0px; }
+.icon16.Master-Data--Add-Customer { background-position: -1024px 0px; }
+.icon16.Master-Data--Add-License { background-position: -1040px 0px; }
+.icon16.Master-Data--Add-Part { background-position: -1056px 0px; }
+.icon16.Master-Data--Add-Project { background-position: -1072px 0px; }
+.icon16.Master-Data--Add-Service { background-position: -1088px 0px; }
+.icon16.Master-Data--Add-Vendor { background-position: -1104px 0px; }
+.icon16.Master-Data { background-position: -1120px 0px; }
+.icon16.Master-Data--Reports--Assemblies { background-position: -1136px 0px; }
+.icon16.Master-Data--Reports--Customers { background-position: -1152px 0px; }
+.icon16.Master-Data--Reports--Licenses { background-position: -1168px 0px; }
+.icon16.Master-Data--Reports--Parts { background-position: -1184px 0px; }
+.icon16.Master-Data--Reports { background-position: -1200px 0px; }
+.icon16.Master-Data--Reports--Projects { background-position: -1216px 0px; }
+.icon16.Master-Data--Reports--Projecttransactions { background-position: -1232px 0px; }
+.icon16.Master-Data--Reports--Services { background-position: -1248px 0px; }
+.icon16.Master-Data--Reports--Vendors { background-position: -1264px 0px; }
+.icon16.Master-Data--Update-Prices { background-position: -1280px 0px; }
+.icon16.MDI-Text-Editor-16x16 { background-position: -1296px 0px; }
+.icon16.Neues-Fenster { background-position: -1312px 0px; }
+.icon16.Program--Logout { background-position: -1328px 0px; }
+.icon16.Program { background-position: -1344px 0px; }
+.icon16.Program--Preferences { background-position: -1360px 0px; }
+.icon16.Program--Version { background-position: -1376px 0px; }
+.icon16.Reports--Balance-Sheet { background-position: -1392px 0px; }
+.icon16.Reports--Chart-of-Accounts { background-position: -1408px 0px; }
+.icon16.Reports--Income-Statement { background-position: -1424px 0px; }
+.icon16.Reports { background-position: -1440px 0px; }
+.icon16.Reports--UStVa { background-position: -1456px 0px; }
+.icon16.System { background-position: -1472px 0px; }
+.icon16.Warehouse { background-position: -1488px 0px; }
+.icon16.Warehouse--Produce-Assembly { background-position: -1504px 0px; }
--- /dev/null
+.icon24 { background: url(../image/maps/icons24.png) 24px 0px no-repeat; padding: 0; width: 24px; height: 24px; }
+.icon24.AP--Add-Purchase-Order { background-position: -0px 0px; }
+.icon24.AP--Add-RFQ { background-position: -24px 0px; }
+.icon24.AP { background-position: -48px 0px; }
+.icon24.AP--Reports { background-position: -72px 0px; }
+.icon24.AP--Reports--Purchase-Orders { background-position: -96px 0px; }
+.icon24.AP--Reports--RFQs { background-position: -120px 0px; }
+.icon24.AR--Add-Dunning { background-position: -144px 0px; }
+.icon24.AR--Add-Quotation { background-position: -168px 0px; }
+.icon24.AR--Add-Sales-Invoice { background-position: -192px 0px; }
+.icon24.AR--Add-Sales-Order { background-position: -216px 0px; }
+.icon24.AR { background-position: -240px 0px; }
+.icon24.AR--Reports--Dunnings { background-position: -264px 0px; }
+.icon24.AR--Reports--Invoices { background-position: -288px 0px; }
+.icon24.AR--Reports { background-position: -312px 0px; }
+.icon24.AR--Reports--Quotations { background-position: -336px 0px; }
+.icon24.AR--Reports--Sales-Orders { background-position: -360px 0px; }
+.icon24.Batch-Printing--Packing-Lists { background-position: -384px 0px; }
+.icon24.Batch-Printing { background-position: -408px 0px; }
+.icon24.Batch-Printing--Purchase-Orders { background-position: -432px 0px; }
+.icon24.Batch-Printing--Quotations { background-position: -456px 0px; }
+.icon24.Batch-Printing--Receipts { background-position: -480px 0px; }
+.icon24.Batch-Printing--RFQs { background-position: -504px 0px; }
+.icon24.Batch-Printing--Sales-Invoices { background-position: -528px 0px; }
+.icon24.Batch-Printing--Sales-Orders { background-position: -552px 0px; }
+.icon24.Cash--Payment { background-position: -576px 0px; }
+.icon24.Cash { background-position: -600px 0px; }
+.icon24.Cash--Receipt { background-position: -624px 0px; }
+.icon24.Cash--Reconciliation { background-position: -648px 0px; }
+.icon24.Cash--Reports--Payments { background-position: -672px 0px; }
+.icon24.Cash--Reports { background-position: -696px 0px; }
+.icon24.Cash--Reports--Receipts { background-position: -720px 0px; }
+.icon24.CRM--Admin--Benutzer { background-position: -744px 0px; }
+.icon24.CRM--Admin--Dokumentvorlage { background-position: -768px 0px; }
+.icon24.CRM--Admin--Etiketten { background-position: -792px 0px; }
+.icon24.CRM--Admin--Gruppen { background-position: -816px 0px; }
+.icon24.CRM--Admin--Mitteilungen { background-position: -840px 0px; }
+.icon24.CRM--Admin { background-position: -864px 0px; }
+.icon24.CRM--Admin--Status { background-position: -888px 0px; }
+.icon24.CRM--Auftragschance { background-position: -912px 0px; }
+.icon24.CRM--eMail { background-position: -936px 0px; }
+.icon24.CRM--Hilfe { background-position: -960px 0px; }
+.icon24.CRM--Kunden { background-position: -984px 0px; }
+.icon24.CRM--Lieferant { background-position: -1008px 0px; }
+.icon24.CRM--Notizen { background-position: -1032px 0px; }
+.icon24.CRM--Personen { background-position: -1056px 0px; }
+.icon24.CRM { background-position: -1080px 0px; }
+.icon24.CRM--Schnellsuche { background-position: -1104px 0px; }
+.icon24.CRM--Service { background-position: -1128px 0px; }
+.icon24.CRM--Termine { background-position: -1152px 0px; }
+.icon24.CRM--Wiedervorlage { background-position: -1176px 0px; }
+.icon24.CRM--Wissens-DB { background-position: -1200px 0px; }
+.icon24.General-Ledger--Add-AP-Transaction { background-position: -1224px 0px; }
+.icon24.General-Ledger--Add-AR-Transaction { background-position: -1248px 0px; }
+.icon24.General-Ledger--Add-Transaction { background-position: -1272px 0px; }
+.icon24.General-Ledger--DATEV---Export-Assistent { background-position: -1296px 0px; }
+.icon24.General-Ledger { background-position: -1320px 0px; }
+.icon24.General-Ledger--Reports--AP-Aging { background-position: -1344px 0px; }
+.icon24.General-Ledger--Reports--AR-Aging { background-position: -1368px 0px; }
+.icon24.General-Ledger--Reports--Journal { background-position: -1392px 0px; }
+.icon24.General-Ledger--Reports { background-position: -1416px 0px; }
+.icon24.leftarrow_24 { background-position: -1440px 0px; }
+.icon24.Master-Data--Add-Assembly { background-position: -1464px 0px; }
+.icon24.Master-Data--Add-Customer { background-position: -1488px 0px; }
+.icon24.Master-Data--Add-License { background-position: -1512px 0px; }
+.icon24.Master-Data--Add-Part { background-position: -1536px 0px; }
+.icon24.Master-Data--Add-Project { background-position: -1560px 0px; }
+.icon24.Master-Data--Add-Service { background-position: -1584px 0px; }
+.icon24.Master-Data--Add-Vendor { background-position: -1608px 0px; }
+.icon24.Master-Data { background-position: -1632px 0px; }
+.icon24.Master-Data--Reports--Assemblies { background-position: -1656px 0px; }
+.icon24.Master-Data--Reports--Customers { background-position: -1680px 0px; }
+.icon24.Master-Data--Reports--Licenses { background-position: -1704px 0px; }
+.icon24.Master-Data--Reports--Parts { background-position: -1728px 0px; }
+.icon24.Master-Data--Reports { background-position: -1752px 0px; }
+.icon24.Master-Data--Reports--Projects { background-position: -1776px 0px; }
+.icon24.Master-Data--Reports--Projecttransactions { background-position: -1800px 0px; }
+.icon24.Master-Data--Reports--Services { background-position: -1824px 0px; }
+.icon24.Master-Data--Reports--Vendors { background-position: -1848px 0px; }
+.icon24.Neues-Fenster { background-position: -1872px 0px; }
+.icon24.Productivity { background-position: -1896px 0px; }
+.icon24.Program--Logout { background-position: -1920px 0px; }
+.icon24.Program { background-position: -1944px 0px; }
+.icon24.Program--Preferences { background-position: -1968px 0px; }
+.icon24.Program--Version { background-position: -1992px 0px; }
+.icon24.Reports--Balance-Sheet { background-position: -2016px 0px; }
+.icon24.Reports--Chart-of-Accounts { background-position: -2040px 0px; }
+.icon24.Reports--Income-Statement { background-position: -2064px 0px; }
+.icon24.Reports { background-position: -2088px 0px; }
+.icon24.Reports--UStVa { background-position: -2112px 0px; }
+.icon24.rightarrow_24 { background-position: -2136px 0px; }
+.icon24.System { background-position: -2160px 0px; }
+.icon24.Warehouse { background-position: -2184px 0px; }
--- /dev/null
+.icon32 { background: url(../image/maps/icons32.png) 32px 0px no-repeat; padding: 0; width: 32px; height: 32px; }
+.icon32.AP--Add-Purchase-Order { background-position: -0px 0px; }
+.icon32.AP--Add-RFQ { background-position: -32px 0px; }
+.icon32.AP { background-position: -64px 0px; }
+.icon32.AP--Reports { background-position: -96px 0px; }
+.icon32.AP--Reports--Purchase-Orders { background-position: -128px 0px; }
+.icon32.AP--Reports--RFQs { background-position: -160px 0px; }
+.icon32.AR--Add-Dunning { background-position: -192px 0px; }
+.icon32.AR--Add-Quotation { background-position: -224px 0px; }
+.icon32.AR--Add-Sales-Invoice { background-position: -256px 0px; }
+.icon32.AR--Add-Sales-Order { background-position: -288px 0px; }
+.icon32.AR { background-position: -320px 0px; }
+.icon32.AR--Reports--Dunnings { background-position: -352px 0px; }
+.icon32.AR--Reports--Invoices { background-position: -384px 0px; }
+.icon32.AR--Reports { background-position: -416px 0px; }
+.icon32.AR--Reports--Quotations { background-position: -448px 0px; }
+.icon32.AR--Reports--Sales-Orders { background-position: -480px 0px; }
+.icon32.Batch-Printing--Packing-Lists { background-position: -512px 0px; }
+.icon32.Batch-Printing { background-position: -544px 0px; }
+.icon32.Batch-Printing--Purchase-Orders { background-position: -576px 0px; }
+.icon32.Batch-Printing--Quotations { background-position: -608px 0px; }
+.icon32.Batch-Printing--Receipts { background-position: -640px 0px; }
+.icon32.Batch-Printing--RFQs { background-position: -672px 0px; }
+.icon32.Batch-Printing--Sales-Invoices { background-position: -704px 0px; }
+.icon32.Batch-Printing--Sales-Orders { background-position: -736px 0px; }
+.icon32.Cash--Payment { background-position: -768px 0px; }
+.icon32.Cash { background-position: -800px 0px; }
+.icon32.Cash--Receipt { background-position: -832px 0px; }
+.icon32.Cash--Reconciliation { background-position: -864px 0px; }
+.icon32.Cash--Reports--Payments { background-position: -896px 0px; }
+.icon32.Cash--Reports { background-position: -928px 0px; }
+.icon32.Cash--Reports--Receipts { background-position: -960px 0px; }
+.icon32.CRM--Admin--Benutzer { background-position: -992px 0px; }
+.icon32.CRM--Admin--Dokumentvorlage { background-position: -1024px 0px; }
+.icon32.CRM--Admin--Etiketten { background-position: -1056px 0px; }
+.icon32.CRM--Admin--Gruppen { background-position: -1088px 0px; }
+.icon32.CRM--Admin--Mitteilungen { background-position: -1120px 0px; }
+.icon32.CRM--Admin { background-position: -1152px 0px; }
+.icon32.CRM--Admin--Status { background-position: -1184px 0px; }
+.icon32.CRM--Auftragschance { background-position: -1216px 0px; }
+.icon32.CRM--eMail { background-position: -1248px 0px; }
+.icon32.CRM--Hilfe { background-position: -1280px 0px; }
+.icon32.CRM--Kunden { background-position: -1312px 0px; }
+.icon32.CRM--Lieferant { background-position: -1344px 0px; }
+.icon32.CRM--Notizen { background-position: -1376px 0px; }
+.icon32.CRM--Personen { background-position: -1408px 0px; }
+.icon32.CRM { background-position: -1440px 0px; }
+.icon32.CRM--Schnellsuche { background-position: -1472px 0px; }
+.icon32.CRM--Service { background-position: -1504px 0px; }
+.icon32.CRM--Termine { background-position: -1536px 0px; }
+.icon32.CRM--Wiedervorlage { background-position: -1568px 0px; }
+.icon32.CRM--Wissens-DB { background-position: -1600px 0px; }
+.icon32.General-Ledger--Add-AP-Transaction { background-position: -1632px 0px; }
+.icon32.General-Ledger--Add-AR-Transaction { background-position: -1664px 0px; }
+.icon32.General-Ledger--Add-Transaction { background-position: -1696px 0px; }
+.icon32.General-Ledger--DATEV---Export-Assistent { background-position: -1728px 0px; }
+.icon32.General-Ledger { background-position: -1760px 0px; }
+.icon32.General-Ledger--Reports--AP-Aging { background-position: -1792px 0px; }
+.icon32.General-Ledger--Reports--AR-Aging { background-position: -1824px 0px; }
+.icon32.General-Ledger--Reports--Journal { background-position: -1856px 0px; }
+.icon32.General-Ledger--Reports { background-position: -1888px 0px; }
+.icon32.Master-Data--Add-Assembly { background-position: -1920px 0px; }
+.icon32.Master-Data--Add-Customer { background-position: -1952px 0px; }
+.icon32.Master-Data--Add-License { background-position: -1984px 0px; }
+.icon32.Master-Data--Add-Part { background-position: -2016px 0px; }
+.icon32.Master-Data--Add-Project { background-position: -2048px 0px; }
+.icon32.Master-Data--Add-Service { background-position: -2080px 0px; }
+.icon32.Master-Data--Add-Vendor { background-position: -2112px 0px; }
+.icon32.Master-Data { background-position: -2144px 0px; }
+.icon32.Master-Data--Reports--Assemblies { background-position: -2176px 0px; }
+.icon32.Master-Data--Reports--Customers { background-position: -2208px 0px; }
+.icon32.Master-Data--Reports--Licenses { background-position: -2240px 0px; }
+.icon32.Master-Data--Reports--Parts { background-position: -2272px 0px; }
+.icon32.Master-Data--Reports { background-position: -2304px 0px; }
+.icon32.Master-Data--Reports--Projects { background-position: -2336px 0px; }
+.icon32.Master-Data--Reports--Projecttransactions { background-position: -2368px 0px; }
+.icon32.Master-Data--Reports--Services { background-position: -2400px 0px; }
+.icon32.Master-Data--Reports--Vendors { background-position: -2432px 0px; }
+.icon32.Neues-Fenster { background-position: -2464px 0px; }
+.icon32.Program--Logout { background-position: -2496px 0px; }
+.icon32.Program { background-position: -2528px 0px; }
+.icon32.Program--Preferences { background-position: -2560px 0px; }
+.icon32.Program--Version { background-position: -2592px 0px; }
+.icon32.Reports--Balance-Sheet { background-position: -2624px 0px; }
+.icon32.Reports--Chart-of-Accounts { background-position: -2656px 0px; }
+.icon32.Reports--Income-Statement { background-position: -2688px 0px; }
+.icon32.Reports { background-position: -2720px 0px; }
+.icon32.Reports--UStVa { background-position: -2752px 0px; }
+.icon32.System { background-position: -2784px 0px; }
+.icon32.Warehouse--Produce-Assembly { background-position: -2816px 0px; }
th.login {
text-align: right;
}
-body.admin {
+div.admin {
background-color: #FFFFE0;
+ padding: 8px;
color: #000000;
}
body.menu {
/*border: 3px solid;*/
background-color: #FFFFFF;
color: #000000;
- margin-top: 0.2em;
}
#menuv4 a, #menuv4 h2, #menuv4 div.x {
font-size: 80%;
position: relativ: left: 10px;
}
/* End of non-anchor hover selectors */
+
+/* html menu */
+/* types of lines: m sm i (menu submenu item)
+ each line is a mi (menuitem) and has one mii (menu-item-icon) whcih is ms (menu-spacer)
+ and one mic (menu-item-chunk)
+ indenting is done with the levels s0, s1, s2 */
+#content.html-menu, #html-menu {
+ transition: margin-left 0.2s, width 0.2s;
+ -moz-transition: margin-left 0.2s, width 0.2s;
+ -webkit-transition: margin-left 0.2s, width 0.2s;
+ -o-transition: margin-left 0.2s, width 0.2s;
+}
+#content.html-menu { margin-left: 190px; }
+#content.html-menu.folded { margin-left: 40px }
+#html-menu.folded:hover + #content.html-menu.folded { margin-left: 190px }
+#html-menu { float:left; width: 183px; font-size: 8pt; margin-top: 10px; overflow:hidden; }
+#html-menu.folded { width: 32px; }
+#html-menu.folded:hover { width: 183px; }
+#html-menu div.mi { margin-top: 4px; margin-bottom: 3px; white-space: nowrap; clear:both; position:relative; }
+#html-menu div.sm { font-weight: bold }
+#html-menu img { vertical-align: top; border: 0; }
+#html-menu a { vertical-align: top }
+#html-menu .i span.ms { float: left; width: 24px; margin-bottom: 4px; }
+#html-menu .m span.ms { float: left; width: 32px }
+#html-menu .sm span.ms { float: left; width: 24px; background: url(../../image/unterpunkt.png); }
+#html-menu div.m { height: 24px }
+#html-menu div.m span.mic { color:black; position: relative; top: 4px }
+#html-menu div.m:hover,
+#html-menu div.i:hover { color:blue; background-color: #d1d1d1; cursor: pointer; }
+#html-menu span.mic { white-space: normal; display: inline-block; vertical-align: top; line-height: 1.2; }
+#html-menu a.ml span.mic { width: 145px } /* fix deep indents */
+#html-menu div.s0 { padding-left: 2px }
+#html-menu div.s1 { padding-left: 8px }
+#html-menu div.s2 { padding-left: 16px }
+
+body { margin: 0 }
-.frame-header-element a:link,
-.frame-header-element a:visited,
-.frame-header-element a:hover,
-.frame-header-element a:active {
+#frame-header .frame-header-element a:link,
+#frame-header .frame-header-element a:visited,
+#frame-header .frame-header-element a:hover,
+#frame-header .frame-header-element a:active {
color: white;
background: none;
text-decoration: underline;
}
-body.frame-header {
- background: url('../../../image/fade.png') repeat-x;
-}
-
-div.frame-header {
+#frame-header {
background: url('../../../image/bg_titel.gif') repeat-x;
text-align: center;
-}
-
-.frame-header {
margin: 0;
padding: 0;
color: white;
overflow: hidden;
width: 100%;
border-spacing: 0;
+ font-size: 12px;
}
-.frame-header-left {
+#frame-header .frame-header-left {
float: left;
}
-.frame-header-right {
+#frame-header .frame-header-right {
float: right;
}
-.frame-header-left,
-.frame-header-center,
-.frame-header-right {
+#frame-header .frame-header-left,
+#frame-header .frame-header-center,
+#frame-header .frame-header-right {
border-spacing: 0;
color: white;
padding: 0;
background-color: lemonchiffon;
text-decoration: none;
}
+a, div {
+ transition: background-color 0.2s;
+ -moz-transition: background-color 0.2s;
+ -webkit-transition: background-color 0.2s;
+}
+
+input, textarea, select {
+ border: 1px;
+ border-color: darkgray lightgray lightgray;
+ border-style: solid;
+ padding: 1px;
+ background-color: white;
+}
+
+select {
+ padding: 0px;
+}
input:focus, textarea:focus, select:focus {
- background-color: yellow;
+ background-color: whitesmoke;
+ border: 1px;
+ border-color: gray lightgray lightgray;
+ border-style: solid;
+}
+
+input:hover, textarea:hover, select:hover {
+ border-color: dimgray darkgray darkgray;
+}
+
+input[type="button"],
+input[type="submit"],
+button,
+input[type="button"]:focus,
+input[type="submit"]:focus,
+button:focus {
+ border: 1px;
+ border-color: darkgray;
+ border-style: solid;
+ padding: 0px 4px;
+ -webkit-border-radius: 2px;
+ -moz-border-radius: 2px;
+ border-radius: 2px;
+ background-color: whitesmoke;
+}
+
+button:hover,
+input[type="button"]:hover,
+input[type="submit"]:hover {
+ border: 1px;
+ background-color: lightgray;
+ border-color: gray;
+ border-style: solid;
+ -webkit-border-radius: 2px;
+ -moz-border-radius: 2px;
+ border-radius: 2px;
+}
+
+html {
+ height: 100%;
}
body {
background-color: white;
background-image: url("../../image/fade.png"); background-repeat:repeat-x;
color: black;
+ height: 100%;
}
td {
.login {
font-family: Verdana, Arial, Helvetica, sans-serif;
}
-body.login {
+div.login {
+ min-height: 100%;
+ height: auto !important;
+ height: 100%;
background: #b8d1f3;
color: #A0A0A0;
}
text-align: right;
}
-body.admin {
- background-color:#ffffff;
+div.admin {
color: black;
+ margin: 8px;
}
.message_error_login {
border-style:none;
border-width:thin;
}
+
+
/* End of non-anchor hover selectors */
-
+/* html menu */
+/* types of lines: m sm i (menu submenu item)
+ each line is a mi (menuitem) and has one mii (menu-item-icon) whcih is ms (menu-spacer)
+ and one mic (menu-item-chunk)
+ indenting is done with the levels s0, s1, s2 */
+#content.html-menu, #html-menu {
+ transition: margin-left 0.2s, width 0.2s;
+ -moz-transition: margin-left 0.2s, width 0.2s;
+ -webkit-transition: margin-left 0.2s, width 0.2s;
+ -o-transition: margin-left 0.2s, width 0.2s;
+}
+#content.html-menu { margin-left: 190px; }
+#content.html-menu.folded { margin-left: 40px }
+#html-menu.folded:hover + #content.html-menu.folded { margin-left: 190px }
+#html-menu { float:left; width: 183px; font-size: 8pt; margin-top: 10px; overflow:hidden; }
+#html-menu.folded { width: 32px; }
+#html-menu.folded:hover { width: 183px; }
+#html-menu div.mi { margin-top: 4px; margin-bottom: 3px; white-space: nowrap; clear:both; position:relative; }
+#html-menu div.sm { font-weight: bold }
+#html-menu img { vertical-align: top; border: 0; }
+#html-menu a { vertical-align: top }
+#html-menu .i span.ms { float: left; width: 24px; margin-bottom: 4px; }
+#html-menu .m span.ms { float: left; width: 32px }
+#html-menu .sm span.ms { float: left; width: 24px; background: url(../../image/unterpunkt.png); }
+#html-menu div.m { height: 24px }
+#html-menu div.m span.mic { color:blue; position: relative; top: 4px }
+#html-menu div.m:hover,
+#html-menu div.i:hover { color:blue; background-color: lemonchiffon; cursor: pointer; }
+#html-menu span.mic { white-space: normal; display: inline-block; vertical-align: top; line-height: 1.2; }
+#html-menu a.ml span.mic { width: 145px } /* fix deep indents */
+#html-menu div.s0 { padding-left: 2px }
+#html-menu div.s1 { padding-left: 8px }
+#html-menu div.s2 { padding-left: 16px }
+
+body { margin: 0 }
<sect2 id="Zeichensätze-die-Verwendung-von-UTF-8">
<title>Zeichensätze/die Verwendung von UTF-8</title>
- <para>kivitendo kann komplett mit UTF-8 als Zeichensatz verwendet
- werden. Dabei gibt es zwei Punkte zu beachten: PostgreSQL muss in
- Version 8.2 oder neuer benutzt werden, und der
- PostgreSQL-Datenbankcluster muss ebenfalls mit UTF-8 als Locale
- angelegt worden sein.</para>
+ <para>Bei aktuellen Serverinstallationen braucht man hier meist nicht
+ eingreifen</para>
+
+ <para>Dieses kann überprüft werden: ist das Encoding der Datenbank
+ “template1” “UTF8”, so braucht man nichts weiteres diesbezueglich
+ unternehmen. Zum Testen:
+
+ <programlisting>su postgres
+echo '\l' | psql
+exit </programlisting>
- <para>Dieses ist kann überprüft werden: ist das Encoding der Datenbank
- “template1” “UTF8”, so kann auch kivitendo mit UTF-8 betrieben werden.
Andernfalls ist es notwendig, einen neuen Datenbankcluster mit
UTF-8-Encoding anzulegen und diesen zu verwenden. Unter Debian und
Ubuntu kann dies z.B. für PostgreSQL 8.2 mit dem folgenden Befehl
<para>In der Datei <filename>pg_hba.conf</filename>, die im gleichen
Verzeichnis wie die <filename>postgresql.conf</filename> zu finden
sein sollte, müssen die Berichtigungen für den Zugriff geändert
- werden. Hier gibt es mehrere Möglichkeiten. Eine besteht darin, lokale
- Verbindungen immer zuzulassen:</para>
-
- <programlisting>local all all trust
-host all all 127.0.0.1 255.0.0.0 trust</programlisting>
-
- <para>Besser ist es, für eine bestimmte Datenbank Zugriff nur per
- Passwort zuzulassen. Beispielsweise:</para>
+ werden. Hier gibt es mehrere Möglichkeiten. sinnvoll ist es nur die
+ nögiten Verbindungen immer zuzulassen, für eine lokal laufenden
+ Datenbank zum Beispiel:</para>
<programlisting>local all kivitendo password
host all kivitendo 127.0.0.1 255.255.255.255 password</programlisting>
<para>In der Datenbank <literal>template1</literal> muss die
Unterstützung für servergespeicherte Prozeduren eingerichet werden.
- Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an, und
+ Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an:
+ <programlisting>su - postgres
+psql template1</programlisting>
+
führen Sie die folgenden Kommandos aus:</para>
- <programlisting>create language 'plpgsql';</programlisting>
+ <programlisting>create language 'plpgsql';
+\q</programlisting>
</sect2>
<sect2 id="Datenbankbenutzer-anlegen">
anlegen. Ein Beispiel, wie Sie einen neuen Benutzer anlegen
können:</para>
- <programlisting>su - postgres createuser -d -P kivitendo</programlisting>
+ Die Frage, ob der neue User Superuser sein soll, können Sie mit nein
+ beantworten, genauso ist die Berechtigung neue User (Roles) zu
+ generieren nicht nötig.
+ <programlisting>su - postgres
+createuser -d -P kivitendo
+exit</programlisting>
<para>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
Sie den evtl. voreingestellten Benutzer “postgres” auf “kivitendo” bzw.
dem Kürzel das im Dateinamen verwendetet wird.</para>
</listitem>
</varlistentry>
+
+ <varlistentry>
+ <term><varname>template_meta.tmpfile</varname></term>
+
+ <listitem>
+ <para>Datei-Prefix für temporäre Dateien.</para>
+ </listitem>
+ </varlistentry>
</variablelist>
</sect3>
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.4. Anpassung der PostgreSQL-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei"><link rel="next" href="ch02s05.html" title="2.5. Webserver-Konfiguration"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.4. Anpassung der PostgreSQL-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.4. Anpassung der PostgreSQL-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Anpassung-der-PostgreSQL-Konfiguration"></a>2.4. Anpassung der PostgreSQL-Konfiguration</h2></div></div></div><p>PostgreSQL muss auf verschiedene Weisen angepasst werden.</p><div class="sect2" title="2.4.1. Zeichensätze/die Verwendung von UTF-8"><div class="titlepage"><div><div><h3 class="title"><a name="Zeichens%C3%A4tze-die-Verwendung-von-UTF-8"></a>2.4.1. Zeichensätze/die Verwendung von UTF-8</h3></div></div></div><p>kivitendo kann komplett mit UTF-8 als Zeichensatz verwendet
- werden. Dabei gibt es zwei Punkte zu beachten: PostgreSQL muss in
- Version 8.2 oder neuer benutzt werden, und der
- PostgreSQL-Datenbankcluster muss ebenfalls mit UTF-8 als Locale
- angelegt worden sein.</p><p>Dieses ist kann überprüft werden: ist das Encoding der Datenbank
- “template1” “UTF8”, so kann auch kivitendo mit UTF-8 betrieben werden.
+ <title>2.4. Anpassung der PostgreSQL-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei"><link rel="next" href="ch02s05.html" title="2.5. Webserver-Konfiguration"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.4. Anpassung der PostgreSQL-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.4. Anpassung der PostgreSQL-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Anpassung-der-PostgreSQL-Konfiguration"></a>2.4. Anpassung der PostgreSQL-Konfiguration</h2></div></div></div><p>PostgreSQL muss auf verschiedene Weisen angepasst werden.</p><div class="sect2" title="2.4.1. Zeichensätze/die Verwendung von UTF-8"><div class="titlepage"><div><div><h3 class="title"><a name="Zeichens%C3%A4tze-die-Verwendung-von-UTF-8"></a>2.4.1. Zeichensätze/die Verwendung von UTF-8</h3></div></div></div><p>Bei aktuellen Serverinstallationen braucht man hier meist nicht
+ eingreifen</p><p>Dieses kann überprüft werden: ist das Encoding der Datenbank
+ “template1” “UTF8”, so braucht man nichts weiteres diesbezueglich
+ unternehmen. Zum Testen:
+
+ </p><pre class="programlisting">su postgres
+echo '\l' | psql
+exit </pre><p>
+
Andernfalls ist es notwendig, einen neuen Datenbankcluster mit
UTF-8-Encoding anzulegen und diesen zu verwenden. Unter Debian und
Ubuntu kann dies z.B. für PostgreSQL 8.2 mit dem folgenden Befehl
was mit dem Wert <code class="literal">*</code> geschieht.</p><p>In der Datei <code class="filename">pg_hba.conf</code>, die im gleichen
Verzeichnis wie die <code class="filename">postgresql.conf</code> zu finden
sein sollte, müssen die Berichtigungen für den Zugriff geändert
- werden. Hier gibt es mehrere Möglichkeiten. Eine besteht darin, lokale
- Verbindungen immer zuzulassen:</p><pre class="programlisting">local all all trust
-host all all 127.0.0.1 255.0.0.0 trust</pre><p>Besser ist es, für eine bestimmte Datenbank Zugriff nur per
- Passwort zuzulassen. Beispielsweise:</p><pre class="programlisting">local all kivitendo password
+ werden. Hier gibt es mehrere Möglichkeiten. sinnvoll ist es nur die
+ nögiten Verbindungen immer zuzulassen, für eine lokal laufenden
+ Datenbank zum Beispiel:</p><pre class="programlisting">local all kivitendo password
host all kivitendo 127.0.0.1 255.255.255.255 password</pre></div><div class="sect2" title="2.4.3. Erweiterung für servergespeicherte Prozeduren"><div class="titlepage"><div><div><h3 class="title"><a name="Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren"></a>2.4.3. Erweiterung für servergespeicherte Prozeduren</h3></div></div></div><p>In der Datenbank <code class="literal">template1</code> muss die
Unterstützung für servergespeicherte Prozeduren eingerichet werden.
- Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an, und
- führen Sie die folgenden Kommandos aus:</p><pre class="programlisting">create language 'plpgsql';</pre></div><div class="sect2" title="2.4.4. Datenbankbenutzer anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="Datenbankbenutzer-anlegen"></a>2.4.4. Datenbankbenutzer anlegen</h3></div></div></div><p>Wenn Sie nicht den Datenbanksuperuser “postgres” zum Zugriff
+ Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an:
+ </p><pre class="programlisting">su - postgres
+psql template1</pre><p>
+
+ führen Sie die folgenden Kommandos aus:</p><pre class="programlisting">create language 'plpgsql';
+\q</pre></div><div class="sect2" title="2.4.4. Datenbankbenutzer anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="Datenbankbenutzer-anlegen"></a>2.4.4. Datenbankbenutzer anlegen</h3></div></div></div><p>Wenn Sie nicht den Datenbanksuperuser “postgres” zum Zugriff
benutzen wollen, so sollten Sie bei PostgreSQL einen neuen Benutzer
anlegen. Ein Beispiel, wie Sie einen neuen Benutzer anlegen
- können:</p><pre class="programlisting">su - postgres createuser -d -P kivitendo</pre><p>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
+ können:</p>
+
+ Die Frage, ob der neue User Superuser sein soll, können Sie mit nein
+ beantworten, genauso ist die Berechtigung neue User (Roles) zu
+ generieren nicht nötig.
+ <pre class="programlisting">su - postgres
+createuser -d -P kivitendo
+exit</pre><p>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
Sie den evtl. voreingestellten Benutzer “postgres” auf “kivitendo” bzw.
den hier gewählten Benutzernamen.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.3. kivitendo-Konfigurationsdatei </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.5. Webserver-Konfiguration</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.5. Webserver-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s04.html" title="2.4. Anpassung der PostgreSQL-Konfiguration"><link rel="next" href="ch02s06.html" title="2.6. Der Task-Server"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.5. Webserver-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.5. Webserver-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Apache-Konfiguration"></a>2.5. Webserver-Konfiguration</h2></div></div></div><div class="sect2" title="2.5.1. Grundkonfiguration mittels CGI"><div class="titlepage"><div><div><h3 class="title"><a name="d0e49
0"></a>2.5.1. Grundkonfiguration mittels CGI</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Für einen deutlichen Performanceschub sorgt die Ausführung
+ <title>2.5. Webserver-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s04.html" title="2.4. Anpassung der PostgreSQL-Konfiguration"><link rel="next" href="ch02s06.html" title="2.6. Der Task-Server"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.5. Webserver-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.5. Webserver-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Apache-Konfiguration"></a>2.5. Webserver-Konfiguration</h2></div></div></div><div class="sect2" title="2.5.1. Grundkonfiguration mittels CGI"><div class="titlepage"><div><div><h3 class="title"><a name="d0e49
3"></a>2.5.1. Grundkonfiguration mittels CGI</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Für einen deutlichen Performanceschub sorgt die Ausführung
mittels FastCGI/FCGI. Die Einrichtung wird ausführlich im Abschnitt
<a class="xref" href="ch02s05.html#Apache-Konfiguration.FCGI" title="2.5.2. Konfiguration für FastCGI/FCGI">Konfiguration für FastCGI/FCGI</a> beschrieben.</p></td></tr></table></div><p>Der Zugriff auf das Programmverzeichnis muss in der Apache
Webserverkonfigurationsdatei <code class="literal">httpd.conf</code> eingestellt
Links aus einem der Runlevel-Verzeichnisse heraus in den Boot-Prozess
einzubinden. Da das bei neueren Linux-Distributionen aber nicht
zwangsläufig funktioniert, werden auch Start-Scripte mitgeliefert, die
- anstelle eines symbolischen Links verwendet werden können.</p><div class="sect3" title="2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora Core)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e674"></a>2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora
+ anstelle eines symbolischen Links verwendet werden können.</p><div class="sect3" title="2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora Core)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e677"></a>2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora
Core)</h4></div></div></div><p>Kopieren Sie die Datei
<code class="filename">scripts/boot/system-v/kivitendo-server</code>
nach <code class="filename">/etc/init.d/kivitendo-server</code>. Passen
insserv kivitendo-task-server</pre></li><li class="listitem"><p>OpenSuSE und Fedora Core:</p><pre class="programlisting">chkconfig --add kivitendo-task-server</pre></li></ul></div><p>Danach kann der Task-Server mit dem folgenden Befehl gestartet
werden: <span class="command"><strong>/etc/init.d/kivitendo-task-server
start</strong></span>
- </p></div><div class="sect3" title="2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e70
4"></a>2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)</h4></div></div></div><p>Kopieren Sie die Datei
+ </p></div><div class="sect3" title="2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e70
7"></a>2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)</h4></div></div></div><p>Kopieren Sie die Datei
<code class="filename">scripts/boot/upstart/kivitendo-task-server.conf</code>
nach <code class="filename">/etc/init/kivitendo-task-server.conf</code>.
Passen Sie in der kopierten Datei den Pfad zum Task-Server an (Zeile
</span></dt><dd><p>Beschreibung des ausgewählten Druckers</p></dd><dt><span class="term">
<code class="varname">template_meta.printer.template_code</code>
</span></dt><dd><p>Vorlagenürzel des ausgewählten Druckers, identisch mit
- dem Kürzel das im Dateinamen verwendetet wird.</p></dd></dl></div></div><div class="sect3" title="3.2.7.2. Stammdaten von Kunden und Lieferanten"><div class="titlepage"><div><div><h4 class="title"><a name="dokumentenvorlagen-und-variablen.allgemeine-variablen.kunden-lieferanten"></a>3.2.7.2. Stammdaten von Kunden und Lieferanten</h4></div></div></div><div class="variablelist"><dl><dt><span class="term">
+ dem Kürzel das im Dateinamen verwendetet wird.</p></dd><dt><span class="term">
+ <code class="varname">template_meta.tmpfile</code>
+ </span></dt><dd><p>Datei-Prefix für temporäre Dateien.</p></dd></dl></div></div><div class="sect3" title="3.2.7.2. Stammdaten von Kunden und Lieferanten"><div class="titlepage"><div><div><h4 class="title"><a name="dokumentenvorlagen-und-variablen.allgemeine-variablen.kunden-lieferanten"></a>3.2.7.2. Stammdaten von Kunden und Lieferanten</h4></div></div></div><div class="variablelist"><dl><dt><span class="term">
<code class="varname">account_number</code>
</span></dt><dd><p>Kontonummer</p></dd><dt><span class="term">
<code class="varname">bank</code>
<code class="varname">invdate</code>
</span></dt><dd><p>Rechnungsdatum</p></dd><dt><span class="term">
<code class="varname">invnumber</code>
- </span></dt><dd><p>Rechnungsnummer</p></dd></dl></div></div></div><div class="sect2" title="3.2.10. Variablen in anderen Vorlagen"><div class="titlepage"><div><div><h3 class="title"><a name="dokumentenvorlagen-und-variablen.andere-vorlagen"></a>3.2.10. Variablen in anderen Vorlagen</h3></div></div></div><div class="sect3" title="3.2.10.1. Einführung"><div class="titlepage"><div><div><h4 class="title"><a name="d0e37
31"></a>3.2.10.1. Einführung</h4></div></div></div><p>Die Variablen in anderen Vorlagen sind ähnlich wie in der
+ </span></dt><dd><p>Rechnungsnummer</p></dd></dl></div></div></div><div class="sect2" title="3.2.10. Variablen in anderen Vorlagen"><div class="titlepage"><div><div><h3 class="title"><a name="dokumentenvorlagen-und-variablen.andere-vorlagen"></a>3.2.10. Variablen in anderen Vorlagen</h3></div></div></div><div class="sect3" title="3.2.10.1. Einführung"><div class="titlepage"><div><div><h4 class="title"><a name="d0e37
43"></a>3.2.10.1. Einführung</h4></div></div></div><p>Die Variablen in anderen Vorlagen sind ähnlich wie in der
Rechnung. Allerdings heißen die Variablen, die mit
<code class="varname">inv</code> beginnen, jetzt anders. Bei den Angeboten
fangen sie mit <code class="varname">quo</code> für "quotation" an:
zeigen:</p><pre class="programlisting"><%if var1 == "Wert"%></pre><p>Testet die Variable <code class="varname">var1</code> auf
übereinstimmung mit der Zeichenkette <code class="constant">Wert</code>.
Mittels <code class="function">!=</code> anstelle von <code class="function">==</code>
- würde auf Ungleichheit getestet.</p><pre class="programlisting">%if var1 == var2%></pre><p>Testet die Variable <code class="varname">var1</code> auf
+ würde auf Ungleichheit getestet.</p><pre class="programlisting">
<%if var1 == var2%></pre><p>Testet die Variable <code class="varname">var1</code> auf
übereinstimmung mit der Variablen <code class="varname">var2</code>. Mittel
<code class="function">!=</code> anstelle von <code class="function">==</code> würde
auf Ungleichheit getestet.</p><p>Erfahrere Benutzer können neben der Tests auf (Un-)Gleichheit
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>Kapitel 4. Entwicklerdokumentation</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch03s03.html" title="3.3. Excel-Vorlagen"><link rel="next" href="ch04s02.html" title="4.2. Entwicklung unter FastCGI"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 4. Entwicklerdokumentation</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 4. Entwicklerdokumentation"><div class="titlepage"><div><div><h2 class="title"><a name="d0e43
31"></a>Kapitel 4. Entwicklerdokumentation</h2></div></div></div><div class="sect1" title="4.1. Globale Variablen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.globals"></a>4.1. Globale Variablen</h2></div></div></div><div class="sect2" title="4.1.1. Wie sehen globale Variablen in Perl aus?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4337"></a>4.1.1. Wie sehen globale Variablen in Perl aus?</h3></div></div></div><p>Globale Variablen liegen in einem speziellen namespace namens
+ <title>Kapitel 4. Entwicklerdokumentation</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch03s03.html" title="3.3. Excel-Vorlagen"><link rel="next" href="ch04s02.html" title="4.2. Entwicklung unter FastCGI"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 4. Entwicklerdokumentation</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 4. Entwicklerdokumentation"><div class="titlepage"><div><div><h2 class="title"><a name="d0e43
43"></a>Kapitel 4. Entwicklerdokumentation</h2></div></div></div><div class="sect1" title="4.1. Globale Variablen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.globals"></a>4.1. Globale Variablen</h2></div></div></div><div class="sect2" title="4.1.1. Wie sehen globale Variablen in Perl aus?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4349"></a>4.1.1. Wie sehen globale Variablen in Perl aus?</h3></div></div></div><p>Globale Variablen liegen in einem speziellen namespace namens
"main", der von überall erreichbar ist. Darüber hinaus sind bareword
globs global und die meisten speziellen Variablen sind...
speziell.</p><p>Daraus ergeben sich folgende Formen:</p><div class="variablelist"><dl><dt><span class="term">
<code class="varname">$PACKAGE::form</code>.</p></dd><dt><span class="term">
<code class="literal">local $form</code>
</span></dt><dd><p>Alle Änderungen an <code class="varname">$form</code> werden am Ende
- des scopes zurückgesetzt</p></dd></dl></div></div><div class="sect2" title="4.1.2. Warum sind globale Variablen ein Problem?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e44
38"></a>4.1.2. Warum sind globale Variablen ein Problem?</h3></div></div></div><p>Das erste Problem ist <span class="productname">FCGI</span>™.</p><p>
+ des scopes zurückgesetzt</p></dd></dl></div></div><div class="sect2" title="4.1.2. Warum sind globale Variablen ein Problem?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e44
50"></a>4.1.2. Warum sind globale Variablen ein Problem?</h3></div></div></div><p>Das erste Problem ist <span class="productname">FCGI</span>™.</p><p>
<span class="productname">SQL-Ledger</span>™ hat fast alles im globalen
namespace abgelegt, und erwartet, dass es da auch wiederzufinden ist.
Unter <span class="productname">FCGI</span>™ müssen diese Sachen aber wieder
dies hat, seit der Einführung, u.a. schon so manche langwierige
Bug-Suche verkürzt. Da globale Variablen aber implizit mit Package
angegeben werden, werden die nicht geprüft, und somit kann sich
- schnell ein Tippfehler einschleichen.</p></div><div class="sect2" title="4.1.3. Kanonische globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e44
71"></a>4.1.3. Kanonische globale Variablen</h3></div></div></div><p>Um dieses Problem im Griff zu halten gibt es einige wenige
+ schnell ein Tippfehler einschleichen.</p></div><div class="sect2" title="4.1.3. Kanonische globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e44
83"></a>4.1.3. Kanonische globale Variablen</h3></div></div></div><p>Um dieses Problem im Griff zu halten gibt es einige wenige
globale Variablen, die kanonisch sind, d.h. sie haben bestimmte
vorgegebenen Eigenschaften, und alles andere sollte anderweitig
umhergereicht werden.</p><p>Diese Variablen sind im Moment die folgenden neun:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
<code class="varname">$::request</code>
</p></li></ul></div><p>Damit diese nicht erneut als Müllhalde missbraucht werden, im
Folgenden eine kurze Erläuterung der bestimmten vorgegebenen
- Eigenschaften (Konventionen):</p><div class="sect3" title="4.1.3.1. $::form"><div class="titlepage"><div><div><h4 class="title"><a name="d0e45
35"></a>4.1.3.1. $::form</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Ist ein Objekt der Klasse
+ Eigenschaften (Konventionen):</p><div class="sect3" title="4.1.3.1. $::form"><div class="titlepage"><div><div><h4 class="title"><a name="d0e45
47"></a>4.1.3.1. $::form</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Ist ein Objekt der Klasse
"<code class="classname">Form</code>"</p></li><li class="listitem"><p>Wird nach jedem Request gelöscht</p></li><li class="listitem"><p>Muss auch in Tests und Konsolenscripts vorhanden
sein.</p></li><li class="listitem"><p>Enthält am Anfang eines Requests die Requestparameter vom
User</p></li><li class="listitem"><p>Kann zwar intern über Requestgrenzen ein Datenbankhandle
push @{ $form->{TEMPLATE_ARRAYS}{number} }, $form->{"partnumber_$i"};
push @{ $form->{TEMPLATE_ARRAYS}{description} }, $form->{"description_$i"};
# ...
-}</pre></div><div class="sect3" title="4.1.3.2. %::myconfig"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
19"></a>4.1.3.2. %::myconfig</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Das einzige Hash unter den globalen Variablen</p></li><li class="listitem"><p>Wird spätestens benötigt wenn auf die Datenbank
+}</pre></div><div class="sect3" title="4.1.3.2. %::myconfig"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
31"></a>4.1.3.2. %::myconfig</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Das einzige Hash unter den globalen Variablen</p></li><li class="listitem"><p>Wird spätestens benötigt wenn auf die Datenbank
zugegriffen wird</p></li><li class="listitem"><p>Wird bei jedem Request neu erstellt.</p></li><li class="listitem"><p>Enthält die Userdaten des aktuellen Logins</p></li><li class="listitem"><p>Sollte nicht ohne Filterung irgendwo gedumpt werden oder
extern serialisiert werden, weil da auch der Datenbankzugriff
für diesen user drinsteht.</p></li><li class="listitem"><p>Enthält unter anderem Listenbegrenzung vclimit,
überwiegend die Daten, die sich unter <span class="guimenu">Programm</span>
-> <span class="guimenuitem">Einstellungen</span> befinden, bzw. die
Informationen über den Benutzer die über die
- Administrator-Schnittstelle (admin.pl) eingegeben wurden.</p></div><div class="sect3" title="4.1.3.3. $::locale"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
58"></a>4.1.3.3. $::locale</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "Locale"</p></li><li class="listitem"><p>Wird pro Request erstellt</p></li><li class="listitem"><p>Muss auch für Tests und Scripte immer verfügbar
+ Administrator-Schnittstelle (admin.pl) eingegeben wurden.</p></div><div class="sect3" title="4.1.3.3. $::locale"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
70"></a>4.1.3.3. $::locale</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "Locale"</p></li><li class="listitem"><p>Wird pro Request erstellt</p></li><li class="listitem"><p>Muss auch für Tests und Scripte immer verfügbar
sein.</p></li><li class="listitem"><p>Cached intern über Requestgrenzen hinweg benutzte
Locales</p></li></ul></div><p>Lokalisierung für den aktuellen User. Alle Übersetzungen,
- Zahlen- und Datumsformatierungen laufen über dieses Objekt.</p></div><div class="sect3" title="4.1.3.4. $::lxdebug"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
76"></a>4.1.3.4. $::lxdebug</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "LXDebug"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Muss immer verfügbar sein, in nahezu allen
+ Zahlen- und Datumsformatierungen laufen über dieses Objekt.</p></div><div class="sect3" title="4.1.3.4. $::lxdebug"><div class="titlepage"><div><div><h4 class="title"><a name="d0e46
88"></a>4.1.3.4. $::lxdebug</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "LXDebug"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Muss immer verfügbar sein, in nahezu allen
Funktionen</p></li></ul></div><p>
<code class="varname">$::lxdebug</code> stellt Debuggingfunktionen
bereit, wie "<code class="function">enter_sub</code>" und
"<code class="function">message</code>" und "<code class="function">dump</code>" mit
denen man flott Informationen ins Log (tmp/kivitendo-debug.log)
packen kann.</p><p>Beispielsweise so:</p><pre class="programlisting">$main::lxdebug->message(0, 'Meine Konfig:' . Dumper (%::myconfig));
-$main::lxdebug->message(0, 'Wer bin ich? Kunde oder Lieferant:' . $form->{vc});</pre></div><div class="sect3" title="4.1.3.5. $::auth"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
13"></a>4.1.3.5. $::auth</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "SL::Auth"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Hat eine permanente DB Verbindung zur Authdatenbank</p></li><li class="listitem"><p>Wird nach jedem Request resettet.</p></li></ul></div><p>
+$main::lxdebug->message(0, 'Wer bin ich? Kunde oder Lieferant:' . $form->{vc});</pre></div><div class="sect3" title="4.1.3.5. $::auth"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
25"></a>4.1.3.5. $::auth</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "SL::Auth"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Hat eine permanente DB Verbindung zur Authdatenbank</p></li><li class="listitem"><p>Wird nach jedem Request resettet.</p></li></ul></div><p>
<code class="varname">$::auth</code> stellt Funktionen bereit um die
Rechte des aktuellen Users abzufragen. Obwohl diese Informationen
vom aktuellen User abhängen wird das Objekt aus
Geschwindigkeitsgründen nur einmal angelegt und dann nach jedem
- Request kurz resettet.</p></div><div class="sect3" title="4.1.3.6. $::lx_office_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
34"></a>4.1.3.6. $::lx_office_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ Request kurz resettet.</p></div><div class="sect3" title="4.1.3.6. $::lx_office_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
46"></a>4.1.3.6. $::lx_office_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="classname">SL::LxOfficeConf</code>"</p></li><li class="listitem"><p>Global gecached</p></li><li class="listitem"><p>Repräsentation der
<code class="filename">config/kivitendo.conf[.default]</code>-Dateien</p></li></ul></div><p>Globale Konfiguration. Configdateien werden zum Start gelesen
und danach nicht mehr angefasst. Es ist derzeit nicht geplant, dass
file = /tmp/kivitendo-debug.log</pre><p>ist der Key <code class="varname">file</code> im Programm als
<code class="varname">$::lx_office_conf->{debug}{file}</code>
erreichbar.</p><div class="warning" title="Warnung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Warning"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Warnung]" src="../../../../system/docbook-xsl/images/warning.png"></td><th align="left">Warnung</th></tr><tr><td align="left" valign="top"><p>Zugriff auf die Konfiguration erfolgt im Moment über
- Hashkeys, sind also nicht gegen Tippfehler abgesichert.</p></td></tr></table></div></div><div class="sect3" title="4.1.3.7. $::instance_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
70"></a>4.1.3.7. $::instance_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ Hashkeys, sind also nicht gegen Tippfehler abgesichert.</p></td></tr></table></div></div><div class="sect3" title="4.1.3.7. $::instance_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e47
82"></a>4.1.3.7. $::instance_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="classname">SL::InstanceConfiguration</code>"</p></li><li class="listitem"><p>wird pro Request neu erstellt</p></li></ul></div><p>Funktioniert wie <code class="varname">$::lx_office_conf</code>,
speichert aber Daten die von der Instanz abhängig sind. Eine Instanz
ist hier eine Mandantendatenbank. Beispielsweise überprüft
</p><pre class="programlisting">$::instance_conf->get_inventory_system eq 'perpetual'</pre><p>
- ob die berüchtigte Bestandsmethode zur Anwendung kommt.</p></div><div class="sect3" title="4.1.3.8. $::dispatcher"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4
791"></a>4.1.3.8. $::dispatcher</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ ob die berüchtigte Bestandsmethode zur Anwendung kommt.</p></div><div class="sect3" title="4.1.3.8. $::dispatcher"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4
803"></a>4.1.3.8. $::dispatcher</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="varname">SL::Dispatcher</code>"</p></li><li class="listitem"><p>wird pro Serverprozess erstellt.</p></li><li class="listitem"><p>enthält Informationen über die technische Verbindung zum
Server</p></li></ul></div><p>Der dritte Punkt ist auch der einzige Grund warum das Objekt
global gespeichert wird. Wird vermutlich irgendwann in einem anderen
- Objekt untergebracht.</p></div><div class="sect3" title="4.1.3.9. $::request"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
09"></a>4.1.3.9. $::request</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Hashref (evtl später Objekt)</p></li><li class="listitem"><p>Wird pro Request neu initialisiert.</p></li><li class="listitem"><p>Keine Unterstruktur garantiert.</p></li></ul></div><p>
+ Objekt untergebracht.</p></div><div class="sect3" title="4.1.3.9. $::request"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
21"></a>4.1.3.9. $::request</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Hashref (evtl später Objekt)</p></li><li class="listitem"><p>Wird pro Request neu initialisiert.</p></li><li class="listitem"><p>Keine Unterstruktur garantiert.</p></li></ul></div><p>
<code class="varname">$::request</code> ist ein generischer Platz um
Daten "für den aktuellen Request" abzulegen. Sollte nicht für action
at a distance benutzt werden, sondern um lokales memoizing zu
<code class="varname">$::request</code>
</p></li><li class="listitem"><p>Muss ich von anderen Teilen des Programms lesend drauf
zugreifen? Dann <code class="varname">$::request</code>, aber Zugriff über
- Wrappermethode</p></li></ul></div></div></div><div class="sect2" title="4.1.4. Ehemalige globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e48
51"></a>4.1.4. Ehemalige globale Variablen</h3></div></div></div><p>Die folgenden Variablen waren einmal im Programm, und wurden
- entfernt.</p><div class="sect3" title="4.1.4.1. $::cgi"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
56"></a>4.1.4.1. $::cgi</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil cookie Methoden nicht als
+ Wrappermethode</p></li></ul></div></div></div><div class="sect2" title="4.1.4. Ehemalige globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e48
63"></a>4.1.4. Ehemalige globale Variablen</h3></div></div></div><p>Die folgenden Variablen waren einmal im Programm, und wurden
+ entfernt.</p><div class="sect3" title="4.1.4.1. $::cgi"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
68"></a>4.1.4.1. $::cgi</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil cookie Methoden nicht als
Klassenfunktionen funktionieren</p></li><li class="listitem"><p>Aufruf als Klasse erzeugt Dummyobjekt was im
Klassennamespace gehalten wird und über Requestgrenzen
leaked</p></li><li class="listitem"><p>liegt jetzt unter
<code class="varname">$::request->{cgi}</code>
- </p></li></ul></div></div><div class="sect3" title="4.1.4.2. $::all_units"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
72"></a>4.1.4.2. $::all_units</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil einige Funktionen in Schleifen zum Teil
+ </p></li></ul></div></div><div class="sect3" title="4.1.4.2. $::all_units"><div class="titlepage"><div><div><h4 class="title"><a name="d0e48
84"></a>4.1.4.2. $::all_units</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil einige Funktionen in Schleifen zum Teil
ein paar hundert mal pro Request eine Liste der Einheiten
brauchen, und de als Parameter durch einen Riesenstack von
Funktionen geschleift werden müssten.</p></li><li class="listitem"><p>Liegt jetzt unter
<code class="varname">$::request->{cache}{all_units}</code>
</p></li><li class="listitem"><p>Wird nur in
<code class="function">AM->retrieve_all_units()</code> gesetzt oder
- gelesen.</p></li></ul></div></div><div class="sect3" title="4.1.4.3. %::called_subs"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4
891"></a>4.1.4.3. %::called_subs</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>wurde benutzt um callsub deep recursions
+ gelesen.</p></li></ul></div></div><div class="sect3" title="4.1.4.3. %::called_subs"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4
903"></a>4.1.4.3. %::called_subs</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>wurde benutzt um callsub deep recursions
abzufangen.</p></li><li class="listitem"><p>Wurde entfernt, weil callsub nur einen Bruchteil der
möglichen Rekursioenen darstellt, und da nie welche
auftreten.</p></li><li class="listitem"><p>komplette recursion protection wurde entfernt.</p></li></ul></div></div></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">3.3. Excel-Vorlagen </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.2. Entwicklung unter FastCGI</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>kivitendo: Installation, Konfiguration, Entwicklung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="next" href="ch01.html" title="Kapitel 1. Aktuelle Hinweise"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">kivitendo: Installation, Konfiguration, Entwicklung</th></tr><tr><td width="20%" align="left"> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr></table><hr></div><div lang="de" class="book" title="kivitendo: Installation, Konfiguration, Entwicklung"><div class="titlepage"><div><div><h1 class="title"><a name="kivitendo-documentation"></a>kivitendo: Installation, Konfiguration, Entwicklung</h1></div></div><hr></div><div class="toc"><p><b>Inhaltsverzeichnis</b></p><dl><dt><span class="chapter"><a href="ch01.html">1. Aktuelle Hinweise</a></span></dt><dt><span class="chapter"><a href="ch02.html">2. Installation und Grundkonfiguration</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch02.html#Ben%C3%B6tigte-Software-und-Pakete">2.1. Benötigte Software und Pakete</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02.html#Betriebssystem">2.1.1. Betriebssystem</a></span></dt><dt><span class="sect2"><a href="ch02.html#Pakete">2.1.2. Pakete</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s02.html">2.2. Manuelle Installation des Programmpaketes</a></span></dt><dt><span class="sect1"><a href="ch02s03.html">2.3. kivitendo-Konfigurationsdatei</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s03.html#config.config-file.introduction">2.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.sections-parameters">2.3.2. Abschnitte und Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.prior-versions">2.3.3. Versionen vor 2.6.3</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s04.html">2.4. Anpassung der PostgreSQL-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s04.html#Zeichens%C3%A4tze-die-Verwendung-von-UTF-8">2.4.1. Zeichensätze/die Verwendung von UTF-8</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#%C3%84nderungen-an-Konfigurationsdateien">2.4.2. Änderungen an Konfigurationsdateien</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren">2.4.3. Erweiterung für servergespeicherte Prozeduren</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Datenbankbenutzer-anlegen">2.4.4. Datenbankbenutzer anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s05.html">2.5. Webserver-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s05.html#d0e49
0">2.5.1. Grundkonfiguration mittels CGI</a></span></dt><dt><span class="sect2"><a href="ch02s05.html#Apache-Konfiguration.FCGI">2.5.2. Konfiguration für FastCGI/FCGI</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s06.html">2.6. Der Task-Server</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s06.html#Konfiguration-des-Task-Servers">2.6.1. Verfügbare und notwendige Konfigurationsoptionen</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Einbinden-in-den-Boot-Prozess">2.6.2. Automatisches Starten des Task-Servers beim Booten</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle">2.6.3. Wie der Task-Server gestartet und beendet wird</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle2">2.6.4. Task-Server mit mehreren Mandanten</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s07.html">2.7. Benutzerauthentifizierung und Administratorpasswort</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s07.html#Grundlagen-zur-Benutzerauthentifizierung">2.7.1. Grundlagen zur Benutzerauthentifizierung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Administratorpasswort">2.7.2. Administratorpasswort</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Authentifizierungsdatenbank">2.7.3. Authentifizierungsdatenbank</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Passwort%C3%BCberpr%C3%BCfung">2.7.4. Passwortüberprüfung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Name-des-Session-Cookies">2.7.5. Name des Session-Cookies</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Anlegen-der-Authentifizierungsdatenbank">2.7.6. Anlegen der Authentifizierungsdatenbank</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s08.html">2.8. Benutzer- und Gruppenverwaltung</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s08.html#Zusammenh%C3%A4nge">2.8.1. Zusammenhänge</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Datenbanken-anlegen">2.8.2. Datenbanken anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppen-anlegen">2.8.3. Gruppen anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Benutzer-anlegen">2.8.4. Benutzer anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppenmitgliedschaften-verwalten">2.8.5. Gruppenmitgliedschaften verwalten</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Migration-alter-Installationen">2.8.6. Migration alter Installationen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s09.html">2.9. Drucken mit kivitendo</a></span></dt><dt><span class="sect1"><a href="ch02s10.html">2.10. OpenDocument-Vorlagen</a></span></dt><dt><span class="sect1"><a href="ch02s11.html">2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ <title>kivitendo: Installation, Konfiguration, Entwicklung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="next" href="ch01.html" title="Kapitel 1. Aktuelle Hinweise"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">kivitendo: Installation, Konfiguration, Entwicklung</th></tr><tr><td width="20%" align="left"> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr></table><hr></div><div lang="de" class="book" title="kivitendo: Installation, Konfiguration, Entwicklung"><div class="titlepage"><div><div><h1 class="title"><a name="kivitendo-documentation"></a>kivitendo: Installation, Konfiguration, Entwicklung</h1></div></div><hr></div><div class="toc"><p><b>Inhaltsverzeichnis</b></p><dl><dt><span class="chapter"><a href="ch01.html">1. Aktuelle Hinweise</a></span></dt><dt><span class="chapter"><a href="ch02.html">2. Installation und Grundkonfiguration</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch02.html#Ben%C3%B6tigte-Software-und-Pakete">2.1. Benötigte Software und Pakete</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02.html#Betriebssystem">2.1.1. Betriebssystem</a></span></dt><dt><span class="sect2"><a href="ch02.html#Pakete">2.1.2. Pakete</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s02.html">2.2. Manuelle Installation des Programmpaketes</a></span></dt><dt><span class="sect1"><a href="ch02s03.html">2.3. kivitendo-Konfigurationsdatei</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s03.html#config.config-file.introduction">2.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.sections-parameters">2.3.2. Abschnitte und Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.prior-versions">2.3.3. Versionen vor 2.6.3</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s04.html">2.4. Anpassung der PostgreSQL-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s04.html#Zeichens%C3%A4tze-die-Verwendung-von-UTF-8">2.4.1. Zeichensätze/die Verwendung von UTF-8</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#%C3%84nderungen-an-Konfigurationsdateien">2.4.2. Änderungen an Konfigurationsdateien</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren">2.4.3. Erweiterung für servergespeicherte Prozeduren</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Datenbankbenutzer-anlegen">2.4.4. Datenbankbenutzer anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s05.html">2.5. Webserver-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s05.html#d0e49
3">2.5.1. Grundkonfiguration mittels CGI</a></span></dt><dt><span class="sect2"><a href="ch02s05.html#Apache-Konfiguration.FCGI">2.5.2. Konfiguration für FastCGI/FCGI</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s06.html">2.6. Der Task-Server</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s06.html#Konfiguration-des-Task-Servers">2.6.1. Verfügbare und notwendige Konfigurationsoptionen</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Einbinden-in-den-Boot-Prozess">2.6.2. Automatisches Starten des Task-Servers beim Booten</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle">2.6.3. Wie der Task-Server gestartet und beendet wird</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle2">2.6.4. Task-Server mit mehreren Mandanten</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s07.html">2.7. Benutzerauthentifizierung und Administratorpasswort</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s07.html#Grundlagen-zur-Benutzerauthentifizierung">2.7.1. Grundlagen zur Benutzerauthentifizierung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Administratorpasswort">2.7.2. Administratorpasswort</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Authentifizierungsdatenbank">2.7.3. Authentifizierungsdatenbank</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Passwort%C3%BCberpr%C3%BCfung">2.7.4. Passwortüberprüfung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Name-des-Session-Cookies">2.7.5. Name des Session-Cookies</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Anlegen-der-Authentifizierungsdatenbank">2.7.6. Anlegen der Authentifizierungsdatenbank</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s08.html">2.8. Benutzer- und Gruppenverwaltung</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s08.html#Zusammenh%C3%A4nge">2.8.1. Zusammenhänge</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Datenbanken-anlegen">2.8.2. Datenbanken anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppen-anlegen">2.8.3. Gruppen anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Benutzer-anlegen">2.8.4. Benutzer anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppenmitgliedschaften-verwalten">2.8.5. Gruppenmitgliedschaften verwalten</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Migration-alter-Installationen">2.8.6. Migration alter Installationen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s09.html">2.9. Drucken mit kivitendo</a></span></dt><dt><span class="sect1"><a href="ch02s10.html">2.10. OpenDocument-Vorlagen</a></span></dt><dt><span class="sect1"><a href="ch02s11.html">2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
EUR</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s11.html#config.eur.introduction">2.11.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.parameters">2.11.2. Konfigurationsparameter</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.setting-parameters">2.11.3. Festlegen der Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.inventory-system-perpetual">2.11.4. Bemerkungen zu Bestandsmethode</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.knonw-issues">2.11.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s12.html">2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s12.html#config.skr04-update-3804.introduction">2.12.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.skr04-update-3804.create-chart">2.12.2. Konto 3804 manuell anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s13.html">2.13. kivitendo ERP verwenden</a></span></dt></dl></dd><dt><span class="chapter"><a href="ch03.html">3. Features und Funktionen</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch03.html#features.periodic-invoices">3.1. Wiederkehrende Rechnungen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.introduction">3.1.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.configuration">3.1.2. Konfiguration</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.reports">3.1.3. Auflisten</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.task-server">3.1.4. Erzeugung der eigentlichen Rechnungen</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.create-for-current-month">3.1.5. Erste Rechnung für aktuellen Monat erstellen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s02.html">3.2. Dokumentenvorlagen und verfügbare Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.einf%C3%BChrung">3.2.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.variablen-ausgeben">3.2.2. Variablen ausgeben</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.verwendung-in-druckbefehlen">3.2.3. Verwendung in Druckbefehlen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.tag-style">3.2.4. Anfang und Ende der Tags verändern</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.zuordnung-dateinamen">3.2.5. Zuordnung von den Dateinamen zu den Funktionen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.dateinamen-erweitert">3.2.6. Sprache, Drucker und E-Mail</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.allgemeine-variablen">3.2.7. Allgemeine Variablen, die in allen Vorlagen vorhanden
sind</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.invoice">3.2.8. Variablen in Rechnungen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.dunning">3.2.9. Variablen in Mahnungen und Rechnungen über Mahngebühren</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.andere-vorlagen">3.2.10. Variablen in anderen Vorlagen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.bloecke">3.2.11. Blöcke, bedingte Anweisungen und Schleifen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.markup">3.2.12. Markup-Code zur Textformatierung innerhalb von
- Formularen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s03.html">3.3. Excel-Vorlagen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s03.html#excel-templates.summary">3.3.1. Zusammenfassung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.usage">3.3.2. Bedienung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.syntax">3.3.3. Variablensyntax</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.limitations">3.3.4. Einschränkungen</a></span></dt></dl></dd></dl></dd><dt><span class="chapter"><a href="ch04.html">4. Entwicklerdokumentation</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch04.html#devel.globals">4.1. Globale Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04.html#d0e43
37">4.1.1. Wie sehen globale Variablen in Perl aus?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4438">4.1.2. Warum sind globale Variablen ein Problem?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4471">4.1.3. Kanonische globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4851">4.1.4. Ehemalige globale Variablen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s02.html">4.2. Entwicklung unter FastCGI</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.general">4.2.1. Allgemeines</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.exiting">4.2.2. Programmende und Ausnahmen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.globals">4.2.3. Globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.performance">4.2.4. Performance und Statistiken</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.known-issues">4.2.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s03.html">4.3. SQL-Upgradedateien</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.introduction">4.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.format">4.3.2. Format der Kontrollinformationen</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.dbupgrade-tool">4.3.3. Hilfsscript dbupgrade2_tool.pl</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s04.html">4.4. Translations and languages</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s04.html#translations-languages.introduction">4.4.1. Introduction</a></span></dt><dt><span class="sect2"><a href="ch04s04.html#translations-languages.file-structure">4.4.2. File structure</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s05.html">4.5. Stil-Richtlinien</a></span></dt><dt><span class="sect1"><a href="ch04s06.html">4.6. Dokumentation erstellen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.introduction">4.6.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.required-software">4.6.2. Benötigte Software</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.build">4.6.3. PDFs und HTML-Seiten erstellen</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.repository">4.6.4. Einchecken in das Git-Repository</a></span></dt></dl></dd></dl></dd></dl></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top"> </td><td width="20%" align="center"> </td><td width="40%" align="right" valign="top"> Kapitel 1. Aktuelle Hinweise</td></tr></table></div></body></html>
\ No newline at end of file
+ Formularen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s03.html">3.3. Excel-Vorlagen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s03.html#excel-templates.summary">3.3.1. Zusammenfassung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.usage">3.3.2. Bedienung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.syntax">3.3.3. Variablensyntax</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.limitations">3.3.4. Einschränkungen</a></span></dt></dl></dd></dl></dd><dt><span class="chapter"><a href="ch04.html">4. Entwicklerdokumentation</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch04.html#devel.globals">4.1. Globale Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04.html#d0e43
49">4.1.1. Wie sehen globale Variablen in Perl aus?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4450">4.1.2. Warum sind globale Variablen ein Problem?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4483">4.1.3. Kanonische globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4863">4.1.4. Ehemalige globale Variablen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s02.html">4.2. Entwicklung unter FastCGI</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.general">4.2.1. Allgemeines</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.exiting">4.2.2. Programmende und Ausnahmen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.globals">4.2.3. Globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.performance">4.2.4. Performance und Statistiken</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.known-issues">4.2.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s03.html">4.3. SQL-Upgradedateien</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.introduction">4.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.format">4.3.2. Format der Kontrollinformationen</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.dbupgrade-tool">4.3.3. Hilfsscript dbupgrade2_tool.pl</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s04.html">4.4. Translations and languages</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s04.html#translations-languages.introduction">4.4.1. Introduction</a></span></dt><dt><span class="sect2"><a href="ch04s04.html#translations-languages.file-structure">4.4.2. File structure</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s05.html">4.5. Stil-Richtlinien</a></span></dt><dt><span class="sect1"><a href="ch04s06.html">4.6. Dokumentation erstellen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.introduction">4.6.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.required-software">4.6.2. Benötigte Software</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.build">4.6.3. PDFs und HTML-Seiten erstellen</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.repository">4.6.4. Einchecken in das Git-Repository</a></span></dt></dl></dd></dl></dd></dl></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top"> </td><td width="20%" align="center"> </td><td width="40%" align="right" valign="top"> Kapitel 1. Aktuelle Hinweise</td></tr></table></div></body></html>
\ No newline at end of file
+<!DOCTYPE html>
<html>
<head>
+ <meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
<meta http-equiv="refresh" content="0;URL=controller.pl?action=LoginScreen/user_login">
</head>
<body>
--- /dev/null
+function load_layout(baseURL){
+ $.ajax({
+ url: baseURL + 'controller.pl?action=Layout/empty&format=json',
+ method: 'GET',
+ dataType: 'json',
+ success: function (data) {
+ if (data["stylesheets"]) {
+ $.each(data["stylesheets"], function(i, e){
+ $('head').append('<link rel="stylesheet" href="' + baseURL + e + '" type="text/css" title="Stylesheet">');
+ });
+ }
+ if (data["stylesheets_inline"] && data["stylesheets_inline"].size) {
+ var style = "<style type='text/css'>";
+ $.each(data["stylesheets_inline"], function(i, e){
+ style += e;
+ });
+ style += '</style>';
+ $('head').append(style);
+ }
+ if (data["start_content"]) {
+ $('body').wrapInner(data["start_content"]);
+ }
+ if (data["pre_content"]) {
+ $('body').prepend(data["pre_content"]);
+ }
+ if (data["post_content"]) {
+ $('body').append(data["post_content"]);
+ }
+ if (data["javascripts"]) {
+ $.each(data["javascripts"], function(i, e){
+ $('head').append('<script type="text/javascript" src="' + baseURL + e + '">');
+ });
+ }
+ if (data["javascripts_inline"]) {
+ var script = "<script type='text/javascript'>";
+ $.each(data["javascripts_inline"], function(i, e){
+ script += e;
+ });
+ script += '</script>';
+ $('head').append(script);
+ }
+ }
+ });
+}
});
// legacy. sone forms install these
if (typeof fokus == 'function') { fokus(); return; }
- if (focus_by_name('fokus')) return;
if (focus_by_name('cursor_fokus')) return;
set_cursor_to_first_element();
});
getTopPos : function(inputObj)\r
{ \r
var returnValue = inputObj.offsetTop;\r
+ if (returnValue > 700) returnValue = 0;\r
while((inputObj = inputObj.offsetParent) != null){\r
if(inputObj.tagName!='HTML'){\r
returnValue += (inputObj.offsetTop - inputObj.scrollTop);\r
var cssPrefix; // Css prefix for the menu items.\r
var modelItemRef; // Reference to menuModelItem\r
\r
- this.layoutCSS = 'menu-item.css';\r
+// this.layoutCSS = 'menu-item.css';\r
this.cssPrefix = 'DHTMLSuite_';\r
\r
if(!standardObjectsCreated)DHTMLSuite.createStandardObjects(); \r
*/\r
createItem : function(menuModelItemObj)\r
{\r
- DHTMLSuite.commonObj.loadCSS(this.layoutCSS); // Load css\r
+// DHTMLSuite.commonObj.loadCSS(this.layoutCSS); // Load css\r
\r
DHTMLSuite.variableStorage.arrayOfDhtmlSuiteObjects[this.objectIndex] = this;\r
\r
var globalObjectIndex; // Global index of this object - used to refer to the object of this class outside\r
this.cssPrefix = 'DHTMLSuite_';\r
this.menuItemLayoutCss = false; // false = use default for the menuItem class.\r
- this.layoutCSS = 'menu-bar.css';\r
+// this.layoutCSS = 'menu-bar.css';\r
this.menuBarBackgroundImage = 'menu_strip_bg.jpg';\r
this.menuItem_objects = new Array();\r
DHTMLSuite.variableStorage.menuBar_highlightedItems = new Array();\r
init : function()\r
{\r
\r
- DHTMLSuite.commonObj.loadCSS(this.layoutCSS); \r
+// DHTMLSuite.commonObj.loadCSS(this.layoutCSS); \r
this.__createDivs(); // Create general divs\r
this.__createMenuItems(); // Create menu items\r
this.__setBasicEvents(); // Set basic events.\r
$('div.DHTMLSuite_menuBar_top').click(function(e) {\r
if ($(e.target).attr('class') == 'DHTMLSuite_menuBar_top') { menu.hideSubMenus(); menu.unsetMenuBarState() }\r
});\r
- $('#win1').load(function(){\r
- $('#win1').contents().mousedown(function(){\r
- menu.hideSubMenus();\r
- menu.menuBarState = false;\r
- });\r
- })\r
+ $('#content').mousedown(function(){\r
+ menu.hideSubMenus();\r
+ menu.menuBarState = false;\r
+ });\r
}\r
}\r
\r
--- /dev/null
+/*jshint eqnull:true */
+/*!
+* jQuery Cookie Plugin v1.2
+* https://github.com/carhartl/jquery-cookie
+*
+* Copyright 2011, Klaus Hartl
+* Dual licensed under the MIT or GPL Version 2 licenses.
+* http://www.opensource.org/licenses/mit-license.php
+* http://www.opensource.org/licenses/GPL-2.0
+*/
+(function ($, document, undefined) {
+
+var pluses = /\+/g;
+
+function raw(s) {
+ return s;
+}
+
+function decoded(s) {
+ return decodeURIComponent(s.replace(pluses, ' '));
+}
+
+var config = $.cookie = function (key, value, options) {
+ // write
+ if (value !== undefined) {
+ options = $.extend({}, config.defaults, options);
+
+ if (value === null) {
+ options.expires = -1;
+ }
+
+ if (typeof options.expires === 'number') {
+ var days = options.expires, t = options.expires = new Date();
+ t.setDate(t.getDate() + days);
+ }
+
+ value = config.json ? JSON.stringify(value) : String(value);
+
+ return (document.cookie = [
+ encodeURIComponent(key), '=', config.raw ? value : encodeURIComponent(value),
+ options.expires ? '; expires=' + options.expires.toUTCString() : '', // use expires attribute, max-age is not supported by IE
+ options.path ? '; path=' + options.path : '',
+ options.domain ? '; domain=' + options.domain : '',
+ options.secure ? '; secure' : ''
+ ].join(''));
+ }
+
+ // read
+ var decode = config.raw ? raw : decoded;
+ var cookies = document.cookie.split('; ');
+ for (var i = 0, parts; (parts = cookies[i] && cookies[i].split('=')); i++) {
+ if (decode(parts.shift()) === key) {
+ var cookie = decode(parts.join('='));
+ return config.json ? JSON.parse(cookie) : cookie;
+ }
+ }
+
+ return null;
+};
+
+config.defaults = {};
+
+$.removeCookie = function (key, options) {
+ if ($.cookie(key) !== null) {
+ $.cookie(key, null, options);
+ return true;
+ }
+ return false;
+};
+
+})(jQuery, document);
var vSwitch_Menu = 1;
-var FrameSize = (parent.document.getElementById('menuframe').cols);
-
-function Switch_Menu()
-{
- if (vSwitch_Menu)
- {
- vSwitch_Menu=false;
- parent.document.getElementById('menuframe').setAttribute('cols','30,*');
- }
- else
- {
- vSwitch_Menu=true;
- parent.document.getElementById('menuframe').setAttribute('cols',FrameSize);
- }
- return;
+function Switch_Menu() {
+ vSwitch_Menu=!vSwitch_Menu;
+ SetMenuFolded(vSwitch_Menu);
}
+function SetMenuFolded(on) {
+ if (on) {
+ $('#html-menu').removeClass('folded');
+ $('#content').removeClass('folded');
+ } else {
+ $('#html-menu').addClass('folded');
+ $('#content').addClass('folded');
+ }
+}
+$(function(){
+ SetMenuFolded(vSwitch_Menu);
+})
'Account for interest' => 'Konto für Zinsen',
'Account number' => 'Kontonummer',
'Account number #1, bank code #2, #3' => 'Kontonummer #1, BLZ #2, #3',
+ 'Account number not unique!' => 'Kontonummer bereits vorhanden!',
'Account saved!' => 'Konto gespeichert!',
'Accounting Group deleted!' => 'Buchungsgruppe gelöscht!',
'Accounting Group saved!' => 'Buchungsgruppe gespeichert!',
'Cannot post invoice!' => 'Rechnung kann nicht gebucht werden!',
'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
'Cannot post payment!' => 'Zahlung kann nicht gebucht werden!',
+ 'Cannot post storno for a closed period!' => 'Für einen geschlossenen Zeitraum können keine Stornos gebucht werden!',
'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
'Cannot post transaction with a debit and credit entry for the same account!' => 'Kann Soll und Haben nicht auf dasselbe Konto buchen!',
'Cannot post transaction!' => 'Rechnung kann nicht gebucht werden!',
+++ /dev/null
-am.pl
\ No newline at end of file
+++ /dev/null
-am.pl
\ No newline at end of file
+++ /dev/null
-am.pl
\ No newline at end of file
+++ /dev/null
-am.pl
\ No newline at end of file
+++ /dev/null
-am.pl
\ No newline at end of file
--- /dev/null
+#!/usr/bin/perl
+
+use strict;
+use GD;
+use Getopt::Long;
+use File::Basename;
+
+
+my $css_file = 'generated.css';
+my $image_file = 'generated.png';
+my $class_for_map = 'icon';
+
+GetOptions(
+ 'css-out=s' => \$css_file,
+ 'image-out=s' => \$image_file,
+ 'icon-class=s' => \$class_for_map,
+);
+
+my @files = @ARGV;
+my @gd_images;
+
+GD::Image->trueColor(1);
+
+# read files
+
+for my $filename (@files) {
+ my $image = GD::Image->newFromPng($filename);
+ if (!defined $image) {
+ warn "warning: could not load image '$filename'. skpping...";
+ next;
+ }
+ push @gd_images, {
+ gd => $image,
+ filename => $filename,
+ };
+}
+
+# make target layout
+# for simplification thi will check if all the images have the same dimensions
+# and croak if not
+my $first_height = $gd_images[0]->{gd}->height;
+my $first_width = $gd_images[0]->{gd}->width;
+
+use Data::Dumper;
+
+for my $img (@gd_images) {
+ die 'heights are not equal' if $first_height != $img->{gd}->height;
+ die 'widths are not equal' if $first_width != $img->{gd}->width;
+}
+
+# all equal? nice.
+# we'll be lazy and just put them all together left-to-right
+my $new_height = $first_height;
+my $new_width = $first_width * @gd_images;
+
+my $new_image = GD::Image->new($new_width, $new_height, 1);
+# now copy them all together, and keep a referende to;
+
+$new_image->saveAlpha(1);
+$new_image->alphaBlending(0);
+
+my $h_offset = 0;
+for (@gd_images) {
+ $_->{h_offset} = $h_offset;
+ $_->{v_offset} = 0;
+ $new_image->copy($_->{gd}, $_->{h_offset}, $_->{v_offset}, 0, 0, $_->{gd}->width, $_->{gd}->height);
+} continue {
+ $h_offset += $_->{gd}->width;
+}
+
+# now write that png...
+{
+ open my $file, '>:raw', $image_file or die "can't write to $image_file";
+ print $file $new_image->png;
+}
+
+# make css file
+{
+ open my $file, ">", $css_file or die "can't write too $css_file";
+ print $file ".$class_for_map { background: url(../$image_file) ${first_width}px 0px no-repeat; padding: 0; width: ${first_width}px; height: ${first_height}px; }\n";
+
+ for (@gd_images) {
+ my $name = fileparse($_->{filename}, ".png");
+ $name =~ s/ /-/g;
+ print $file ".$class_for_map.$name { background-position: -$_->{h_offset}px 0px; }\n";
+ }
+}
+
+1;
+
+__END__
+
+=encoding utf-8
+
+=head1 NAME
+
+image_maps - generates image maps for css sprites from images in a directory
+
+=head1 SYNOPSIS
+
+ scripts/image_maps.pl \
+ --out-css=css/icons_16.css \
+ --out-image= image/maps/icons_16.png \
+ image/icons/16x16/*
+
+=head1 DESCRIPTION
+
+=head1 OPTIONS
+
+=head1 BUGS
+
+None yet. :)
+
+=head1 AUTHOR
+
+Sven Schoeling E<lt>s.schoeling@linet-services.deE<gt>
+
+=cut
+
+
}
}
- # if this is the menu.pl file
- if ($file eq 'menu.pl') {
- foreach my $item (@menufiles) {
- &scanmenu("$basedir/$item");
- }
- }
-
- if ($file eq 'menunew.pl') {
- foreach my $item (@menufiles) {
- &scanmenu("$basedir/$item");
- print "." if $opt_v;
- }
- }
-
$file =~ s/\.pl//;
foreach my $text (keys %$missing) {
--- /dev/null
+scripts/image_maps.pl --icon-class=icon16 --css-out=css/icons16.css --image-out=image/maps/icons16.png image/icons/16x16/*.png
+scripts/image_maps.pl --icon-class=icon24 --css-out=css/icons24.css --image-out=image/maps/icons24.png image/icons/24x24/*.png
+scripts/image_maps.pl --icon-class=icon32 --css-out=css/icons32.css --image-out=image/maps/icons32.png image/icons/32x32/*.png
%======Die eigentliche-Tabelle========================================
% temporaere Datei mit Tabelle anlegen
-\begin{filecontents}{<%tmpfile%>.table.tex}
+\begin{filecontents}{<%template_meta.tmpfile%>.table.tex}
\mainfont
\resetlaufsumme
}
\end{filecontents} % Ende der Hilfsdatei.
-\LTXtable{\textwidth}{<%tmpfile%>.table.tex}
+\LTXtable{\textwidth}{<%template_meta.tmpfile%>.table.tex}
\rule{\textwidth}{0pt} % Ein (unsichtbarer) Strich quer ueber die Seite
\vspace{ 5mm}
[%- USE T8 %]
[% USE HTML %]
[%- USE L %]
-<body>
<h1>[% title %]</h1>
<p>
<input type="hidden" name="action" value="analyze">
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
-<body>
<p><div class="listtop">[% title %]</div></p>
<hr>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
-<body>
<p><div class="listtop">[% title %]</div></p>
-->
</script>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
[% USE LxERP %]
-<body>
<h1>[% title %]</h1>
<p>
<input type="submit" value="[% 'Re-run analysis' | $T8 %]">
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
[% USE LxERP %]
-<body>
<h1>[% title %]</h1>
<p>
<input type="button" onclick="history.back()" value="[% 'No' | $T8 %]">
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
[% USE LxERP%]
-<body class="admin" onload="document.getElementById('rpw').focus()">
+ <script type='text/javascript'>
+ $(function(){ document.getElementsById('rpw').focus();});
+ </script>
<div align="center">
<a href="http://www.kivitendo.org"><img src="image/kivitendo.png" border="0"></a>
</div>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin" onload="set_subject(); document.getElementsByName('to')[0].focus(); ">
-
+[%- USE HTML %]
<script type="text/javascript">
<!--
- function set_subject() {
+ $(function(){
+ document.getElementsByName('to')[0].focus();
+ set_subject();
+ });
+
+ function set_subject () {
var subject_template = "[% 'Backup of dataset' | $T8 %]";
var subject = document.Form.subject.value;
[% END %]
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<p>[% LxERP.t8('The dataset backup has been sent via email to #1.', to) | html %]</p>
<input type="hidden" name="nextsub" value="list_users">
<input type="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<form method="post" action="admin.pl">
-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<form method="post" action="admin.pl">
<p>[% 'Leave host and port field empty unless you want to make a remote connection.' | $T8 %]</p>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body class="admin">
-
<h2>[% title %]</h2>
<form method="post" action="admin.pl">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<form method="post" action="admin.pl">
<p><input type="submit" class="submit" name="action" value="[% 'Continue' | $T8 %]"></p>
</form>
-</body>
-</html>
<input type="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<p><a href="admin.pl?action=pg_database_administration">[% 'Back' | $T8 %]</a></p>
<form method="post" action="admin.pl">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% 'Delete group' | $T8 %]: [% name %]</div>
<p class="message_hint">[ [% name %] ] - [% 'Do you really want to delete this group?' | $T8 %]</p>
<input type="submit" class="submit" name="action" value="[% 'Delete' | $T8 %]">
</form>
- </body>
-</html>
[% USE T8 %][% USE HTML %][% USE L %][% USE LxERP -%]
-<body>
[% L.stylesheet_tag('jquery.multiselect2side') %]
[% L.javascript_tag('jquery.selectboxes', 'jquery.multiselect2side') %]
</form>
[% L.multiselect2side('user_ids_', labelsx => LxERP.t8('All users'), labeldx => LxERP.t8('Users in this group')) %]
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
<div class="listtop">[% 'Edit group membership' | $T8 %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% 'Edit groups' | $T8 %]</div>
[% IF message %]
</form>
-</body>
-</html>
+ <hr size="2" noshade>
[%- USE T8 %]
[%- USE HTML %]
[%- USE L %]
-<body class="admin">
-
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/jquery.js"></script>
<script type="text/javascript">
-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin" onload="">
-
+[%- USE HTML %]
<h1>[% title %]</h1>
<form method="post" action="admin.pl">
<hr size="3" noshade>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin" onload="document.getElementsByName('dbname')[0].focus(); ">
+[%- USE HTML %]
+ <script type='text/javascript'>
+ $(function(){ document.getElementsByName('dbname')[0].focus();});
+ </script>
<h2>[% title %]</h2>
</form>
-</body>
-</html>
<input type="hidden" name="nextsub" value="list_users">
<input type="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-<body class="admin">
-
<h2>[% title %]</h2>
<p>[%- 'The restoration process has started. Here\'s the output of the "pg_restore" command:' | $T8 %]</p>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
</p>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="admin">
-
+[%- USE HTML %]
<h2>[% title %]</h2>
<p><a href="admin.pl?action=pg_database_administration">[% 'Back' | $T8 %]</a></p>
[% IF ALL_UPDATED %]
[% END %]
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-<body>
<form method=post>
</form>
-</body>
-</html>
[%- USE T8 %]
-<body>
<form method='post'>
<h1 class=listtop>[% title %]</h1>
<input type="submit" name='get_login_form' value="[% 'Back' | $T8 %]">
<input type="submit" name="add_printer" value ="[% 'Add' | $T8 %]">
</form>
-</body>
-</html>
[%- USE LxERP %]
[%- USE T8 %]
[%- USE L %]
-<body>
<h1>[% title | html %]</h1>
</form>
-</body>
-</html>
[%- USE L %]
[%- USE LxERP %]
[%- USE T8 %]
-<body>
<h1>[% title | html %]</h1>
[%- USE L %]
[%- USE LxERP %]
[%- USE T8 %]
-<body>
<h1>[% title | html %]</h1>
</form>
- </body>
- </html>
[%- USE T8 %]
[%- USE LxERP %]
-[% USE HTML %][% USE L %]<body onLoad="fokus()">
-
+[%- USE HTML %][%- USE L %]
<p>
<div class="listtop">[% title %]</div>
</p>
-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
<input type="submit" class="submit" name="action" value="[% 'Delete' | $T8 %]">
</form>
-</body>
</form>
</script>
<script type="text/javascript">
-window.onload = function() {
+$(function() {
setupDependencies('EditAccount'); //name of form(s). Seperate each with a comma (ie: 'weboptions', 'myotherform' )
- };
+});
</script>
-<body>
<form method="post" name="EditAccount" action="am.pl">
<input type="hidden" name="id" value="[% HTML.escape(id) %]">
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
[% IF MESSAGE %]<p>[% MESSAGE %]</p>[% END %]
<table border="0">
<tr>
<td align="right">[% 'Description' | $T8 %]</td>
- <td><input name="description" value="[% HTML.escape(description) %]"></td>
+ <td><input id="description" name="description" value="[% HTML.escape(description) %]"></td>
</tr>
<tr>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<form method="post" action="am.pl">
<input type="hidden" name="id" value="[% HTML.escape(id) %]">
<input type="hidden" name="type" value="tax">
[% END %]
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<h1>[% title %]</h1>
</p>
[% IF CAN_EDIT %]
- <p><textarea name="content" id="content" cols="100" rows="25">[% HTML.escape(content) %]</textarea></p>
+ <p><textarea name="content" id="edit_content" cols="100" rows="25">[% HTML.escape(content) %]</textarea></p>
<p>
<input type="hidden" name="save_nextsub" value="save_template">
</form>
-</body>
-</html>
<script type="text/javascript" src="js/jquery-ui.js"></script>
-<body>
[% IF saved_message %]
<p>[% saved_message %]</p>
[% L.sortable_element('#unit_list tbody', url => 'controller.pl?action=Unit/reorder', with => 'unit_id') %]
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body [% IF onload %]onload="[% onload %]"[% END %]>
-
+[%- USE HTML %]
[% IF saved_message %]
<p>[% saved_message %]</p>
[% END %]
<tr>
<td align="right">[% 'Description' | $T8 %]</td>
<td>
- <input name="description" size="60" value="[% HTML.escape(description) %]">
+ <input id='description' name="description" size="60" value="[% HTML.escape(description) %]">
<input type="hidden" name="orig_description" value="[% HTML.escape(description) %]">
</td>
</tr>
[% END %]
-</body>
-</html>
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE T8 %]
-<body>
<form method=post action=am.pl>
[%- USE L %]
[%- USE LxERP %]
[%- USE T8 %]
-<body>
<h1>[% title | html %]</h1>
</form>
- </body>
- </html>
[%- USE HTML %]
[%- USE T8 %]
-<body>
<form method=post action=am.pl>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body>
<table width=100%>
<tr>
</form>
- </body>
- </html>
[%- USE T8 %]
[%- USE HTML %]
-<body>
<h1>[% title %]</h1>
<table width="100%">
</table>
-</body>
<script type='text/javascript'>
function account_details(id) {
$.ajax({
</script>
-</html>
<script type="text/javascript" src="js/jquery-ui.js"></script>
-<body>
[% IF MESSAGE %]<p>[% MESSAGE %]</p>[% END %]
[% L.sortable_element('#price_factor_list tbody', url => 'controller.pl?action=PriceFactor/reorder', with => 'price_factor_id') %]
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop">[% title %]</div>
</form>
</p>
-</body>
-</html>
<script type="text/javascript" src="js/jquery-ui.js"></script>
-<body>
[% IF saved_message %]<p>[% saved_message %]</p>[% END %]
[% L.sortable_element('#warehouse_list tbody', url => 'controller.pl?action=Warehouse/reorder', with => 'warehouse_id') %]
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="document.Form.name.focus();">
+[%- USE HTML %]
+ <script type='text/javascript'>
+ $(function(){document.Form.name.focus();});
+ </script>
<style type="text/css">
.small {
</form>
-</body>
-</html>
<script type="text/javascript" src="js/jquery-ui.js"></script>
-<body>
[% IF MESSAGE %]<p>[% MESSAGE %]</p>[% END %]
[% L.sortable_element('#cvarcfg_list tbody', url => 'controller.pl?action=CustomVariableConfig/reorder', with => 'cvarcfg_id') %]
-</body>
-</html>
</form>
-</body>
-</html>
</script>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-<body>
<form method=post name="search" action=[% script %]>
<th align=right>[% 'Vendor' | $T8 %]</th>
<td colspan=3>
[%- INCLUDE 'generic/multibox.html'
+ id = 'vendor',
name = 'vendor',
default = oldvendor,
style = 'width: 250px',
<br>
<input class=submit type=submit name=action value="[% 'Continue' | $T8 %]">
</form>
- </body>
- <script type="text/javascript">
- <!--
- $(document).ready(function(){
- focus();
- setupDateFormat('[% dateformat | html %]','[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat | html %]','[% 'wrongformat' | $T8 %]');
- })
- //-->
- </script>
-</html>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
-<body onLoad="[% onload %]">
-
<form method=post name="arledger" action="[% script %]">
[% L.hidden_tag('id', id) %]
<th align="right" nowrap>[% 'Customer' | $T8 %]</th>
<td colspan=3>
[%- IF selectcustomer %]
- <select name="customer" onchange="document.getElementById('update_button').click();">[% selectcustomer %]</select>
+ <select id='customer' name="customer" onchange="document.getElementById('update_button').click();">[% selectcustomer %]</select>
[%- ELSE %]
- <input name=customer value="[% customer | html %]" size=35>
+ <input id='customer' name=customer value="[% customer | html %]" size=35>
[%- END %]
<input type="button" value="[% 'Details (one letter abbreviation)' | $T8 %]" onclick="show_vc_details('customer')"></td>
[% L.hidden_tag('selectcustomer', selectcustomer) %]
[%- USE T8 %]
[%- USE L %]
-<body>
<form method=post name="search" action=[% script %]>
<!--
$(document).ready(function(){
$('customer').focus();
- setupDateFormat('[% dateformat | html %]','[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat | html %]','[% 'wrongformat' | $T8 %]');
})
//-->
</script>
- </body>
-</html>
[%- USE T8 %]
[%- USE L %]
[%- USE LxERP %]
-<body>
<h1>[% 'Select from one of the projects below' | $T8 %]</h1>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<h1>[% FORM.title %]</h1>
<a href="[% SELF.url_for(action => 'list') %]">[%- LxERP.t8('Abort') %]</a>
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<h1>[% FORM.title %]</h1>
[%- INCLUDE 'common/flash.html' %]
<a href="[% SELF.url_for(controller => 'TaskServer', action => 'show') %]">[%- LxERP.t8('Task server control') %]</a>
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<h1>[% FORM.title %]</h1>
[%- INCLUDE 'common/flash.html' %]
<a href="[% SELF.url_for(controller => 'TaskServer', action => 'show') %]">[%- LxERP.t8('Task server control') %]</a>
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<h1>[% FORM.title %]</h1>
<p>
<a href="[% back_to %]">[%- LxERP.t8('Back') %]</a>
</p>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
[%- IF params.error %]
<p><div class="message_error">[% params.error %]</div></p>
</p>
</form>
-</body>
-</html>
[%- USE url %]
[%- SET list_spool__callback = href _ '&sort=' _ sort %]
[% L.javascript_tag('jquery.checkall') %]
-<body>
<h1>[% title | html %]</h1>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
[%- USE HTML %]
-<body>
<form method=post action=bp.pl>
<h1>[% 'Print' | $T8 %] [% label.$type.title %]</h1>[% L.hidden_tag('title', LxERP.t8('Print') _ ' ' _ label.$type.title) %]
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<form method="post" action="controller.pl">
<div class="listtop">[% FORM.title %]</div>
<a href="[% SELF.url_for(action => 'list') %]">[%- LxERP.t8('Abort') %]</a>
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<div class="listtop">[% FORM.title %]</div>
[%- INCLUDE 'common/flash.html' %]
<a href="[% SELF.url_for(action => 'new') %]">[%- LxERP.t8('Create new business') %]</a>
</p>
</form>
-</body>
-</html>
[% USE T8 %]
[% USE HTML %]
[% USE LxERP %]
-
-<body onLoad="[% onload %]">
-
<form method=post action="[% script %]">
[% L.hidden_tag('accno', accno) %]
<br>[% L.submit_tag('action', LxERP.t8('List Transactions')) %]
</form>
-</body>
-</html>
//-->
</script>
-</body>
-</html>
<hr>
[% END %]
-<body>
<div width="100%" class="listtop">
[% IF is_customer %][% 'Customer details' | $T8 %][% ELSE %][% 'Vendor details' | $T8 %][% END %] "[% HTML.escape(name) %]"
[% END %]
-</body>
-</html>
<input class=submit type=submit name=action value="[% 'Post' | $T8 %]">
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE T8 %]
[%- USE LxERP %]
-<body onload=[% onload %]>
-
<form method=post action=cp.pl>
[% L.hidden_tag('defaultcurrency', defaultcurrency) %]
<tr>
<th align="right" valign="top">[%- LxERP.t8('Default buchungsgruppe') %]:</th>
<td colspan="10" valign="top">
- [% opts = SELF.all_buchungsgruppen, title_key = 'description', default = SELF.profile.get('default_buchungsgruppe') %]
- [% L.select_tag('settings.default_buchungsgruppe', opts, style => 'width: 300px') %]
+ [% L.select_tag('settings.default_buchungsgruppe', SELF.all_buchungsgruppen, title_key = 'description', default = SELF.profile.get('default_buchungsgruppe'), style => 'width: 300px') %]
<br>
[% opts = [ [ 'never', LxERP.t8('Do not set default buchungsgruppe') ], [ 'all', LxERP.t8('Apply to all parts') ], [ 'missing', LxERP.t8('Apply to parts without buchungsgruppe') ] ] %]
[% L.select_tag('settings.apply_buchungsgruppe', opts, default = SELF.profile.get('apply_buchungsgruppe'), style = 'width: 300px') %]
<tr>
<th align="right" valign="top">[%- LxERP.t8('Default unit') %]:</th>
<td colspan="10" valign="top">
- [% opts = SELF.all_units, title_key = 'name', value_key = 'name', default = SELF.profile.get('default_unit') %]
- [% L.select_tag('settings.default_unit', opts, style => 'width: 300px') %]
+ [% L.select_tag('settings.default_unit', SELF.all_units, title_key='name', value_key='name', default=SELF.profile.get('default_unit'), style = 'width: 300px') %]
</td>
</tr>
[%- USE LxERP %]
[%- USE L %]
[%- USE T8 %]
-<body>
<div class="listtop">[% FORM.title %]</div>
});
-->
</script>
-</body>
-</html>
</table>
-[% IF cp_id %]
- <input type="submit" id="delete_contact" name="action" value="[% 'Delete Contact' | $T8 %]">
-[% END %]
+ [% IF cp_id %]
+ <input type="button" id="delete_contact" onclick="submitInputButton(this);" name="action" value="[% 'Delete Contact' | $T8 %]">
+ [% END %]
<br style="clear: left" />
function enable_delete_shipto(used) { var s=document.getElementById('delete_shipto'); if (s) s.disabled = (used > 0 ? true : false); }
function enable_delete_contact(used){ var s=document.getElementById('delete_contact'); if (s) s.disabled = (used > 0 ? true : false); }
+ function submitInputButton(button)
+ {
+ var hidden = document.createElement("input");
+ hidden.setAttribute("type", "hidden");
+
+ if( button.hasAttribute("name") )
+ hidden.setAttribute("name", button.getAttribute("name"));
+
+ if( button.hasAttribute("value") )
+ hidden.setAttribute("value", button.getAttribute("value"));
+
+
+ button.form.appendChild(hidden);
+
+ button.disabled = true;
+
+ button.form.submit();
+ }
+
var maintab = new ddtabcontent("maintab");
maintab.setpersist(true);
maintab.setselectedClassTarget("link"); //"link" or "linkparent"
-->
</script>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
[% USE L %]
-<body>
<h1>[% title %]</h1>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %]<body onload="fokus()">
-
+[%- USE HTML %]
<form method="post" action="ct.pl" name="Form">
<input type="hidden" name="db" value="[% HTML.escape(db) %]">
<tr>
<th align="right" nowrap>[% IF IS_CUSTOMER %][% 'Customer Name' | $T8 %][%- ELSE %][% 'Vendor Name' | $T8 %][%- END %]</th>
- <td><input name="name" size="35"></td>
+ <td><input id="name" name="name" size="35"></td>
</tr>
<tr>
<input type="submit" class="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE T8 %]
-<body onload="fokus()">
-
<form method="post" action="ct.pl" name="Form">
<input type="hidden" name="db" value="[% db | html %]">
<input type="submit" class="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-<body>
<form method=post action='[% script %]'>
<input type=submit class=submit name=action value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
<html>
-<body>
Export in Bearbeitung<br>
<br>
%]
[% END %]
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-<body>
<form method=post action="[% script %]">
<input type=submit class=submit name=action value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-<body>
<form method=post action="[% script %]">
<table width=100%>
<input type=submit class=submit name=action value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]<p>[% '...done' | $T8 %]</p>
-<form action="[% IF is_admin %]admin.pl[% ELSE %][% menufile %][% END %]">
+<form action="[% IF is_admin %]admin.pl[% ELSE %][% login.pl %][% END %]">
- <input type="hidden" name="action" value="[% IF is_admin %]login[% ELSE %]display[% END %]">
+ <input type="hidden" name="action" value="[% IF is_admin %]login[% ELSE %]company_logo[% END %]">
<p><input type="submit" value="[% 'Continue' | $T8 %]"></p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<table width="100%">
<tr>
[% USE HTML %][% USE T8 %][% USE L %][% USE LxERP %]
[% SET is_used = SELF.department.is_used %]
-<body>
<form method="post" action="controller.pl">
<div class="listtop">[% FORM.title %]</div>
<a href="[% SELF.url_for(action => 'list') %]">[%- 'Abort' | $T8 %]</a>
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE T8 %][% USE L %][% USE LxERP %]
-<body>
<div class="listtop">[% FORM.title %]</div>
[%- INCLUDE 'common/flash.html' %]
<a href="[% SELF.url_for(action => 'new') %]">[%- 'Create new department' | $T8 %]</a>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
<div class="listtop">[% 'Delete delivery order' | $T8 %]</div>
<input name="action" class="submit" type="submit" value="[% 'No' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<!-- <body> -->
-<!-- <form> -->
-<!-- <p> -->
-<!-- <table> -->
-
+[% USE HTML %][% USE LxERP %]
[%- IF delivered %]
[%- SET RO = ' readonly' %]
[%- END %]
}
}
</script>
-</body>
-</html>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body onload="on_load()">
-
<script type="text/javascript" src="js/show_form_details.js"></script>
<script type="text/javascript" src="js/show_history.js"></script>
<script type="text/javascript" src="js/show_vc_details.js"></script>
<script type="text/javascript" src="js/stock_in_out.js"></script>
<script type="text/javascript" src="js/follow_up.js"></script>
- <script type="text/javascript">
- <!--
- function on_load() {
- [% IF onload %][% onload %];[% END %]
- setupDateFormat('[% myconfig_dateformat %]', '[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% myconfig_numberformat %]', '[% 'wrongformat' | $T8 %]');
- }
- -->
- </script>
-
<style type="text/css">
.fixed_width {
width: 250px;
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE LxERP %]<body onload="on_load();">
-
+[%- USE HTML %][%- USE LxERP %]
[%- IF vc == 'customer' %]
[%- SET is_customer = '1' %]
[%- ELSE %]
[%- END %]
<script type="text/javascript">
- <!--
- function on_load() {
- document.Form.donumber.focus();
- }
- -->
+ $(function(){ document.Form.donumber.focus(); });
</script>
<style type="text/css">
<input class="submit" type="submit" name="action" value="[% 'Continue' | $T8 %]">
</p>
</form>
-
-</body>
-</html>
[% USE HTML %]
[% USE L %]
[% L.javascript_tag('jquery') %]
-<body onload="on_load();">
-
<script type="text/javascript">
<!--
- function on_load() {
+ $(function(){
var row = $('#row').attr('value');
window.opener.document.getElementsByName("stock_" + $('#in_out').attr('value') + "_" + row)[0].value = $('#stock').attr('value');
$(window.opener.document.getElementById("stock_in_out_qty_display_" + row)).html($('#qty_display').attr('value'));
$(window.opener.document.getElementById("stock_in_out_qty_matches_" + row)).val([% qty_matches %]);
window.close();
- }
+ });
-->
</script>
<input type="hidden" name="qty_display" id="qty_display" value="[% HTML.escape(qty_display) %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE LxERP %][% USE JavaScript %]<body[% UNLESS delivered %] onload="on_load();"[% END %]>
-
+[%- USE HTML %][%- USE LxERP %][%- USE JavaScript %]
[%- UNLESS delivered %]
<script type="text/javascript">
<!--
control.options[initial_bin_index].selected = true;
}
- function on_load() {
+ $(function(){
[%- USE STOCK_INFO_it = Iterator(STOCK_INFO) %][%- FOREACH si = STOCK_INFO_it %]
// new si for wh [% si.warehouse_id %] bin [% si.bin_id %]
[%- SET warehouse_selected = '0' %]
warehouse_selected([% STOCK_INFO_it.count %], 0);
[%- END %]
[%- END %]
- }
+ });
-->
</script>
[%- END %]
[%- END %]
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
[%- IF delivered %]
[%- SET RO = ' readonly' %]
[%- END %]
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<form action="[% HTML.escape(script) %]" method="post">
</table>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<form action="[% HTML.escape(script) %]" method="post">
</table>
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]<script type="text/javascript" src="js/common.js"></script>
-<script type="text/javascript">
- <!--
- function setup_controls() {
- fokus();
- setupDateFormat('[% myconfig_dateformat %]', '[% 'Wrong date format!' | $T8 %]');
- setupPoints('[% myconfig_numberformat %]', '[% 'wrongformat' | $T8 %]');
- }
- -->
-</script>
-
-<body onLoad="setup_controls();">
-
<div class="listtop">[% title %]</div>
<form method="post" name="search" action="dn.pl">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/dunning.js"></script>
<input class="submit" type="submit" name="action" value="[% 'Save' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE L %]
-<body onLoad="[% onload %]">
-
<script type="text/javascript" src="js/common.js"></script>
<form method="post" name="search" action="dn.pl">
<th align="right">[% 'Customer' | $T8 %]</th>
<td colspan="3">
[% IF SHOW_CUSTOMER_DDBOX %]
- <select name="customer_id">
+ <select id='customer' name="customer_id">
<option value=""></option>
[% FOREACH row = ALL_CUSTOMERS %]<option value="[% HTML.escape(row.id) %]">[% HTML.escape(row.name) %]</option>
[% END %]
</select>
[% ELSE %]
- <input name="customer" size="35">
+ <input id='customer' name="customer" size="35">
[% END %]
</td>
</tr>
<input class="submit" type="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<script type="text/javascript">
<!--
function email_updated() {
<button type="button" onclick="email_updated()">[% 'Save and close' | $T8 %]</button>
</form>
-</body>
-</html>
[% USE HTML %] <input type="hidden" name="rowcount" value="[% rowcount %]">
<p>
- <input type="checkbox" name="force_lang" size="6" value="1" onclick="document.getElementsByName('language_id')[0].disabled = !document.getElementsByName('force_lang')[0].checked;">
+ <input type="checkbox" id='force_lang' name="force_lang" size="6" value="1">
[% 'Override invoice language' | $T8 %]
[% PRINT_OPTIONS %]
</p>
</p>
</form>
+ <script type='text/javascript'>
+ $(function(){$("select[name='language_id']").attr('disabled', $('#force_lang').attr('checked') ? '' : 'disabled')})
+ $('#force_lang').click(function(){ $('select[name="language_id"]').attr('disabled', $('#force_lang').attr('checked') ? '' : 'disabled') })
+ </script>
[% L.javascript_tag('jquery.checkall') %]
[% SET all_active = 1 %][% FOREACH row = DUNNINGS %][% IF !row.active %][% SET all_active = 0 %][% LAST %][% END %][% END %]
[% SET all_email = 1 %][% FOREACH row = DUNNINGS %][% IF !row.email %][% SET all_email = 0 %][% LAST %][% END %][% END %]
-<body [% IF onload %] onload="[% onload %]"[% END %]>
-
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/dunning.js"></script>
<hr size=3 noshade>
- <input type="checkbox" name="force_lang" size="6" value="1" onclick="document.getElementsByName('language_id')[0].disabled = !document.getElementsByName('force_lang')[0].checked;">
+ <input type="checkbox" id='force_lang' name="force_lang" size="6" value="1">
[% 'Override invoice language' | $T8 %]
[% PRINT_OPTIONS %]
[% UNLESS DEBUG_DUNNING %]onclick="this.disabled=true; this.value='[% 'The dunning process started' | $T8 %]'; document.Form.submit()"[% END %]>
</form>
-</body>
-</html>
+ <script type='text/javascript'>
+ $(function(){$("select[name='language_id']").attr('disabled', $('#force_lang').attr('checked') ? '' : 'disabled')})
+ $('#force_lang').click(function(){ $('select[name="language_id"]').attr('disabled', $('#force_lang').attr('checked') ? '' : 'disabled') })
+ </script>
+
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %]<body onload="on_load();">
-
+[%- USE HTML %]
<script type="text/javascript">
- <!--
- function on_load() {
- document.Form.subject.focus();
- }
- -->
+ $(function(){ document.Form.subject.focus(); });
</script>
<form action="fu.pl" method="post" name="Form">
<input type="hidden" name="trans_rowcount" value="[% LINKS.size %]">
</form>
-</body>
-</html>
-<body onload="window.close()"></body></html>
+<script type='text/javascript'>$(function(){ window.close() })</script>
[%- USE T8 %]
[% USE HTML %]
-<body>
[%- IF SAVED_MESSAGE %]
<p>[% SAVED_MESSAGE %]</p>
</p>
</form>
-</body>
-</html>
<input type="hidden" name="callback" value="[% HTML.escape(callback) %]">
<input type="hidden" name="rowcount" value="[% FOLLOW_UPS.size %]">
- <p>
<table width="100%">
<tr>
<td class="listheading"> </td>
</td>
<td>[% HTML.escape(row.follow_up_date) %]</td>
<td>[% HTML.escape(row.created_on) %]</td>
- <td><a href="[% edit_url %][% HTML.escape(row.id) %]">[% HTML.escape(row.subject) %]</a></td>
- <td>[% IF row.reference_link %]<a href="[% row.reference_link %]">[% END %][% HTML.escape(row.reference) %][% IF row.reference_link %]</a>[% END %]</td>
+ <td><a href="[% edit_url | html %][% HTML.escape(row.id) %]">[% HTML.escape(row.subject) %]</a></td>
+ <td>[% IF row.reference_link %]<a href="[% row.reference_link | html %]">[% END %][% HTML.escape(row.reference) %][% IF row.reference_link %]</a>[% END %]</td>
<td>[% HTML.escape(row.created_by_name) %]</td>
</tr>
[%- END %]
</table>
- </p>
<p>
<input type="hidden" name="action" value="dispatcher">
[%- USE T8 %]
[%- USE L %]
[% USE HTML %]
-<body onload="on_load()">
-
<script type="text/javascript">
- <!--
- function on_load() {
- document.Form.subject.focus();
- }
- -->
+ $(function(){ document.Form.subject.focus(); });
</script>
<div class="listtop">[% title %]</div>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<form name="Form">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
}
</script>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
-<body[% IF onload %] onload="[% onload %]"[% END %]>
-
<form method="post">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
//-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="fokus()">
-
+[%- USE HTML %]
<form name="Form" method="post" action="[% script %]">
<table width="100%">
<tr>
<th align="right" nowrap>[% 'To' | $T8 %]</th>
- <td><input name="email" size="30" value="[% HTML.escape(email) %]"></td>
+ <td><input id="email" name="email" size="30" value="[% HTML.escape(email) %]"></td>
</tr>
<tr>
<th align="right" nowrap>[% 'Cc' | $T8 %]</th>
<tr>
<th align="right" nowrap>[% 'Subject' | $T8 %]</th>
- <td><input name="subject" size="30" value="[% HTML.escape(subject) %]"></td>
+ <td><input id="subject" name="subject" size="30" value="[% HTML.escape(subject) %]"></td>
</tr>
<tr>
<th align="right" nowrap>[% 'Attachment name' | $T8 %]</th>
<input name="action" class="submit" type="submit" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="message_error">[% IF title_error %][% title_error %][% ELSE %][% 'Error!' | $T8 %][% END %]
<p class="message_error_label">[% label_error %]</p>
[%- END %]
-</body>
-</html>
-[%- USE LxERP %][% USE HTML %]<body>
+[%- USE LxERP %]
+[%- USE HTML %]
<h1 class="message_error">[%- LxERP.t8('Error!') %]</h1>
</table>
</div>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
- <table width="100%">
- <tr>
- <th class="message_ok">[% IF title_information %][% title_information %][% ELSE %][% 'Information' | $T8 %][% END %]</th>
- </tr>
- <tr height="5"></tr>
+<div class="message_ok">[% IF title_information %][% title_information %][% ELSE %][% 'Information' | $T8 %][% END %]</div>
+<p>[% label_information %]</p>
- <tr><td>[% label_information %]</td></tr>
- </table>
-
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %] <body>
+[%- USE HTML %]
<h4 class="error">[% 'Item not on file!' | $T8 %]
<input class="submit" type="submit" name="action_back_to_record" value="[% 'Back' | $T8 %]">
</form>
- </body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body [% IF onload %]onload="[% onload %]"[% END %]>
-
+[%- USE HTML %]
<form action="[% HTML.escape(script) %]" method="post" name="Form">
<input type="hidden" name="input_partnumber" value="[% HTML.escape(input_partnumber) %]">
//-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<form name="Form">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
//-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body [% IF onload %]onload="[% onload %]"[% END %]>
-
+[%- USE HTML %]
<form method="post" action="[% HTML.escape(script) %]">
<input type="hidden" name="nextsub" value="[% HTML.escape(nextsub) %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<form name="Form">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
//-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<form name="Form">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
-->
</script>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<p>
<div class="listtop">[% HTML.escape(title) %]</div>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<p>
<div class="listtop">[% HTML.escape(title) %]</div>
</form>
-</body>
-</html>
</form>
-</body>
-</html>
[%- USE LxERP %]
[%- USE T8 %]
[%- USE L %]
-<body onLoad="focus()">
-
<script type="text/javascript">
<!--
function setTaxkey(row) {
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body onLoad="[% onload %]">
-
<form method=post action=gl.pl>
<input type=hidden name=sort value=datesort>
<input class=submit type=submit name=action value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body>
<form method="post" action="ic.pl">
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body>
<form method="post" action="ic.pl">
<input type="button" class="submit" onclick="history.back()" value="[% 'Back' | $T8 %]">
</p>
</form>
-</body>
-</html>
-->
</script>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body onLoad="fokus()">
-
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/parts_language_selection.js"></script>
<table>
<tr>
<th align="right">[% 'Part Number' | $T8 %]</th>
- <td><input name="partnumber" value="[% HTML.escape(partnumber) %]" size="40"></td>
+ <td><input id='partnumber' name="partnumber" value="[% HTML.escape(partnumber) %]" size="40"></td>
</tr>
<tr>
<th align="right">[% 'Part Description' | $T8 %]</th>
[%- USE T8 %]
-[% USE HTML %]<body onload="[% onload %]">
-
+[%- USE HTML %]
<form name="Form">
<input type="hidden" name="input_name" value="[% HTML.escape(input_name) %]">
//-->
</script>
-</body>
-</html>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body>
<form method="post" action="ic.pl">
</td>
</tr>
+ <tr>
+ <td>
+ <input name="l_notes" id="l_notes" class="checkbox" type="checkbox" value="Y">
+ <label for="l_notes">[% 'Notes' | $T8 %]</label>
+ </td>
+ </tr>
+
[% CUSTOM_VARIABLES_INCLUSION_CODE %]
</table>
</td>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body>
<form method="post" action="ic.pl">
</p>
</form>
-</body>
-</html>
[% USE LxERP %][% USE HTML %][% USE L %]
-<body>
<div class="listtop">[% title %]</div>
[% L.submit_tag('action', LxERP.t8('Continue')) %]
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<form method="post" action="[% HTML.escape(script) %]">
[% L.submit_tag("__dummy", LxERP.t8("Continue")) %]
</form>
-</body>
-</html>
</form>
-</body>
-</html>
[%- USE LxERP %]
[%- USE L %]
[%- SET follow_up_trans_info = invnumber _ ' (' _ vendor_name _ ')' %]
-<body>
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/vendor_selection.js"></script>
<script type="text/javascript" src="js/calculate_qty.js"></script>
<th align="right">[% 'Vendor' | $T8 %]</th>
<td>
[%- INCLUDE 'generic/multibox.html'
+ id = 'vendor',
name = 'vendor',
style = 'width: 250px',
DATA = ALL_VENDORS,
[% IF creditwarning != '' %]
alert('[% 'Credit Limit exceeded!!!' | $T8 %]');
[% ELSE %]
- focus();
[% END %]
- setupDateFormat('[% dateformat %]', '[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat %]', '[% 'wrongformat' | $T8 %]');
});
function set_duedate() {
$.ajax({
<input type="hidden" name="gldate" value="[% gldate %]">
</form>
-</body>
-</html>
[%- USE LxERP %]
[%- USE L %]
[%- SET follow_up_trans_info = invnumber _ ' (' _ customer_name _ ')' %]
-<body>
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/delivery_customer_selection.js"></script>
<script type="text/javascript" src="js/vendor_selection.js"></script>
<th align="right">[% 'Customer' | $T8 %]</th>
<td>
[%- INCLUDE 'generic/multibox.html'
+ id = 'customer',
name = 'customer',
style = 'width: 250px',
DATA = ALL_CUSTOMERS,
[% ELSIF creditwarning != '' %]
alert('[% 'Credit Limit exceeded!!!' | $T8 %]');
[% ELSE %]
- focus();
[% END %]
- setupDateFormat('[% dateformat %]', '[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat %]', '[% 'wrongformat' | $T8 %]');
});
function set_duedate() {
$.ajax({
--- /dev/null
+function fokus(){ [% IF focus %]$('[% focus %]').focus()[% END %] }
--- /dev/null
+[%- USE T8 %]
+$(function() {
+ setupPoints('[% myconfig.numberformat %]', '[% 'wrongformat' | $T8 %]');
+ setupDateFormat('[% myconfig.dateformat %]', '[% 'Falsches Datumsformat!' | $T8 %]');
+})
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
[%- DEFAULT myconfig_dbhost = 'localhost' %]
<noscript>
[% INCLUDE 'generic/information.html'
%]
</noscript>
<center>
- <a class="nomobile" href="http://www.kivitendo.de" target="_top"><img src="image/kivitendo.png" border="0" title="[% 'kivitendo Homepage' | $T8 %]"></a>
+ <a class="nomobile" href="http://www.kivitendo.de" target="_top"><img src="image/kivitendo.png" border="0" alt='[% 'kivitendo' | $T8 %]' title="[% 'kivitendo Homepage' | $T8 %]"></a>
<h3 class="login">[% 'kivitendo' | $T8 %] [% version %]</h3>
[%- todo_list %]
-</body>
-</html>
[%- USE LxERP %]
-<body>
<p><b>[% LxERP.t8('Error!') %]</b></p>
<a href="admin.pl" target="_top">[% LxERP.t8('Administration') %]</a>
</p>
-</body>
-</html>
[%- USE T8 %]
-<body>
<p><b>[% 'Error!' | $T8 %]</b></p>
<a href="admin.pl" target="_top">[% 'Administration' | $T8 %]</a>
</p>
-</body>
-</html>
[% USE LxERP %][% USE HTML %]
-<body>
<div class="listtop">[% title %]</div>
<p>
<p>
<a href="controller.pl?action=LoginScreen/user_login">[%- LxERP.t8('Back to login') %]</a>
</p>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body class="login" onLoad="document.loginscreen.login.focus()">
-
+[%- USE HTML %]
<center>
<table class="login" border="3" cellpadding="20">
<tr>
<table>
<tr>
<th align="right">[% 'Login Name' | $T8 %]</th>
- <td><input class="login" name="{AUTH}login" size="30" tabindex="1"></td>
+ <td><input id='login' class="login" name="{AUTH}login" size="30" tabindex="1"></td>
</tr>
<tr>
<th align="right">[% 'Password' | $T8 %]</th>
</td>
</tr>
</table>
-
-</body>
-</html>
+ <script type='text/javascript'>
+ $(function(){ $('#login').focus() })
+ </script>
[%- USE T8 %]
-<body class="frame-header">
-<div class="frame-header">
+<div id="frame-header">
[% UNLESS is_links %]
<span class="frame-header-element frame-header-left">
[<a href="JavaScript:Switch_Menu();" title="[% 'Switch Menu on / off' | $T8 %]">[% 'Menu' | $T8 %]</a>]
[<a href="controller.pl?action=LoginScreen/user_login" target="_blank" title="[% 'Open a further kivitendo window or tab' | $T8 %]">[% 'New window/tab' | $T8 %]</a>]
- [<a href="JavaScript:top.main_window.print();" title="[% 'Hardcopy' | $T8 %]">[% 'Print' | $T8 %]</a>]
- [<a href="Javascript:top.main_window.history.back();" title="[% 'Go one step back' | $T8 %]">[% 'Back' | $T8 %]</a>]
- [<a href="Javascript:top.main_window.history.forward();" title="[% 'Go one step forward' | $T8 %]">[% 'Fwd' | $T8 %]</a>]
+ [<a href="JavaScript:top.print();" title="[% 'Hardcopy' | $T8 %]">[% 'Print' | $T8 %]</a>]
+ [<a href="Javascript:top.history.back();" title="[% 'Go one step back' | $T8 %]">[% 'Back' | $T8 %]</a>]
+ [<a href="Javascript:top.history.forward();" title="[% 'Go one step forward' | $T8 %]">[% 'Fwd' | $T8 %]</a>]
</span>
[%- END %]
[% IF is_fastcgi && LXCONFIG.debug.show_debug_menu %]
<span class="frame-header-element frame-header-center">
Debug:
[<a href='controller.pl?action=DebugMenu/reload'>FCGI Reload</a>]
- [<a href='controller.pl?action=DebugMenu/toggle&level=request_timer'>[% IF LXDEBUG.level_by_name('request_timer') %]<b>Timing</b>[% ELSE %]Timing[% END %]</a>]
- [<a href='controller.pl?action=DebugMenu/toggle&level=trace'>[% IF LXDEBUG.level_by_name('trace') %]<b>Trace</b>[% ELSE %]Trace[% END %]</a>]
- [<a href='controller.pl?action=DebugMenu/toggle&level=query'>[% IF LXDEBUG.level_by_name('query') %]<b>Query</b>[% ELSE %]Query[% END %]</a>]
- [<a href='controller.pl?action=DebugMenu/toggle&level=warn'>[% IF LXDEBUG.level_by_name('warn') %]<b>Warnings</b>[% ELSE %]Warnings[% END %]</a>]
+ [<a href='controller.pl?action=DebugMenu/toggle&level=request_timer'>[% IF LXDEBUG.level_by_name('request_timer') %]<b>Timing</b>[% ELSE %]Timing[% END %]</a>]
+ [<a href='controller.pl?action=DebugMenu/toggle&level=trace'>[% IF LXDEBUG.level_by_name('trace') %]<b>Trace</b>[% ELSE %]Trace[% END %]</a>]
+ [<a href='controller.pl?action=DebugMenu/toggle&level=query'>[% IF LXDEBUG.level_by_name('query') %]<b>Query</b>[% ELSE %]Query[% END %]</a>]
+ [<a href='controller.pl?action=DebugMenu/toggle&level=warn'>[% IF LXDEBUG.level_by_name('warn') %]<b>Warnings</b>[% ELSE %]Warnings[% END %]</a>]
</span>
[%- END %]
<span class="frame-header-element frame-header-right">
[% now.hms %]
</span>
</div>
-</body>
-</html>
--- /dev/null
+[%- USE JSON %]
+$(function(){$([% JSON.json(sections) %]).each(function(i,b){var a=$('<a class="ml">').append($('<span class="mii ms">').append($('<div>').addClass(b[3])),$('<span class="mic">').append(b[0]));if(b[5])a.attr('href', b[5]);$('#html-menu').append($('<div class="mi">').addClass(b[4]).addClass(b[1]).attr('id','mi'+b[2]).append(a))});$('#html-menu div.i, #html-menu div.sm').not('[id^='+$.cookie('html-menu-selection')+'_]').hide();$('#html-menu div.m').each(function(){$(this).click(function(){$.cookie('html-menu-selection',$(this).attr('id'));$('#html-menu div.mi').not('div.m').not('[id^='+$(this).attr('id')+'_]').hide();$('#html-menu div.mi[id^='+$(this).attr('id')+'_]').toggle()})})})
[%- USE T8 %]
-[% USE HTML %]<body class="menunew">
-
+[% USE HTML %]
<script type="text/javascript">
<!--
function clockon() {
document.getElementById('clock_id').innerHTML = (h<10?'0'+h:h)+":"+(m<10?'0'+m:m);
var timer=setTimeout("clockon()", 10000);
}
-window.onload=clockon
+$(clockon);
//-->
</script>
<tr>
<td>
- [<a href="menunew.pl?action=display" target="_blank">[% 'new Window' | $T8 %]</a>]
+ [<a href="login.pl?action=company_logo" target="_blank">[% 'new Window' | $T8 %]</a>]
- [<a href="JavaScript:top.main_window.print()">[% 'print' | $T8 %]</a>]
+ [<a href="JavaScript:top.print()">[% 'print' | $T8 %]</a>]
</td>
<td align="right" nowrap>
- [[% 'User' | $T8 %]: [% HTML.escape(login) %] -
+ [[% 'User' | $T8 %]: [% HTML.escape(MYCONFIG.login) %] -
<a href="controller.pl?action=LoginScreen/logout" target="_top">[% 'logout' | $T8 %]</a>]
[% date %] <span id='clock_id' style='position:relative'></span>
</td>
<div id="main_menu_div"></div>
[%- SET main_id = '100' %]
- <ul id="main_menu_model">
+ <ul id="main_menu_model" style='display:none'>
[%- FOREACH mainitem = menu_items %]
[%- SET main_id = main_id + 1 %]
<li id="[% main_id %]"[% IF mainitem.image %] itemIcon="[% mainitem.image %]"[% END %]>
- <a href="[% IF mainitem.href %][% mainitem.href %][% ELSE %]#[% END %]"[% IF mainitem.target %] target="[% mainitem.target %]"[% END %]>
+ <a href="[% IF mainitem.href %][% mainitem.href %][% ELSE %]#[% END %]">
[%- HTML.escape(mainitem.title) %]
</a>
[%- IF mainitem.subitems %]
[%- FOREACH sub1item = mainitem.subitems %]
[%- SET sub1_id = sub1_id + 1 %]
<li id="[% sub1_id %]"[% IF sub1item.image %] itemIcon="[% sub1item.image %]"[% END %]>
- <a href="[% IF sub1item.href %][% sub1item.href %][% ELSE %]#[% END %]"[% IF sub1item.target %] target="[% sub1item.target %]"[% END %]>
+ <a href="[% IF sub1item.href %][% sub1item.href %][% ELSE %]#[% END %]">
[%- HTML.escape(sub1item.title) %]
</a>
[%- IF sub1item.subitems %]
[%- FOREACH sub2item = sub1item.subitems %]
[%- SET sub2_id = sub2_id + 1 %]
<li id="[% sub2_id %]"[% IF sub2item.image %] itemIcon="[% sub2item.image %]"[% END %]>
- <a href="[% IF sub2item.href %][% sub2item.href %][% ELSE %]#[% END %]"[% IF sub2item.target %] target="[% sub2item.target %]"[% END %]>
+ <a href="[% IF sub2item.href %][% sub2item.href %][% ELSE %]#[% END %]">
[%- HTML.escape(sub2item.title) %]
</a>
</li>
[%- END %]
</ul>
- <iframe id="win1" src="[% callback %]" width="100%" height="94%" name="main_window" style="position: absolute; border: 0px; z-index: 99; ">
- <p>[% 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' | $T8 %]</p>
- </iframe>
<script type="text/javascript">
<!--
-DHTMLSuite.createStandardObjects();
+$(function(){
+ DHTMLSuite.createStandardObjects();
+
+ DHTMLSuite.configObj.setImagePath('image/dhtmlsuite/');
-DHTMLSuite.configObj.setCssPath('[% myconfig.css_path %]/dhtmlsuite/');
-DHTMLSuite.configObj.setImagePath('image/dhtmlsuite/');
+ var menu_model = new DHTMLSuite.menuModel();
+ menu_model.addItemsFromMarkup('main_menu_model');
+ menu_model.init();
+
+ var menu_bar = new DHTMLSuite.menuBar();
+ menu_bar.addMenuItems(menu_model);
+ menu_bar.setTarget('main_menu_div');
+ menu_bar.init();
+});
-var menu_model = new DHTMLSuite.menuModel();
-menu_model.addItemsFromMarkup('main_menu_model');
-menu_model.init();
-var menu_bar = new DHTMLSuite.menuBar();
-menu_bar.addMenuItems(menu_model);
-menu_bar.setTarget('main_menu_div');
-menu_bar.init();
function open_url(url, target) {
-->
</script>
-
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body style="padding:0px; margin:0px;">
-
+[% USE HTML %]
<script type="text/javascript" src="js/jquery.js"></script>
<script type="text/javascript">
<!--
document.getElementById('clock_id').innerHTML = (h<10?'0'+h:h)+":"+(m<10?'0'+m:m);
var timer=setTimeout("clockon()", 10000);
}
-window.onload=clockon
+$(clockon);
//-->
</script>
<tr>
<td style="color:white; font-family:verdana,arial,sans-serif; font-size: 12px;" nowrap>
- [<a href="menuv3.pl?action=display" target="_blank">[% 'new Window' | $T8 %]</a>]
+ [<a href="login.pl?action=company_logo" target="_blank">[% 'new Window' | $T8 %]</a>]
- [<a href="JavaScript:top.main_window.print()">[% 'print' | $T8 %]</a>]
+ [<a href="JavaScript:top.print()">[% 'print' | $T8 %]</a>]
[[% 'Search contacts' | $T8 %] <input size="15" name="search_term" id="search_term" onkeydown="return on_keydown_quicksearch(event)">]
</td>
</tr>
</table>
-
<div id="menuv3">
[% menu %]
</div>
-
<div style="clear: both;"></div>
-
- <iframe id="win1" src="[% callback %]" width="100%" height="94%" name="main_window" style="position: absolute; border: 0px; z-index: 99; ">
- <p>[% 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' | $T8 %]</p>
- </iframe>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
-<body class="frame-header menuv4">
- <div class="frame-header">
- <span class="frame-header-element frame-header-left">
- [<a href="menuv4.pl?action=display" target="_blank">[% 'new Window' | $T8 %]</a>]
- [<a href="JavaScript:top.main_window.print()">[% 'print' | $T8 %]</a>]
- </span>
- <span class="frame-header-element frame-header-right">
- [[% 'User' | $T8 %]: [% HTML.escape(login) %] -
- <a href="controller.pl?action=LoginScreen/logout" target="_top">[% 'logout' | $T8 %]</a>]
- [% date %] <span id='clock_id' style='position:relative'></span>
- </span>
- </div>
<div id="menuv4">
[% menu %]
</div>
<div style="clear: both;"></div>
- <iframe id="win1" src="[% callback %]" width="100%" height="94%" name="main_window" style="position: absolute; border: 0px; z-index: 99; ">
- <p>[% 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' | $T8 %]</p>
- </iframe>
-</body>
-
<script type="text/javascript">
<!--
document.getElementById('clock_id').innerHTML = (h<10?'0'+h:h)+":"+(m<10?'0'+m:m);
var timer=setTimeout("clockon()", 10000);
}
-window.onload=clockon
+$(clockon);
//-->
</script>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop" width="100%">[% 'Carry over shipping address' | $T8 %]</div>
</form>
-</body>
-</html>
[%- USE L %]
[%- USE LxERP %]
-<body>
<form method="post" action="[% script %]">
<button class=submit type=button onclick="history.back()">[% 'No' | $T8 %]</button>
</form>
-</body>
-</html>
[% USE HTML %]
[% USE LxERP %]
[% USE L %]
-<body>
<div class="listtop">[% title %]</div>
-->
</script>
-</body>
-</html>
[% END %]
</form>
-
-
- <script type="text/javascript">
- <!--
- $('document').ready(function(){
- setupDateFormat('[% dateformat %]', '[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat %]', '[% 'wrongformat' | $T8 %]');
- });
- //-->
- </script>
-</body>
-</html>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body onLoad="[% onload %]">
<form method="post" name="oe" action="[% script %]">
<div class="listtop">[% 'Overdue sales quotations and requests for quotations' | $T8 %]</div>
-<p>
<table width="100%">
<tr>
<td class="listheading">[% 'Date' | $T8 %]</td>
<td>[% HTML.escape(row.transdate) %]</td>
<td>[% HTML.escape(row.reqdate) %]</td>
<td>
- <a href="[% edit_url %]&vc=[% HTML.url(row.vc) %]&type=[% IF row.vc == 'customer' %]sales_quotation[% ELSE %]request_quotation[% END %]&id=[% HTML.url(row.id) %]">
+ <a href="[% edit_url | html %]&vc=[% row.vc | html %]&type=[% IF row.vc == 'customer' %]sales_quotation[% ELSE %]request_quotation[% END %]&id=[% row.id | html %]">
[% IF row.vc == 'customer' %]
[% 'Sales quotation' | $T8 %]
[% ELSE %]
</tr>
[%- END %]
</table>
-</p>
[% USE LxERP %]
[% USE T8 %]
[%- IF !TABDIALOG %]
-<body>
<p><div class="listtop">[% 'Price information' | $T8 %]</div></p>
</p>
[%- IF !TABDIALOG %]
-</body>
-</html>
[%- END %]
[% USE HTML %]
[% USE L %]
-<body onload="copy_values_and_close()">
-
<script type="text/javascript">
<!--
- function copy_values_and_close() {
+ $(function() {
window.opener.document.getElementsByName("periodic_invoices_config")[0].value = $("#periodic_invoices_config").attr('value');
window.close();
- }
+ })
-->
</script>
[% L.hidden_tag("periodic_invoices_config", periodic_invoices_config) %]
</form>
-</body>
-</html>
[%- USE L %]
[%- SET vclabel = vc == 'customer' ? LxERP.t8('Customer') : LxERP.t8('Vendor') %]
[%- SET vcnumberlabel = vc == 'customer' ? LxERP.t8('Customer Number') : LxERP.t8('Vendor Number') %]
-<body>
<form method="post" action="oe.pl">
<input class="submit" type="submit" name="action" value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[% USE HTML %][% USE T8 %][% USE L %][% USE LxERP %]
-<body>
<form method="post" action="controller.pl">
<div class="listtop">[% FORM.title %]</div>
</table>
</form>
-</body>
-</html>
<script type="text/javascript" src="js/jquery-ui.js"></script>
-<body>
<div class="listtop">[% FORM.title %]</div>
[%- INCLUDE 'common/flash.html' %]
[% L.sortable_element('#payment_term_list tbody', url => 'controller.pl?action=PaymentTerm/reorder', with => 'payment_term_id') %]
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[% L.javascript_tag('show_history.js') %]
-<body>
<form method=post action="[% script %]">
<input type=button onclick="set_history_window([% id %]);" name=history id=history value="[% 'history' | $T8 %]">
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE T8 %]
-<body>
<table width=100%>
<tr>
<input class=submit type=submit name=action value="[% 'Add' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[% L.javascript_tag('show_history.js') %]
-<body>
<form method=post action="[% script %]">
<input type=button onclick="set_history_window([% id %]);" name=history id=history value="[% 'history' | $T8 %]">
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE T8 %]
-<body>
<table width=100%>
<tr>
<input class=submit type=submit name=action value="[% 'Add' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
-<body>
<form method=post action="[% script %]">
<input class=submit type=submit name=action value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
[%- IF message %]
<p>[% message %]</p>
</script>
[% PROCESS 'common/help_overlay.html' %]
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body onload="fokus()">
-
+[%- USE HTML %]
<form method="post" action="projects.pl" name="Form">
<div class="listtop">[% title %]</div>
</p>
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE L %]
[%- USE LxERP %]
-<body onLoad="[% onload %]">
-
<h1>[% 'Reconciliation' | $T8 %]</h1>
<form method=post action="[% script %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE LxERP %]
[%- L.javascript_tag('jquery.checkall') %]
-<body>
<h1>[% accno | html %]--[% account | html %]</h1>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<h1>[% HTML.escape(title) %]</h1>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body[% IF onload %] onload="[% onload %]"[% END %]>
-
+[%- USE HTML %]
<style type="text/css">
<!--
.top_border {
</form>
[% END %]
-</body>
[%- USE T8 %]
-[% USE HTML %][% USE LxERP %]<body>
+[%- USE HTML %][%- USE LxERP %]
[%- SET default_margin = LxERP.format_amount(1.5) %]
[%- END %]
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE LxERP %]
-<body bgcolor="#ffffff">
-
<h2 align="center">
[% company %]
<br>[% address %]
[%- USE L %]
[%- USE LxERP %]
[%- USE T8 %]
-<body>
<h1>[% 'E-mail Statement to' | $T8 %] [% $ct %]</h1>
<input name=action class=submit type=submit value="[% 'Continue' | $T8 %]">
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<script type="text/javascript">
<!--
</form>
[% END %]
-</body>
</tr>
[%- END %]
-<body onLoad="[% onload %]">
<h1>[% title %]</h1>
<form method=post action='[% script %]'>
</form>
-</body>
-</html>
</tr>
[% END %]
-<body>
<h1>[% title %] [% SET tax_report__accno_title = accno _ '_description' %][% GET $tax_report__accno_title %]</h1>
[%- END %]
</table>
<hr size=3 noshade>
-</body>
-</html>
[% SET arap = 'ar' %]
[% SET iris = 'is' %]
[%- END %]
-<body>
<p><div class="listtop">[% title %]</div></p>
-->
</script>
-</body>
-</html>
[% SET arap = 'ar' %]
[% SET iris = 'is' %]
[%- END %]
-<body>
[%- IF error_message %]
<p><div class="message_error">[% error_message %]</div></p>
<input type="hidden" name="confirmation" value="1">
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
<p><div class="listtop">[% title %]</div></p>
</ul>
</p>
-</body>
-</html>
[% SET arap = 'ar' %]
[% SET iris = 'is' %]
[%- END %]
-<body>
<p><div class="listtop">[% title %]: [% HTML.escape(export.ids.join(', ')) %]</div></p>
<input type="hidden" name="vc" value="[% HTML.escape(vc) %]">
</form>
-</body>
-</html>
[%- USE T8 %]
[% USE HTML %]
-<body>
<p><div class="listtop">[% title %]</div></p>
<input type="hidden" name="vc" value="[%- HTML.escape(vc) %]">
</form>
-</body>
-</html>
[%- USE HTML %]
[%- USE LxERP %]
[%- USE L %]
-<body>
<p><div class="listtop">[% title %]</div></p>
<input type="submit" class="submit" name="action_bank_transfer_list" value="[% 'Continue' | $T8 %]">
</p>
</form>
-</body>
-</html>
[% USE HTML %][% USE L %][% USE LxERP %]
-<body>
<div class="listtop">[% FORM.title %]</div>
|
<a href="[% SELF.url_for(controller => 'BackgroundJobHistory', action => 'list') %]">[%- LxERP.t8('View background job history') %]</a>
</p>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<div class="listtop" style="margin-bottom: 10px">[% 'Your TODO list' | $T8 %]</div>
[%- END %]
-</body>
-</html>
Edit templates/webpages/ustva/config_step1_master.html
and run locale/<cc>/locales.pl -->
-<body>
<form name="verzeichnis" method="post" action="[% HTML.escape(script) %]">
<table width="100%">
<tr>
<input type="hidden" name="[% HTML.escape(var.variable) %]" value="[% HTML.escape(var.value) %]">
[%- END %]
</form>
-</body>
and run locale/<cc>/locales.pl -->
-<body>
<form name="elsterform" method="post" action="[% script %]">
<table width="100%">
<tr>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %]<body>
+[%- USE HTML %]
<h1>[% 'Generic Tax Report' | $T8 %]</h1>
<p>[% 'Taxnumber' | $T8 %]: [% taxnumber %]</p>
</table>
-</html>
-</body>
Edit templates/webpages/ustva/report_master.html
and run locale/<cc>/locales.pl -->
- <body>
<form method="post" action="[% HTML.escape(script) %]">
<input type="hidden" name="title" value="[% HTML.escape(title) %]">
</td>
</tr>
</table>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-<body>
<form method=post name="search_invoice" action=[% script %]>
<th align="right">[% 'Item mode' | $T8 %]</th>
<td colspan="3" align=left><input name="l_parts" class=checkbox type=checkbox value=Y> ([%'Show items from invoices individually' | $T8 %]) </td>
</tr>
- <tr>
+ <tr>
<th align="right">
[% 'Total sum' | $T8 %]
</th>
<td align=left><input name="l_lastcost_total" class=checkbox type=checkbox value=Y checked>[% 'Purchase price total' | $T8 %]</td>
<td align=left><input name="l_marge_total" class=checkbox type=checkbox value=Y checked>[% 'Margetotal' | $T8 %]</td>
<td colspan="4"> ([% 'Single values in item mode, cumulated values in invoice mode' | $T8 %])
-
+
</tr>
<tr>
<td align=left><input name="l_sellprice" class=checkbox type=checkbox value=Y checked>[% 'Sales price' | $T8 %]</td>
</th>
</tr>
[% CUSTOM_VARIABLES_INCLUSION_CODE_CT %]
-
+
<tr><td colspan="7"> </td></tr>
<tr>
<th colspan="4" align="left">
<!--
$(document).ready(function(){
$('customer').focus();
- setupDateFormat('[% dateformat | html %]','[% 'Falsches Datumsformat!' | $T8 %]');
- setupPoints('[% numberformat | html %]','[% 'wrongformat' | $T8 %]');
})
//-->
</script>
- </body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE JavaScript %]<body onload="on_load();">
-
+[%- USE HTML %][%- USE JavaScript %]
<script type="text/javascript">
<!--
warehouses = new Array();
control.options[bin_index].selected = true;
}
- function on_load() {
+ $(function() {
warehouse_selected(0, 0);
document.Form.partnumber.focus();
- }
+ })
-->
</script>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE JavaScript %]<body>
+[%- USE HTML %][%- USE JavaScript %]
<form method="post" action="wh.pl">
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE JavaScript %]<body onload="on_load();">
-
+[%- USE HTML %][%- USE JavaScript %]
<script type="text/javascript">
<!--
warehouses = new Array();
control.options[bin_index].selected = true;
}
- function on_load() {
+ $(function () {
warehouse_selected(0, 0);
document.Form.partnumber.focus();
- }
+ });
-->
</script>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
-[% USE HTML %][% USE JavaScript %]<body onload="on_load();">
-
+[%- USE HTML %][%- USE JavaScript %]
<script type="text/javascript">
<!--
warehouses = new Array();
control.options[0].selected = true;
}
- function on_load() {
+ $(function() {
[% FOREACH row = CONTENTS %]
warehouse_selected([% loop.count %], [% initial_warehouse_idx %]);
[% END %]
- }
+ });
-->
</script>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE HTML %]
[%- USE L %]
-[% USE JavaScript %]<body onload="on_load();">
-
+[%- USE JavaScript %]
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/part_selection.js"></script>
<script type="text/javascript">
control.options[bin_index].selected = true;
}
- function on_load() {
+ $(function() {
warehouse_selected(0, 0);
document.Form.partnumber.focus();
- }
+ });
-->
</script>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE JavaScript %][% USE LxERP %]<body onload="on_load(); [% onload %]">
-
+[%- USE HTML %][%- USE JavaScript %][%- USE LxERP %]
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/part_selection.js"></script>
<script type="text/javascript">
control.options[bin_index].selected = true;
}
- function on_load() {
+ $(function() {
warehouse_selected([% warehouse_id %], [% bin_id %]);
- }
+ })
-->
</script>
</p>
</form>
-</body>
-</html>
[%- USE T8 %]
[%- USE L %]
-[% USE HTML %][% USE JavaScript %][% USE LxERP %]<body onload="on_load(); [% onload %]">
-
+[%- USE HTML %][%- USE JavaScript %][%- USE LxERP %]
<script type="text/javascript" src="js/common.js"></script>
<script type="text/javascript" src="js/part_selection.js"></script>
<script type="text/javascript">
control.options[bin_index].selected = true;
}
- function on_load() {
+ $(function() {
warehouse_selected([% warehouse_id %], [% bin_id %]);
- }
+ })
-->
</script>
<input type="submit" class="submit" name="action" value="[% 'Stock' | $T8 %]">
[%- END %]
</p>
- </form>
-
-</body>
-</html>
+ </form>
+
projects / kivitendo-erp.git / commitdiff
