package AccTransCorrections;
+use utf8;
use strict;
use List::Util qw(first);
delete $entry->{chartlink};
}
- # Verknüpfungen zwischen Steuerschlüsseln und zum Zeitpunkt der Transaktion
- # gültigen Steuersätze
+ # Verknüpfungen zwischen Steuerschlüsseln und zum Zeitpunkt der Transaktion
+ # gültigen Steuersätze
my %all_taxes = $self->{taxkeys}->get_full_tax_info('transdate' => $transaction->[0]->{transdate});
my ($trans_type, $previous_non_tax_entry);
}
}
- # Alle Einträge entfernen, die die Gegenkonten zu Zahlungsein- und
- # -ausgängen darstellen.
+ # Alle Einträge entfernen, die die Gegenkonten zu Zahlungsein- und
+ # -ausgängen darstellen.
foreach my $payment (@{ $data->{payments} }) {
my $idx = 0 < $payment->{amount} ? 'debit' : 'credit';
}
# Problemfall: Verkaufsrechnungen, bei denen Buchungen auf Warenbestandskonten
-# mit Steuerschlüssel != 0 durchgeführt wurden. Richtig wäre, dass alle
-# Steuerschlüssel für solche Warenbestandsbuchungen 0 sind.
+# mit Steuerschlüssel != 0 durchgeführt wurden. Richtig wäre, dass alle
+# Steuerschlüssel für solche Warenbestandsbuchungen 0 sind.
sub _check_trans_invoices_inventory_with_taxkeys {
$main::lxdebug->enter_sub();
}
# Problemfall: Verkaufsrechnungen, bei denen Steuern verbucht wurden, obwohl
-# kein Steuerschlüssel eingetragen ist.
+# kein Steuerschlüssel eingetragen ist.
sub _check_missing_taxkeys_in_invoices {
$::lxdebug->enter_sub;
return $found_broken;
}
-# Problemfall: Kreditorenbuchungen, bei denen mit Umsatzsteuerschlüsseln
-# gebucht wurde und Debitorenbuchungen, bei denen mit Vorsteuerschlüsseln
+# Problemfall: Kreditorenbuchungen, bei denen mit Umsatzsteuerschlüsseln
+# gebucht wurde und Debitorenbuchungen, bei denen mit Vorsteuerschlüsseln
# gebucht wurde.
sub _check_trans_ap_ar_wrong_taxkeys {
$main::lxdebug->enter_sub();
}
# Problemfall: Splitbuchungen, die mehrere Haben- und Sollkonten ansprechen.
-# Aber nur für Debitoren- und Kreditorenbuchungen, weil das bei Einkaufs- und
-# Verkaufsrechnungen hingegen völlig normal ist.
+# Aber nur für Debitoren- und Kreditorenbuchungen, weil das bei Einkaufs- und
+# Verkaufsrechnungen hingegen völlig normal ist.
sub _check_trans_split_multiple_credit_and_debit {
$main::lxdebug->enter_sub();
}
# Problemfall: Buchungen, bei denen Steuersummen nicht mit den Summen
-# übereinstimmen, die nach ausgewähltem Steuerschlüssel hätten auftreten müssen.
+# übereinstimmen, die nach ausgewähltem Steuerschlüssel hätten auftreten müssen.
sub _check_trans_wrong_taxkeys {
$main::lxdebug->enter_sub();
return $retval;
}
-# Inaktiver Code für das Erraten möglicher Verteilungen von
-# Steuerschlüsseln. Deaktiviert, weil er exponentiell Zeit
-# benötigt.
+# Inaktiver Code für das Erraten möglicher Verteilungen von
+# Steuerschlüsseln. Deaktiviert, weil er exponentiell Zeit
+# benötigt.
# if (abs($expected_tax - $data{$side}->{tax_sum}) >= 0.02) {
# my @potential_taxkeys = $trans_type eq 'AP' ? (0, 8, 9) : (0, 1, 2, 3);
# $main::lxdebug->dump(0, "pota", \@potential_taxkeys);
-# # Über alle Kombinationen aus Buchungssätzen und potenziellen Steuerschlüsseln
+# # Über alle Kombinationen aus Buchungssätzen und potenziellen Steuerschlüsseln
# # iterieren und jeweils die Summe ermitteln.
# my $num_entries = scalar @{ $data{$side}->{entries} };
# my @taxkey_indices = (0) x $num_entries;
# while ($num_entries == scalar @taxkey_indices) {
# my @tax_cache = ();
-# # Berechnen der Steuersumme für die aktuell angenommenen Steuerschlüssel.
+# # Berechnen der Steuersumme für die aktuell angenommenen Steuerschlüssel.
# my $tax_sum = 0;
# foreach my $i (0 .. $num_entries - 1) {
# my $taxkey = $potential_taxkeys[$taxkey_indices[$i]];
# $tax_sum += $tax_cache[$i];
# }
-# # Entspricht die Steuersumme mit den aktuell angenommenen Steuerschlüsseln
+# # Entspricht die Steuersumme mit den aktuell angenommenen Steuerschlüsseln
# # der verbuchten Steuersumme? Wenn ja, dann ist das eine potenzielle
-# # Lösung.
+# # Lösung.
# if (abs($tax_sum - $data{$side}->{tax_sum}) < 0.02) {
# push @solutions, {
# 'taxkeys' => [ @potential_taxkeys[@taxkey_indices] ],
# }
# }
-# # Weiterzählen der Steuerschlüsselindices zum Interieren über
-# # alle möglichen Kombinationen.
+# # Weiterzählen der Steuerschlüsselindices zum Interieren über
+# # alle möglichen Kombinationen.
# my $i = 0;
# while (1) {
# $taxkey_indices[$i]++;
#
#======================================================================
+use utf8;
+use strict;
+
package CA;
use Data::Dumper;
use SL::DBUtils;
-use strict;
-
sub all_accounts {
$main::lxdebug->enter_sub();
# connect to database
my $dbh = $form->dbconnect($myconfig);
- # bug 1071 Warum sollte bei Erreichen eines neuen Jahres die Kontenübersicht nur noch die
+ # bug 1071 Warum sollte bei Erreichen eines neuen Jahres die Kontenübersicht nur noch die
# bereits bebuchten Konten anzeigen?
# Folgende Erweiterung:
- # 1.) Gehe zurück bis zu dem Datum an dem die Bücher geschlossen wurden
- # 2.) Falls die Bücher noch nie geschlossen wurden, gehe zurück bis zum Bearbeitungsstart
+ # 1.) Gehe zurück bis zu dem Datum an dem die Bücher geschlossen wurden
+ # 2.) Falls die Bücher noch nie geschlossen wurden, gehe zurück bis zum Bearbeitungsstart
# COALESCE((SELECT closedto FROM defaults),(SELECT itime FROM defaults))
my $closedto_sql = "COALESCE((SELECT closedto FROM defaults),(SELECT itime FROM defaults))";
- if ($form->{method} eq "cash") { # EÜR
+ if ($form->{method} eq "cash") { # EÜR
$acc_cash_where = qq| AND (a.trans_id IN (SELECT id FROM ar WHERE datepaid>= $closedto_sql
UNION SELECT id FROM ap WHERE datepaid>= $closedto_sql
UNION SELECT id FROM gl WHERE transdate>= $closedto_sql
$query =
qq|SELECT a.id, a.reference, a.description, ac.transdate, ac.chart_id, | .
qq| $false AS invoice, ac.amount, 'gl' as module, | .
- qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
+ qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
qq|FROM acc_trans ac, gl a | .
$dpt_join .
qq|WHERE | . $where . $dpt_where . $project .
qq|SELECT a.id, a.invnumber, c.name, ac.transdate, ac.chart_id, | .
qq| a.invoice, ac.amount, 'ar' as module, | .
- qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
+ qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
qq|FROM acc_trans ac, customer c, ar a | .
$dpt_join .
qq|WHERE | . $where . $dpt_where . $project .
qq|SELECT a.id, a.invnumber, v.name, ac.transdate, ac.chart_id, | .
qq| a.invoice, ac.amount, 'ap' as module, | .
- qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
+ qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo, ac.source || ' ' || ac.memo AS memo § .
qq|FROM acc_trans ac, vendor v, ap a | .
$dpt_join .
qq|WHERE | . $where . $dpt_where . $project .
qq|SELECT a.id, a.invnumber, c.name, a.transdate, | .
qq| a.invoice, ac.qty * ac.sellprice AS sellprice, 'ar' as module, | .
- qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo § .
+ qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo § .
qq|FROM ar a | .
qq|JOIN invoice ac ON (ac.trans_id = a.id) | .
qq|JOIN parts p ON (ac.parts_id = p.id) | .
qq|SELECT a.id, a.invnumber, v.name, a.transdate, | .
qq| a.invoice, ac.qty * ac.sellprice AS sellprice, 'ap' as module, | .
- qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo § .
+ qq§(SELECT accno||'--'||rate FROM tax LEFT JOIN chart ON (tax.chart_id=chart.id) WHERE tax.id = (SELECT tax_id FROM taxkeys WHERE taxkey_id = ac.taxkey AND taxkeys.startdate <= ac.transdate ORDER BY taxkeys.startdate DESC LIMIT 1)) AS taxinfo § .
qq|FROM ap a | .
qq|JOIN invoice ac ON (ac.trans_id = a.id) | .
qq|JOIN parts p ON (ac.parts_id = p.id) | .
package Common;
+use utf8;
+use strict;
+
use Time::HiRes qw(gettimeofday);
use Data::Dumper;
use vars qw(@db_encodings %db_encoding_to_charset %charset_to_db_encoding);
-use strict;
-
@db_encodings = (
{ "label" => "ASCII", "dbencoding" => "SQL_ASCII", "charset" => "ASCII" },
{ "label" => "UTF-8 Unicode", "dbencoding" => "UNICODE", "charset" => "UTF-8" },
my $query =
qq!SELECT id, name, customernumber, (street || ', ' || zipcode || city) AS address FROM customer ! .
- qq!WHERE $filter business_id = (SELECT id FROM business WHERE description = 'Händler') ! .
+ qq!WHERE $filter business_id = (SELECT id FROM business WHERE description = ?') ! .
qq!ORDER BY $order_by $order_dir!;
+ push @filter_values, $::locale->{iconv_utf8}->convert('Händler');
my $sth = $dbh->prepare($query);
$sth->execute(@filter_values) ||
$form->dberror($query . " (" . join(", ", @filter_values) . ")");
my $base_path = substr($ENV{'SCRIPT_NAME'}, 1);
$base_path =~ s|[^/]+$||;
$base_path =~ s|/$||;
- # wo kommt der wert für dir her? es wird doch gar nichts übergeben? fix für strict my $dir jb 21.2.
+ # wo kommt der wert für dir her? es wird doch gar nichts übergeben? fix für strict my $dir jb 21.2.
if (opendir my $dir, $path) {
foreach my $file (sort { lc $a cmp lc $b } readdir $dir) {
next if (($file eq '.') || ($file eq '..'));
package DATEV;
-use List::Util qw(max);
+use utf8;
+use strict;
use SL::DBUtils;
use SL::DATEV::KNEFile;
use Data::Dumper;
use File::Path;
+use List::Util qw(max);
use Time::HiRes qw(gettimeofday);
-use strict;
-
sub _get_export_path {
$main::lxdebug->enter_sub();
ORDER BY trans_id, acc_trans_id|;
my $sth = prepare_execute_query($form, $dbh, $query);
+ $form->{DATEV} = [];
my $counter = 0;
while (my $ref = $sth->fetchrow_hashref("NAME_lc")) {
my $taxkey = 0;
my $charttax = 0;
my ($haben, $soll);
- my $iconv = $main::locale->{iconv_iso8859};
- my %umlaute = ($iconv->convert('ä') => 'ae',
- $iconv->convert('ö') => 'oe',
- $iconv->convert('ü') => 'ue',
- $iconv->convert('Ä') => 'Ae',
- $iconv->convert('Ö') => 'Oe',
- $iconv->convert('Ü') => 'Ue',
- $iconv->convert('ß') => 'sz');
+ my $iconv = $::locale->{iconv_utf8};
+ my %umlaute = ($iconv->convert('ä') => 'ae',
+ $iconv->convert('ö') => 'oe',
+ $iconv->convert('ü') => 'ue',
+ $iconv->convert('Ä') => 'Ae',
+ $iconv->convert('Ö') => 'Oe',
+ $iconv->convert('Ü') => 'Ue',
+ $iconv->convert('ß') => 'sz');
for (my $i = 0; $i < $trans_lines; $i++) {
if ($trans_lines == 2) {
if (abs($transaction->[$i]->{'amount'}) > abs($umsatz)) {
package SL::DB::Helpers::Mappings;
+use utf8;
use strict;
# these will not be managed as Rose::DB models, because they are not normalized,
=head1 AUTHOR
-Sven Schöling <s.schoeling@linet-services.de>
+Sven Schöling <s.schoeling@linet-services.de>
=cut
package SL::DB::Order;
+use utf8;
use strict;
use SL::RecordLinks;
=head1 AUTHOR
- Sven Schöling <s.schoeling@linet-services.de>
+Sven Schöling <s.schoeling@linet-services.de>
=cut
(SELECT SUM(fee)
FROM dunning_config
WHERE dunning_level <= (SELECT dunning_level FROM dunning_config WHERE id = ?)),
- (SELECT (amount - paid) * (current_date - transdate) FROM ar WHERE id = ?)
+ (SELECT (amount - paid) * (current_date - duedate) FROM ar WHERE id = ?)
* (SELECT interest_rate FROM dunning_config WHERE id = ?)
/ 360,
current_date,
{ name => "DBD::Pg", version => '1.49', url => "http://search.cpan.org/~dbdpg/" },
{ name => "Email::Address", url => "http://search.cpan.org/~rjbs/" },
{ name => "FCGI", url => "http://search.cpan.org/~mstrout/" },
- { name => "IO::Wrap", version => '2.110', url => "http://search.cpan.org/~dskoll/" },
{ name => "List::MoreUtils", version => '0.21', url => "http://search.cpan.org/~vparseval/" },
{ name => "PDF::API2", version => '2.000', url => "http://search.cpan.org/~areibens/" },
{ name => "Template", version => '2.18', url => "http://search.cpan.org/~abw/" },
$self->{iconv_english} = SL::Iconv->new('ASCII', $db_charset);
$self->{iconv_iso8859} = SL::Iconv->new('ISO-8859-15', $db_charset);
$self->{iconv_to_iso8859} = SL::Iconv->new($db_charset, 'ISO-8859-15');
+ $self->{iconv_utf8} = SL::Iconv->new('UTF-8', $db_charset);
$self->_read_special_chars_file($country);
$self->{raw_io_active} = 0;
}
+sub set_numberformat_wo_thousands_separator {
+ my $self = shift;
+ my $myconfig = shift || \%::myconfig;
+
+ $self->{saved_numberformat} = $myconfig->{numberformat};
+ $myconfig->{numberformat} =~ s/^1[,\.]/1/;
+}
+
+sub restore_numberformat {
+ my $self = shift;
+ my $myconfig = shift || \%::myconfig;
+
+ $myconfig->{numberformat} = $self->{saved_numberformat} if $self->{saved_numberformat};
+}
+
1;
# - subdescription
# - proper testing for heading charts
# - transmission from $form to TMPL realm is not as clear as i'd like
+
+sub get_openbalance_date {
+ my ($closedto, $target) = map { $::locale->parse_date_to_object(\%::myconfig, $_) } @_;
+
+ $closedto->subtract(years => 1) while ($target - $closedto)->is_negative;
+ $closedto->add(days => 1);
+ return $::locale->format_date(\%::myconfig, $closedto);
+}
+
sub balance_sheet {
$main::lxdebug->enter_sub();
my $myconfig = \%main::myconfig;
my $form = $main::form;
- my $dbh = $form->get_standard_dbh($myconfig);
+ my $dbh = $::form->get_standard_dbh;
my $last_period = 0;
my @categories = qw(A C L Q);
$form->{period} = $form->{this_period} = conv_dateq($form->{asofdate});
}
- get_accounts($dbh, $last_period, "", $form->{asofdate}, $form, \@categories);
+ # get end of financial year and convert to Date format
+ my ($closedto) = selectfirst_arrayref_query($form, $dbh, 'SELECT closedto FROM defaults');
+
+ # get date of last opening balance
+ my $startdate = get_openbalance_date($closedto, $form->{asofdate});
+
+ get_accounts($dbh, $last_period, $startdate, $form->{asofdate}, $form, \@categories);
# if there are any compare dates
if ($form->{compareasofdate}) {
$last_period = 1;
- get_accounts($dbh, $last_period, "", $form->{compareasofdate}, $form, \@categories);
+
+ $startdate = get_openbalance_date($closedto, $form->{compareasofdate});
+
+ get_accounts($dbh, $last_period, $startdate, $form->{compareasofdate}, $form, \@categories);
$form->{last_period} = conv_dateq($form->{compareasofdate});
}
next if ($period eq 'last' && !$last_period);
# only add assets
$row->{$period} *= $ml;
- $form->{total}{$category}{$period} += $row->{$period}; # if ($row->{charttype} eq 'A') { # why??
}
push @{ $TMPL_DATA->{$category} }, $row;
for my $period (qw(this last)) {
next if ($period eq 'last' && !$last_period);
- $form->{E}{$period} = $form->{total}{A}{$period} - $form->{total}{L}{$period} - $form->{total}{Q}{$period};
- $form->{total}{Q}{$period} += $form->{E}{$period};
- $TMPL_DATA->{total}{Q}{$period} = $form->{total}{Q}{$period};
- $TMPL_DATA->{total}{$period} = $form->{total}{L}{$period} + $form->{total}{Q}{$period};
+ $form->{E}{$period} = $TMPL_DATA->{total}{A}{$period} - $TMPL_DATA->{total}{L}{$period} - $TMPL_DATA->{total}{Q}{$period};
+ $TMPL_DATA->{total}{Q}{$period} += $form->{E}{$period};
+ $TMPL_DATA->{total}{$period} = $TMPL_DATA->{total}{L}{$period} + $TMPL_DATA->{total}{Q}{$period};
}
-
+ $form->{E}{description}='nicht verbuchter Gewinn/Verlust';
push @{ $TMPL_DATA->{Q} }, $form->{E};
$main::lxdebug->leave_sub();
if ($form->{review_of_aging_list}) {
if ($form->{review_of_aging_list} =~ m "-"){
my @period = split(/-/, $form->{review_of_aging_list});
- $review_of_aging_list = " AND $period[0] < date_part('days', now() - duedate)
+ $review_of_aging_list = " AND $period[0] < date_part('days', now() - duedate)
AND date_part('days', now() - duedate) < $period[1]";
} else {
$form->{review_of_aging_list} =~ s/[^0-9]//g;
- $review_of_aging_list = " AND $form->{review_of_aging_list} < date_part('days', now() - duedate)";
+ $review_of_aging_list = " AND $form->{review_of_aging_list} < date_part('days', now() - duedate)";
}
}
package RecordLinks;
+use utf8;
+use strict;
+
use SL::Common;
use SL::DBUtils;
use Data::Dumper;
use List::Util qw(reduce);
-use strict;
-
sub create_links {
$main::lxdebug->enter_sub();
Transitive RecordLinks mit get_links_via.
-get_links_via erwartet den zusätzlichen parameter via. via ist ein
-hashref mit den jeweils optionalen Einträgen table und id, die sich
+get_links_via erwartet den zusätzlichen parameter via. via ist ein
+hashref mit den jeweils optionalen Einträgen table und id, die sich
genauso verhalten wie die from/to_table/id werte der get_links funktion.
Alternativ kann via auch ein Array dieser Hashes sein:
],
)
-Die Einträge in einem via-Array werden exakt in dieser Reihenfolge
-benutzt und sind nicht optional. Da obige Beispiel würde also die
-Verknüpfung:
+Die Einträge in einem via-Array werden exakt in dieser Reihenfolge
+benutzt und sind nicht optional. Da obige Beispiel würde also die
+Verknüpfung:
oe:11 -> ar:12 -> is:13 -> do:14
package SL::ReportGenerator;
use Data::Dumper;
-use IO::Wrap;
use List::Util qw(max);
use Text::CSV_XS;
#use PDF::API2; # these two eat up to .75s on startup. only load them if we actually need them
}
sub unescape_string {
- my $self = shift;
- my $text = shift;
+ my ($self, $text, $do_iconv) = @_;
- $text = $main::locale->unquote_special_chars('HTML', $text);
- $text = $::locale->{iconv}->convert($text);
+ $text = $main::locale->unquote_special_chars('HTML', $text);
+ $text = $::locale->{iconv}->convert($text) if $do_iconv;
return $text;
}
'quote_char' => $quote_char,
'eol' => $eol, });
- my $stdout = wraphandle(\*STDOUT);
my @visible_columns = $self->get_visible_columns('CSV');
+ my $stdout;
+ open $stdout, '>-';
+ binmode $stdout, ':encoding(utf8)' if $::locale->is_utf8;
+
if ($opts->{headers}) {
if (!$self->{custom_headers}) {
- $csv->print($stdout, [ map { $self->unescape_string($self->{columns}->{$_}->{text}) } @visible_columns ]);
+ $csv->print($stdout, [ map { $self->unescape_string($self->{columns}->{$_}->{text}, 1) } @visible_columns ]);
} else {
foreach my $row (@{ $self->{custom_headers} }) {
use strict;
+use Cwd;
+
sub new {
my $type = shift;
my $self = shift;
my $lines = shift;
- my (%used_packages, $document_start_line);
+ my (%used_packages, $document_start_line, $last_usepackage_line);
foreach my $i (0 .. scalar @{ $lines } - 1) {
if ($lines->[$i] =~ m/\\usepackage[^\{]*{(.*?)}/) {
$used_packages{$1} = 1;
+ $last_usepackage_line = $i;
} elsif ($lines->[$i] =~ m/\\begin{document}/) {
$document_start_line = $i;
}
}
- $document_start_line = scalar @{ $lines } - 1 if (!defined $document_start_line);
+ my $insertion_point = defined($document_start_line) ? $document_start_line
+ : defined($last_usepackage_line) ? $last_usepackage_line
+ : scalar @{ $lines } - 1;
- if (!$used_packages{textcomp}) {
- splice @{ $lines }, $document_start_line, 0, "\\usepackage{textcomp}\n";
- $document_start_line++;
+ foreach my $package (qw(textcomp)) {
+ next if $used_packages{$package};
+ splice @{ $lines }, $insertion_point, 0, "\\usepackage{${package}}\n";
+ $insertion_point++;
}
}
$form->{tmpfile} =~ s/\Q$userspath\E\///g;
my $latex = $self->_get_latex_path();
+ my $old_home = $ENV{HOME};
+ $ENV{HOME} = $userspath =~ m|^/| ? $userspath : getcwd() . "/" . $userspath;
for (my $run = 1; $run <= 2; $run++) {
system("${latex} --interaction=nonstopmode $form->{tmpfile} " .
"> $form->{tmpfile}.err");
if ($?) {
+ $ENV{HOME} = $old_home;
$self->{"error"} = $form->cleanup();
$self->cleanup();
return 0;
$form->{tmpfile} =~ s/tex$/dvi/;
system("dvips $form->{tmpfile} -o -q > /dev/null");
+ $ENV{HOME} = $old_home;
+
if ($?) {
$self->{"error"} = "dvips : $!";
$self->cleanup();
$form->{tmpfile} =~ s/\Q$userspath\E\///g;
my $latex = $self->_get_latex_path();
+ my $old_home = $ENV{HOME};
+ $ENV{HOME} = $userspath =~ m|^/| ? $userspath : getcwd() . "/" . $userspath;
for (my $run = 1; $run <= 2; $run++) {
system("${latex} --interaction=nonstopmode $form->{tmpfile} " .
"> $form->{tmpfile}.err");
if ($?) {
+ $ENV{HOME} = $old_home;
$self->{"error"} = $form->cleanup();
$self->cleanup();
return 0;
}
}
+ $ENV{HOME} = $old_home;
$form->{tmpfile} =~ s/tex$/pdf/;
$self->cleanup();
use strict;
sub new {
- my $class = shift;
- my $context = shift;
+ my ($class, $context, @args) = @_;
- bless { }, $class;
+ return bless {
+ CONTEXT => $context,
+ }, $class;
}
+#
+# public interface
+#
+
sub escape {
my $self = shift;
my $text = shift;
+ $text =~ s|\\|\\\\|g;
$text =~ s|\"|\\\"|g;
+ $text =~ s|\n|\\n|g;
return $text;
}
+sub replace_with {
+ return _replace_helper('replaceWith', @_);
+}
+
+sub replace_html_with {
+ return _replace_helper('html', @_);
+}
+
+#
+# private methods
+#
+
+sub _context {
+ die 'not an accessor' if @_ > 1;
+ return $_[0]->{CONTEXT};
+}
+
+sub _replace_helper {
+ my ($method, $self, $selector, $template, $locals) = @_;
+
+ $template .= '.html' unless $template =~ m/\.html$/;
+ my $html = $self->escape($self->_context->process($template, %{ $locals || { } }));
+ my $code = <<CODE;
+\$('${selector}').${method}("$html");
+CODE
+
+ return $code;
+}
+
1;
+__END__
+
+=pod
+
+=encoding utf8
+
+=head1 NAME
+
+SL::Template::Plugin::JavaScript - Template plugin for JavaScript helper functions
+
+=head1 FUNCTIONS
+
+=over 4
+
+=item C<escape $value>
+
+Returns C<$value> escaped for inclusion in a JavaScript string. The
+value is not wrapped in quotes. Example:
+
+ <input type="submit" value="Delete"
+ onclick="if (confirm('Do you really want to delete this: [% JavaScript.escape(obj.description) %]') return true; else return false;">
+
+=item C<replace_with $selector, $template, %locals>
+
+Returns code replacing the DOM elements matched by C<$selector> with
+the content rendered by Template's I<PROCESS> directive applied to
+C<$template>. C<%locals> are passed as local parameters to I<PROCESS>.
+
+Uses jQuery's C<obj.replaceWith()> function. Requires jQuery to be loaded.
+
+Example:
+
+ <div>TODO:</div>
+ <ul>
+ <li id="item1">First item</li>
+ <li id="item2">Second item</li>
+ <li id="item3">Another item</li>
+ </ul>
+
+ <script type="text/javascript">
+ function do_work() {
+ [% JavaScript.replace_with('#item2', 'todo/single_item', item => current_todo_item) %]
+ }
+ </script>
+
+ <input type="submit" onclick="do_work(); return false;" value="Replace single item">
+
+=item C<replace_html_with $selector, $template, %locals>
+
+Returns code replacing the inner HTML of the DOM elements matched by
+C<$selector> with the content rendered by Template's I<PROCESS>
+directive applied to C<$template>. C<%locals> are passed as local
+parameters to I<PROCESS>.
+
+Uses jQuery's C<obj.html()> function. Requires jQuery to be loaded.
+
+ <div>TODO:</div>
+ <ul id="todo_list">
+ <li id="item1">First item</li>
+ <li id="item2">Second item</li>
+ <li id="item3">Another item</li>
+ </ul>
+
+ <script type="text/javascript">
+ function do_work() {
+ [% JavaScript.replace_html_with('#todo_list', 'todo/full_list', items => todo_items) %]
+ }
+ </script>
+
+ <input type="submit" onclick="do_work(); return false;" value="Replace list">
+
+=back
+
+=head1 BUGS
+
+Nothing here yet.
+
+=head1 AUTHOR
+
+Moritz Bunkus E<lt>m.bunkus@linet-services.deE<gt>
+
+=cut
use base qw( Template::Plugin );
use Template::Plugin;
+use List::MoreUtils qw(apply);
+use List::Util qw(max);
use strict;
return $::locale->quote_special_chars('HTML', $string);
}
+sub _J {
+ my $string = "" . shift;
+ $string =~ s/\"/\\\"/g;
+ return $string;
+}
+
sub _hashify {
return (@_ && (ref($_[0]) eq 'HASH')) ? %{ $_[0] } : @_;
}
sub new {
- my $class = shift;
- my $context = shift;
+ my ($class, $context, @args) = @_;
+
+ return bless {
+ CONTEXT => $context,
+ }, $class;
+}
- return bless { }, $class;
+sub _context {
+ die 'not an accessor' if @_ > 1;
+ return $_[0]->{CONTEXT};
}
sub name_to_id {
}
sub attributes {
- my $self = shift;
- my %options = _hashify(@_);
+ my ($self, @slurp) = @_;
+ my %options = _hashify(@slurp);
my @result = ();
while (my ($name, $value) = each %options) {
next unless $name;
- $value ||= '';
+ next if $name eq 'disabled' && !$value;
+ $value = '' if !defined($value);
push @result, _H($name) . '="' . _H($value) . '"';
}
}
sub html_tag {
- my $self = shift;
- my $tag = shift;
- my $content = shift;
- my $attributes = $self->attributes(@_);
+ my ($self, $tag, $content, @slurp) = @_;
+ my $attributes = $self->attributes(@slurp);
- return "<${tag}${attributes}/>" unless $content;
+ return "<${tag}${attributes}/>" unless defined($content);
return "<${tag}${attributes}>${content}</${tag}>";
}
my %attributes = _hashify(@_);
$attributes{id} ||= $self->name_to_id($name);
+ $options_str = $self->options_for_select($options_str) if ref $options_str;
return $self->html_tag('select', $options_str, %attributes, name => $name);
}
+sub textarea_tag {
+ my ($self, $name, $content, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
+
+ $attributes{id} ||= $self->name_to_id($name);
+ $content = $content ? _H($content) : '';
+
+ return $self->html_tag('textarea', $content, %attributes, name => $name);
+}
+
sub checkbox_tag {
+ my ($self, $name, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
+
+ $attributes{id} ||= $self->name_to_id($name);
+ $attributes{value} = 1 unless defined $attributes{value};
+ my $label = delete $attributes{label};
+
+ if ($attributes{checked}) {
+ $attributes{checked} = 'checked';
+ } else {
+ delete $attributes{checked};
+ }
+
+ my $code = $self->html_tag('input', undef, %attributes, name => $name, type => 'checkbox');
+ $code .= $self->html_tag('label', $label, for => $attributes{id}) if $label;
+
+ return $code;
+}
+
+sub radio_button_tag {
my $self = shift;
my $name = shift;
my %attributes = _hashify(@_);
- $attributes{id} ||= $self->name_to_id($name);
$attributes{value} = 1 unless defined $attributes{value};
+ $attributes{id} ||= $self->name_to_id($name . "_" . $attributes{value});
my $label = delete $attributes{label};
if ($attributes{checked}) {
delete $attributes{checked};
}
- my $code = $self->html_tag('input', undef, %attributes, name => $name, type => 'checkbox');
+ my $code = $self->html_tag('input', undef, %attributes, name => $name, type => 'radio');
$code .= $self->html_tag('label', $label, for => $attributes{id}) if $label;
return $code;
}
sub input_tag {
- my $self = shift;
- my $name = shift;
- my $value = shift;
- my %attributes = _hashify(@_);
+ my ($self, $name, $value, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
$attributes{id} ||= $self->name_to_id($name);
$attributes{type} ||= 'text';
return $self->html_tag('input', undef, %attributes, name => $name, value => $value);
}
+sub hidden_tag {
+ return shift->input_tag(@_, type => 'hidden');
+}
+
+sub div_tag {
+ my ($self, $content, @slurp) = @_;
+ return $self->html_tag('div', $content, @slurp);
+}
+
+sub ul_tag {
+ my ($self, $content, @slurp) = @_;
+ return $self->html_tag('ul', $content, @slurp);
+}
+
+sub li_tag {
+ my ($self, $content, @slurp) = @_;
+ return $self->html_tag('li', $content, @slurp);
+}
+
+sub link {
+ my ($self, $href, $content, @slurp) = @_;
+ my %params = _hashify(@slurp);
+
+ $href ||= '#';
+
+ return $self->html_tag('a', $content, %params, href => $href);
+}
+
+sub submit_tag {
+ my ($self, $name, $value, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
+
+ $attributes{onclick} = "if (confirm('" . delete($attributes{confirm}) . "')) return true; else return false;" if $attributes{confirm};
+
+ return $self->input_tag($name, $value, %attributes, type => 'submit', class => 'submit');
+}
+
+sub button_tag {
+ my ($self, $onclick, $value, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
+
+ return $self->input_tag(undef, $value, %attributes, type => 'button', onclick => $onclick);
+}
+
sub options_for_select {
- my $self = shift;
- my $collection = shift;
- my %options = _hashify(@_);
+ my $self = shift;
+ my $collection = shift;
+ my %options = _hashify(@_);
- my $value_key = $options{value} || 'id';
- my $title_key = $options{title} || $value_key;
+ my $value_key = $options{value} || 'id';
+ my $title_key = $options{title} || $value_key;
- my @elements = ();
- push @elements, [ undef, $options{empty_title} || '' ] if $options{with_empty};
+ my $value_sub = $options{value_sub};
+ my $title_sub = $options{title_sub};
- if ($collection && (ref $collection eq 'ARRAY')) {
- foreach my $element (@{ $collection }) {
- my @result = !ref $element ? ( $element, $element )
- : ref $element eq 'ARRAY' ? ( $element->[0], $element->[1] )
- : ref $element eq 'HASH' ? ( $element->{$value_key}, $element->{$title_key} )
- : ( $element->$value_key, $element->$title_key );
+ my $value_title_sub = $options{value_title_sub};
- push @elements, \@result;
- }
- }
+ my %selected = map { ( $_ => 1 ) } @{ ref($options{default}) eq 'ARRAY' ? $options{default} : $options{default} ? [ $options{default} ] : [] };
+
+ my $access = sub {
+ my ($element, $index, $key, $sub) = @_;
+ my $ref = ref $element;
+ return $sub ? $sub->($element)
+ : !$ref ? $element
+ : $ref eq 'ARRAY' ? $element->[$index]
+ : $ref eq 'HASH' ? $element->{$key}
+ : $element->$key;
+ };
+
+ my @elements = ();
+ push @elements, [ undef, $options{empty_title} || '' ] if $options{with_empty};
+ push @elements, map [
+ $value_title_sub ? $value_title_sub->($_) : (
+ $access->($_, 0, $value_key, $value_sub),
+ $access->($_, 1, $title_key, $title_sub),
+ )
+ ], @{ $collection } if $collection && ref $collection eq 'ARRAY';
my $code = '';
foreach my $result (@elements) {
my %attributes = ( value => $result->[0] );
- $attributes{selected} = 'selected' if $options{default} && ($options{default} eq ($result->[0] || ''));
+ $attributes{selected} = 'selected' if $selected{ $result->[0] || '' };
$code .= $self->html_tag('option', _H($result->[1]), %attributes);
}
return $self->html_tag('script', $data, type => 'text/javascript');
}
+sub stylesheet_tag {
+ my $self = shift;
+ my $code = '';
+
+ foreach my $file (@_) {
+ $file .= '.css' unless $file =~ m/\.css$/;
+ $file = "css/${file}" unless $file =~ m|/|;
+
+ $code .= qq|<link rel="stylesheet" href="${file}" type="text/css" media="screen" />|;
+ }
+
+ return $code;
+}
+
sub date_tag {
my ($self, $name, $value, @slurp) = @_;
my %params = _hashify(@slurp);
my $name_e = _H($name);
my $seq = _tag_id();
+ my $datefmt = apply {
+ s/d+/\%d/gi;
+ s/m+/\%m/gi;
+ s/y+/\%Y/gi;
+ } $::myconfig{"dateformat"};
$params{cal_align} ||= 'BR';
$self->input_tag($name, $value,
+ id => $name_e,
size => 11,
title => _H($::myconfig{dateformat}),
onBlur => 'check_right_date_format(this)',
%params,
) .
$self->javascript(
- "Calendar.setup({ inputField: '$name_e', ifFormat: '$::myconfig{jsc_dateformat}', align: '$params{cal_align}', button: 'trigger$seq' });"
+ "Calendar.setup({ inputField: '$name_e', ifFormat: '$datefmt', align: '$params{cal_align}', button: 'trigger$seq' });"
) : '');
}
+sub javascript_tag {
+ my $self = shift;
+ my $code = '';
+
+ foreach my $file (@_) {
+ $file .= '.js' unless $file =~ m/\.js$/;
+ $file = "js/${file}" unless $file =~ m|/|;
+
+ $code .= qq|<script type="text/javascript" src="${file}"></script>|;
+ }
+
+ return $code;
+}
+
+sub tabbed {
+ my ($self, $tabs, @slurp) = @_;
+ my %params = _hashify(@slurp);
+ my $id = $params{id} || 'tab_' . _tag_id();
+
+ $params{selected} *= 1;
+
+ die 'L.tabbed needs an arrayred of tabs for first argument'
+ unless ref $tabs eq 'ARRAY';
+
+ my (@header, @blocks);
+ for my $i (0..$#$tabs) {
+ my $tab = $tabs->[$i];
+
+ next if $tab eq '';
+
+ my $selected = $params{selected} == $i;
+ my $tab_id = "__tab_id_$i";
+ push @header, $self->li_tag(
+ $self->link('', $tab->{name}, rel => $tab_id),
+ ($selected ? (class => 'selected') : ())
+ );
+ push @blocks, $self->div_tag($tab->{data},
+ id => $tab_id, class => 'tabcontent');
+ }
+
+ return '' unless @header;
+ return $self->ul_tag(
+ join('', @header), id => $id, class => 'shadetabs'
+ ) .
+ $self->div_tag(
+ join('', @blocks), class => 'tabcontentstyle'
+ ) .
+ $self->javascript(
+ qq|var $id = new ddtabcontent("$id");$id.setpersist(true);| .
+ qq|$id.setselectedClassTarget("link");$id.init();|
+ );
+}
+
+sub tab {
+ my ($self, $name, $src, @slurp) = @_;
+ my %params = _hashify(@slurp);
+
+ $params{method} ||= 'process';
+
+ return () if defined $params{if} && !$params{if};
+
+ my $data;
+ if ($params{method} eq 'raw') {
+ $data = $src;
+ } elsif ($params{method} eq 'process') {
+ $data = $self->_context->process($src, %{ $params{args} || {} });
+ } else {
+ die "unknown tag method '$params{method}'";
+ }
+
+ return () unless $data;
+
+ return +{ name => $name, data => $data };
+}
+
+sub areainput_tag {
+ my ($self, $name, $value, @slurp) = @_;
+ my %attributes = _hashify(@slurp);
+
+ my $rows = delete $attributes{rows} || 1;
+ my $min = delete $attributes{min_rows} || 1;
+
+ return $rows > 1
+ ? $self->textarea_tag($name, $value, %attributes, rows => max $rows, $min)
+ : $self->input_tag($name, $value, %attributes);
+}
+
+sub multiselect2side {
+ my ($self, $id, @slurp) = @_;
+ my %params = _hashify(@slurp);
+
+ $params{labelsx} = "\"" . _J($params{labelsx} || $::locale->text('Available')) . "\"";
+ $params{labeldx} = "\"" . _J($params{labeldx} || $::locale->text('Selected')) . "\"";
+ $params{moveOptions} = 'false';
+
+ my $vars = join(', ', map { "${_}: " . $params{$_} } keys %params);
+ my $code = <<EOCODE;
+<script type="text/javascript">
+ \$().ready(function() {
+ \$('#${id}').multiselect2side({ ${vars} });
+ });
+</script>
+EOCODE
+
+ return $code;
+}
+
+sub dump {
+ my $self = shift;
+ require Data::Dumper;
+ return '<pre>' . Data::Dumper::Dumper(@_) . '</pre>';
+}
+
1;
__END__
C<$options_string> and with arbitrary HTML attributes from
C<%attributes>. The tag's C<id> defaults to C<name_to_id($name)>.
-The $options_string is usually created by the C<options_for_select>
-function.
+The C<$options_string> is usually created by the
+L</options_for_select> function. If C<$options_string> is an array
+reference then it will be passed to L</options_for_select>
+automatically.
=item C<input_tag $name, $value, %attributes>
C<$value> and with arbitrary HTML attributes from C<%attributes>. The
tag's C<id> defaults to C<name_to_id($name)>.
+=item C<hidden_tag $name, $value, %attributes>
+
+Creates a HTML 'input type=hidden' tag named C<$name> with the value
+C<$value> and with arbitrary HTML attributes from C<%attributes>. The
+tag's C<id> defaults to C<name_to_id($name)>.
+
+=item C<submit_tag $name, $value, %attributes>
+
+Creates a HTML 'input type=submit class=submit' tag named C<$name> with the
+value C<$value> and with arbitrary HTML attributes from C<%attributes>. The
+tag's C<id> defaults to C<name_to_id($name)>.
+
+If C<$attributes{confirm}> is set then a JavaScript popup dialog will
+be added via the C<onclick> handler asking the question given with
+C<$attributes{confirm}>. If request is only submitted if the user
+clicks the dialog's ok/yes button.
+
+=item C<textarea_tag $name, $value, %attributes>
+
+Creates a HTML 'textarea' tag named C<$name> with the content
+C<$value> and with arbitrary HTML attributes from C<%attributes>. The
+tag's C<id> defaults to C<name_to_id($name)>.
+
=item C<checkbox_tag $name, %attributes>
Creates a HTML 'input type=checkbox' tag named C<$name> with arbitrary
created with said C<label>. No attribute named C<label> is created in
that case.
-=item C<date_tag $name, $value, %attributes>
+=item C<date_tag $name, $value, cal_align =E<gt> $align_code, %attributes>
+
+Creates a date input field, with an attached javascript that will open a
+calendar on click. The javascript ist by default anchoered at the bottom right
+sight. This can be overridden with C<cal_align>, see Calendar documentation for
+the details, usually you'll want a two letter abbreviation of the alignment.
+Right + Bottom becomes C<BL>.
+
+=item C<radio_button_tag $name, %attributes>
+
+Creates a HTML 'input type=radio' tag named C<$name> with arbitrary
+HTML attributes from C<%attributes>. The tag's C<value> defaults to
+C<1>. The tag's C<id> defaults to C<name_to_id($name . "_" . $value)>.
+
+If C<%attributes> contains a key C<label> then a HTML 'label' tag is
+created with said C<label>. No attribute named C<label> is created in
+that case.
+
+=item C<javascript_tag $file1, $file2, $file3...>
+
+Creates a HTML 'E<lt>script type="text/javascript" src="..."E<gt>'
+tag for each file name parameter passed. Each file name will be
+postfixed with '.js' if it isn't already and prefixed with 'js/' if it
+doesn't contain a slash.
+
+=item C<stylesheet_tag $file1, $file2, $file3...>
+
+Creates a HTML 'E<lt>link rel="text/stylesheet" href="..."E<gt>' tag
+for each file name parameter passed. Each file name will be postfixed
+with '.css' if it isn't already and prefixed with 'css/' if it doesn't
+contain a slash.
=item C<date_tag $name, $value, cal_align =E<gt> $align_code, %attributes>
the details, usually you'll want a two letter abbreviation of the alignment.
Right + Bottom becomes C<BL>.
+=item C<tabbed \@tab, %attributes>
+
+Will create a tabbed area. The tabs should be created with the helper function
+C<tab>. Example:
+
+ [% L.tabbed([
+ L.tab(LxERP.t8('Basic Data'), 'part/_main_tab.html'),
+ L.tab(LxERP.t8('Custom Variables'), 'part/_cvar_tab.html', if => SELF.display_cvar_tab),
+ ]) %]
+
+An optional attribute is C<selected>, which accepts the ordinal of a tab which
+should be selected by default.
+
+=item C<areainput_tag $name, $content, %PARAMS>
+
+Creates a generic input tag or textarea tag, depending on content size. The
+mount of desired rows must be given with C<rows> parameter, Accpeted parameters
+include C<min_rows> for rendering a minimum of rows if a textarea is displayed.
+
+You can force input by setting rows to 1, and you can force textarea by setting
+rows to anything >1.
+
+=item C<multiselect2side $id, %params>
+
+Creates a JavaScript snippet calling the jQuery function
+C<multiselect2side> on the select control with the ID C<$id>. The
+select itself is not created. C<%params> can contain the following
+entries:
+
+=over 2
+
+=item C<labelsx>
+
+The label of the list of available options. Defaults to the
+translation of 'Available'.
+
+=item C<labeldx>
+
+The label of the list of selected options. Defaults to the
+translation of 'Selected'.
+
+=back
+
+=item C<dump REF>
+
+Dumps the Argument using L<Data::Dumper> into a E<lt>preE<gt> block.
+
=back
=head2 CONVERSION FUNCTIONS
For cases 3 and 4 C<$options{value}> defaults to C<id> and
C<$options{title}> defaults to C<$options{value}>.
+In addition to pure keys/method you can also provide coderefs as I<value_sub>
+and/or I<title_sub>. If present, these take precedence over keys or methods,
+and are called with the element as first argument. It must return the value or
+title.
+
+Lastly a joint coderef I<value_title_sub> may be provided, which in turn takes
+precedence over each individual sub. It will only be called once for each
+element and must return a list of value and title.
+
If the option C<with_empty> is set then an empty element (value
C<undef>) will be used as the first element. The title to display for
this element can be set with the option C<empty_title> and defaults to
an empty string.
+The option C<default> can be either a scalar or an array reference
+containing the values of the options which should be set to be
+selected.
+
+=item C<tab, description, target, %PARAMS>
+
+Creates a tab for C<tabbed>. The description will be used as displayed name.
+The target should be a block or template that can be processed. C<tab> supports
+a C<method> parameter, which can override the process method to apply target.
+C<method => 'raw'> will just include the given text as is. I was too lazy to
+implement C<include> properly.
+
+Also an C<if> attribute is supported, so that tabs can be suppressed based on
+some occasion. In this case the supplied block won't even get processed, and
+the resulting tab will get ignored by C<tabbed>:
+
+ L.tab('Awesome tab wih much info', '_much_info.html', if => SELF.wants_all)
+
=back
=head1 MODULE AUTHORS
use SL::DBUtils;
+use utf8;
use strict;
my @tax_office_information = (
- { 'id' => 8, 'name' => 'Baden-Württemberg', 'taxbird_nr' => '0', 'elster_format' => 'FF/BBB/UUUUP', },
+ { 'id' => 8, 'name' => 'Baden-Württemberg', 'taxbird_nr' => '0', 'elster_format' => 'FF/BBB/UUUUP', },
{ 'id' => 9, 'name' => 'Bayern', 'taxbird_nr' => '1', 'elster_format' => 'FFF/BBB/UUUUP', },
{ 'id' => 11, 'name' => 'Berlin', 'taxbird_nr' => '2', 'elster_format' => 'FF/BBB/UUUUP', },
{ 'id' => 12, 'name' => 'Brandenburg', 'taxbird_nr' => '3', 'elster_format' => 'FFF/BBB/UUUUP', },
{ 'id' => 14, 'name' => 'Sachsen', 'taxbird_nr' => '12', 'elster_format' => 'FFF/BBB/UUUUP', },
{ 'id' => 15, 'name' => 'Sachsen-Anhalt', 'taxbird_nr' => '13', 'elster_format' => 'FFF/BBB/UUUUP', },
{ 'id' => 1, 'name' => 'Schleswig-Holstein', 'taxbird_nr' => '14', 'elster_format' => 'FF BBB UUUUP', },
- { 'id' => 16, 'name' => 'Thüringen', 'taxbird_nr' => '15', 'elster_format' => 'FFF/BBB/UUUUP', },
+ { 'id' => 16, 'name' => 'Thüringen', 'taxbird_nr' => '15', 'elster_format' => 'FFF/BBB/UUUUP', },
);
sub new {
foreach (@tax_office_information) {
my $entry = \%{ $_ };
- $entry->{name} = $main::locale->{iconv_iso8859}->convert($entry->{name});
+ $entry->{name} = $::locale->{iconv_utf8}->convert($entry->{name});
push @{ $self->{tax_office_information} }, $entry;
}
}
# use SL::Form;
- # Referenz wird übergeben, hash of hash wird nicht
- # in neues Hash kopiert, sondern direkt über die Referenz verändert
- # Prototyp für diese Konstruktion
+ # Referenz wird übergeben, hash of hash wird nicht
+ # in neues Hash kopiert, sondern direkt über die Referenz verändert
+ # Prototyp für diese Konstruktion
my ($self, $land, $elsterFFFF, $elster_init) = @_;
var elsterBLAuswahl = document.verzeichnis.elsterland_new;
var elsterFAAuswahl = document.verzeichnis.elsterFFFF_new;
- elsterFAAuswahl.options.length = 0; // dropdown aufräumen
+ elsterFAAuswahl.options.length = 0; // dropdown aufräumen
|;
foreach my $elster_land (sort keys %$elster_init) {
$main::lxdebug->enter_sub();
# noch nicht fertig
- # soll mal eine Erinnerungsfunktion für USTVA Abgaben werden, die automatisch
- # den Termin der nächsten USTVA anzeigt.
+ # soll mal eine Erinnerungsfunktion für USTVA Abgaben werden, die automatisch
+ # den Termin der nächsten USTVA anzeigt.
#
#
my ($today, $FA_dauerfrist, $FA_voranmeld) = @_;
#There is no table, read the table from sql/finanzamt.sql
print qq|<p>Bitte warten, Tabelle $table wird einmalig in Datenbank:
- $myconfig->{dbname} als Benutzer: $myconfig->{dbuser} hinzugefügt...</p>|;
+ $myconfig->{dbname} als Benutzer: $myconfig->{dbuser} hinzugefügt...</p>|;
process_query($form, $dbh, $filename) || $self->error(DBI->errstr);
#execute second last call
}
- # Fixme: Wird auch noch für Oesterreich gebraucht,
+ # Fixme: Wird auch noch für Oesterreich gebraucht,
# weil kein eigenes Ausgabeformular
- # sotte aber aus der allgeméinen Steuerberechnung verschwinden
+ # sotte aber aus der allgeméinen Steuerberechnung verschwinden
#
# Berechnung der USTVA Formularfelder laut Bogen 207
#
#########################################
# Ausgaben und Gl Buchungen sind gleich
- # für Ist- und Soll-Versteuerung
+ # für Ist- und Soll-Versteuerung
#########################################
$query .= qq|
UNION -- alle Ausgaben AP erfassen
#
#======================================================================
+use utf8;
+
use SL::Auth;
use SL::AM;
use SL::CA;
my $select_eur = q|<option value=""> |. $locale->text('None') .q|</option>\n|;
my %eur = (
- 1 => "Umsatzerlöse",
- 2 => "sonstige Erlöse",
+ 1 => "Umsatzerlöse",
+ 2 => "sonstige Erlöse",
3 => "Privatanteile",
- 4 => "Zinserträge",
- 5 => "Ausserordentliche Erträge",
+ 4 => "Zinserträge",
+ 5 => "Ausserordentliche Erträge",
6 => "Vereinnahmte Umsatzst.",
7 => "Umsatzsteuererstattungen",
- 8 => "Wareneingänge",
- 9 => "Löhne und Gehälter",
+ 8 => "Wareneingänge",
+ 9 => "Löhne und Gehälter",
10 => "Gesetzl. sozialer Aufw.",
11 => "Mieten",
12 => "Gas, Strom, Wasser",
13 => "Instandhaltung",
- 14 => "Steuern, Versich., Beiträge",
+ 14 => "Steuern, Versich., Beiträge",
15 => "Kfz-Steuern",
16 => "Kfz-Versicherungen",
17 => "Sonst. Fahrzeugkosten",
18 => "Werbe- und Reisekosten",
19 => "Instandhaltung u. Werkzeuge",
- 20 => "Fachzeitschriften, Bücher",
- 21 => "Miete für Einrichtungen",
+ 20 => "Fachzeitschriften, Bücher",
+ 21 => "Miete für Einrichtungen",
22 => "Rechts- und Beratungskosten",
- 23 => "Bürobedarf, Porto, Telefon",
+ 23 => "Bürobedarf, Porto, Telefon",
24 => "Sonstige Aufwendungen",
25 => "Abschreibungen auf Anlagever.",
26 => "Abschreibungen auf GWG",
30 => "Ausserordentlicher Aufwand",
31 => "Betriebliche Steuern");
foreach my $item (sort({ $a <=> $b } keys(%eur))) {
- my $text = H(SL::Iconv::convert("ISO-8859-15", $main::dbcharset, $eur{$item}));
+ my $text = H($::locale->{iconv_utf8}->convert($eur{$item}));
if ($item == $form->{pos_eur}) {
$select_eur .= qq|<option value=$item selected>|. sprintf("%.2d", $item) .qq|. $text</option>\n|;
} else {
my $select_bwa = q|<option value=""> |. $locale->text('None') .q|</option>\n|;
my %bwapos = (
- 1 => 'Umsatzerlöse',
+ 1 => 'Umsatzerlöse',
2 => 'Best.Verdg.FE/UE',
3 => 'Aktiv.Eigenleistung',
4 => 'Mat./Wareneinkauf',
- 5 => 'So.betr.Erlöse',
+ 5 => 'So.betr.Erlöse',
10 => 'Personalkosten',
11 => 'Raumkosten',
12 => 'Betriebl.Steuern',
- 13 => 'Vers./Beiträge',
+ 13 => 'Vers./Beiträge',
14 => 'Kfz.Kosten o.St.',
15 => 'Werbe-Reisek.',
16 => 'Kosten Warenabgabe',
17 => 'Abschreibungen',
18 => 'Rep./instandhlt.',
- 19 => 'Übrige Steuern',
+ 19 => 'Übrige Steuern',
20 => 'Sonst.Kosten',
30 => 'Zinsauwand',
31 => 'Sonst.neutr.Aufw.',
- 32 => 'Zinserträge',
+ 32 => 'Zinserträge',
33 => 'Sonst.neutr.Ertrag',
34 => 'Verr.kalk.Kosten',
35 => 'Steuern Eink.u.Ertr.');
foreach my $item (sort({ $a <=> $b } keys %bwapos)) {
- my $text = H(SL::Iconv::convert("ISO-8859-15", $main::dbcharset, $bwapos{$item}));
+ my $text = H($::locale->{iconv_utf8}->convert($bwapos{$item}));
if ($item == $form->{pos_bwa}) {
$select_bwa .= qq|<option value="$item" selected>|. sprintf("%.2d", $item) .qq|. $text\n|;
} else {
}
-# Wieder hinzugefügt zu evaluationszwecken (us) 09.03.2007
+# Wieder hinzugefügt zu evaluationszwecken (us) 09.03.2007
my $select_bilanz = q|<option value=""> |. $locale->text('None') .q|</option>\n|;
foreach my $item ((1, 2, 3, 4)) {
if ($item == $form->{pos_bilanz}) {
'attachment_basename' => $locale->text('vendor_invoice_list') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort and escape callback, this one we use for the add sub
$form->{callback} = $href .= "&sort=$form->{sort}";
'attachment_basename' => $locale->text('invoice_list') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort and escape callback, this one we use for the add sub
$form->{callback} = $href .= "&sort=$form->{sort}";
use strict;
+use List::MoreUtils qw(any);
use POSIX qw(strftime);
use SL::BankAccount;
'attachment_basename' => $locale->text('bankaccounts') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
'std_column_visibility' => 1,
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
'std_column_visibility' => 1,
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
'attachment_basename' => $attachment_basename . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
# /saving the history
$form->redirect($locale->text($msg));
- $msg = "Cannot delete $form->{db}";
- $form->error($locale->text($msg));
-
$main::lxdebug->leave_sub();
}
chdir($cwd);
open(IN, $tmp_name) || die("open $tmp_name");
- print("Content-Type: application/zip\n");
- print("Content-Disposition: attachment; filename=\"${zip_name}\"\n\n");
- while (<IN>) {
- print($_);
- }
+ $::locale->with_raw_io(\*STDOUT, sub {
+ print("Content-Type: application/zip\n");
+ print("Content-Disposition: attachment; filename=\"${zip_name}\"\n\n");
+ while (<IN>) {
+ print($_);
+ }
+ });
close(IN);
unlink($tmp_name);
'attachment_basename' => $attachment_basename . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort and escape callback, this one we use for the add sub
$form->{callback} = $href .= "&sort=$form->{sort}";
'amount_unit' => $all_units->{$form->{"partunit_$i"}}->{base_unit},
'conv_units' => 'convertible_not_smaller',
'max_places' => 2);
- $content .= qq| <input type="button" onclick="open_stock_in_out_window('${in_out}', $i);" value="?">|;
+ $content = qq|<span id="stock_in_out_qty_display_${i}">${content}</span> <input type="button" onclick="open_stock_in_out_window('${in_out}', $i);" value="?">|;
$main::lxdebug->leave_sub();
$main::lxdebug->leave_sub();
}
+sub _stock_in_out_set_qty_display {
+ my $stock_info = shift;
+ my $form = $::form;
+ my $all_units = AM->retrieve_all_units();
+ my $sum = AM->sum_with_unit(map { $_->{qty}, $_->{unit} } @{ $stock_info });
+ $form->{qty_display} = $form->format_amount_units(amount => $sum * 1,
+ part_unit => $form->{partunit},
+ amount_unit => $all_units->{ $form->{partunit} }->{base_unit},
+ conv_units => 'convertible_not_smaller',
+ max_places => 2);
+}
+
sub set_stock_in {
$main::lxdebug->enter_sub();
$form->{stock} = YAML::Dump($stock_info);
+ _stock_in_out_set_qty_display($stock_info);
+
$form->header();
print $form->parse_html_template('do/set_stock_in_out');
stock_in_out_form();
} else {
+ _stock_in_out_set_qty_display($stock_info);
+
$form->header();
print $form->parse_html_template('do/set_stock_in_out');
}
'attachment_basename' => $locale->text('follow_up_list') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
my $idx = 0;
my $callback = build_std_url('action=report', grep { $form->{$_} } @report_params);
#
#======================================================================
+use utf8;
+use strict;
+
use POSIX qw(strftime);
use List::Util qw(sum);
require "bin/mozilla/drafts.pl";
require "bin/mozilla/reportgenerator.pl";
-use strict;
-
# this is for our long dates
# $locale->text('January')
# $locale->text('February')
'attachment_basename' => $locale->text('general_ledger_list') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort to callback
$form->{callback} = "$callback&sort=" . E($form->{sort}) . "&sortdir=" . E($form->{sortdir});
my %charts = ();
my $taxchart_init;
foreach my $item (@{ $form->{ALL_CHARTS} }) {
- if ($item->{charttype} eq 'H'){ #falls überschrift
- next; #überspringen (Bug 1150)
+ if ($item->{charttype} eq 'H'){ #falls überschrift
+ next; #überspringen (Bug 1150)
}
my $key = $item->{accno} . "--" . $item->{tax_id};
$taxchart_init = $item->{tax_id} unless (@chart_values);
print qq|<input class=submit type=submit name=action value="| . $locale->text('Storno') . qq|">|;
}
- # Löschen und Ändern von Buchungen nicht mehr möglich (GoB) nur am selben Tag möglich
+ # Löschen und Ändern von Buchungen nicht mehr möglich (GoB) nur am selben Tag möglich
if (!$form->{locked} && $radieren) {
print qq|
<input class=submit type=submit name=action value="| . $locale->text('Post') . qq|" accesskey="b">
'attachment_basename' => $attachment_basenames{$form->{searchitems}} . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
sellprice_pg pricegroup_old price_old price_new unit_old ordnumber
transdate longdescription basefactor marge_total marge_percent
marge_price_factor lastcost price_factor_id partnotes
- stock_out stock_in has_sernumber);
+ stock_out stock_in has_sernumber reqdate);
my $ic_cvar_configs = CVar->get_configs(module => 'IC');
push @flds, map { "ic_cvar_$_->{name}" } @{ $ic_cvar_configs };
# 2007-10-14 - XMLified - Holger Will <holger@treebuilder.de>
#######################################################################
+use utf8;
+
use SL::Menu;
use CGI::Carp qw(fatalsToBrowser);
. qq|<?xml version="1.0" encoding="${charset}"?>
<?xml-stylesheet href="xslt/xulmenu.xsl" type="text/xsl"?>
<!DOCTYPE doc [
-<!ENTITY szlig "| . $::locale->{iconv_iso8859}->convert('ß') . qq|">
-<!ENTITY auml "| . $::locale->{iconv_iso8859}->convert('ä') . qq|">
-<!ENTITY ouml "| . $::locale->{iconv_iso8859}->convert('ö') . qq|">
-<!ENTITY uuml "| . $::locale->{iconv_iso8859}->convert('ü') . qq|">
+<!ENTITY szlig "| . $::locale->{iconv_utf8}->convert('ß') . qq|">
+<!ENTITY auml "| . $::locale->{iconv_utf8}->convert('ä') . qq|">
+<!ENTITY ouml "| . $::locale->{iconv_utf8}->convert('ö') . qq|">
+<!ENTITY uuml "| . $::locale->{iconv_utf8}->convert('ü') . qq|">
]>
<doc>
# 2004-12-14 - Holger Lindemann
#######################################################################
+use utf8;
+use strict;
+
use SL::Menu;
use CGI::Carp qw(fatalsToBrowser);
-use strict;
-
1;
# end of main
} else {
if ($menu->{$item}{module}) {
- #Untermenüpunkte
+ #Untermenüpunkte
my $target = $menu->{$item}{target};
my $uri = $menu->menuitem_js(\%myconfig, \%$form, $item, $level);
'attachment_basename' => $attachment_basename . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort and escape callback, this one we use for the add sub
$form->{callback} = $href .= "&sort=$form->{sort}";
'attachment_basename' => $locale->text('project_list') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
CVar->add_custom_variables_to_report('module' => 'Projects',
'trans_id_field' => 'id',
</tr>
<tr>
<td>| . $locale->text('Review of Aging list') . qq|</td>
- <td><select name="review_of_aging_list">
+ <td><select name="review_of_aging_list">
<option></option>
<option>0-30</option>
<option>30-60</option>
'pdf_template' => 'rp/html_report_susa',
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
# add sort and escape callback, this one we use for the add sub
$form->{callback} = $href .= "&sort=$form->{sort}";
'std_column_visibility' => 1,
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
'title' => $form->{title},
'attachment_basename' => $attachment_basename . strftime('_%Y%m%d', localtime time),
);
+ $report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
my $previous_ctid = 0;
my $row_idx = 0;
'raw_bottom_info_text' => $raw_bottom_info_text);
}
- $report->set_options_from_form();
-
$report->generate_with_headers();
$main::lxdebug->leave_sub();
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
+
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
'attachment_basename' => $locale->text('banktransfers') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%::myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
# German Tax authority Module and later ELSTER Interface
#======================================================================
+use utf8;
+
require "bin/mozilla/common.pl";
#use strict;
$ustva->get_config($userspath, 'finanzamt.ini');
# Hier Einlesen der user-config
- # steuernummer entfernt für prerelease
+ # steuernummer entfernt für prerelease
my @a = qw(
signature name company address businessnumber
tel fax email co_chief co_department
# Anpassungen der Variablennamen auf pre 2.1.1 Namen
- # klären, ob $form->{company_street|_address} gesetzt sind
+ # klären, ob $form->{company_street|_address} gesetzt sind
if ($form->{address} ne '') {
my $temp = $form->{address};
$temp =~ s/\n/<br \/>/;
$sel = '';
my $dfv = '';
- # Offset für Dauerfristverlängerung
+ # Offset für Dauerfristverlängerung
$dfv = '100' if ($form->{FA_dauerfrist} eq '1');
SWITCH: {
my $yy = $form->{year} * 10000;
$yymmdd = "$form->{year}$form->{month}$form->{day}" * 1;
$sel = '';
- my $dfv = ''; # Offset für Dauerfristverlängerung
+ my $dfv = ''; # Offset für Dauerfristverlängerung
$dfv = '100' if ($form->{FA_dauerfrist} eq '1');
SWITCH: {
};
}
- # Kontrollvariable für die Templates
+ # Kontrollvariable für die Templates
$form->{'year2007'} = ($form->{year} >= 2007 ) ? "1":"0";
$form->{endbold} = "}";
$form->{br} = '\\\\';
- # Zahlenformatierung für Latex USTVA Formulare
+ # Zahlenformatierung für Latex USTVA Formulare
foreach my $number (@category_euro) {
$form->{$number} = $form->format_amount(\%myconfig, $form->{$number}, '0', '');
$form->{$number} =~ s/${decimal_comma}/~~/g;
}
- } elsif ( $form->{format} eq 'html') { # Formatierungen für HTML Ausgabe
+ } elsif ( $form->{format} eq 'html') { # Formatierungen für HTML Ausgabe
$form->{IN} = $form->{type} . '.html';
$form->{padding} = " ";
$file .= sprintf("%02d", $form->{year} % 100);
#6. to 18. char = Elstersteuernummer
#Beispiel: Steuernummer in Bayern
- #111/222/33334 ergibt für UStVA Jan 2004: U01049111022233334
+ #111/222/33334 ergibt für UStVA Jan 2004: U01049111022233334
$file .= $form->{elsterFFFF};
$file .= $form->{elstersteuernummer};
#file suffix
$form->{attachment_filename} = $file;
- # Zahlenformatierung für Winston
+ # Zahlenformatierung für Winston
my $temp_numberformat = $myconfig{numberformat};
$form->{USTVA} = [];
- if ( $form->{format} eq 'generic') { # Formatierungen für HTML Ausgabe
+ if ( $form->{format} eq 'generic') { # Formatierungen für HTML Ausgabe
my $rec_ref = {};
for my $kennziffer (@category_cent, @category_euro) {
$ustva->get_coa($form, \%myconfig);
- # hä? kann die weg?
+ # hä? kann die weg?
my $steuernummer_new = '';
- # Variablen für das Template zur Verfügung stellen
+ # Variablen für das Template zur Verfügung stellen
my $template_ref = {
select_tax_office => $select_tax_office,
checked_accrual => $checked_accrual,
$ustva->get_config($userspath, 'finanzamt.ini')
if ($form->{saved} eq $locale->text('saved'));
- # Auf Übergabefehler checken
+ # Auf Übergabefehler checken
USTVA::info( $locale->text('Missing Tax Authoritys Preferences') . "\n"
. $locale->text('USTVA-Hint: Tax Authoritys'))
if ( $form->{elsterFFFF_new} eq 'Auswahl'
. $locale->text('USTVA-Hint: Method'))
if ($form->{method} eq '');
- # Klären, ob Variablen bereits befüllt sind UND ob veräderungen auf
+ # Klären, ob Variablen bereits befüllt sind UND ob veräderungen auf
# der vorherigen Maske stattfanden: $change = 1(in der edit sub,
# mittels get_config)
if ($change eq '1') {
- # Daten ändern
+ # Daten ändern
$elsterland = $form->{elsterland_new};
$elsterFFFF = $form->{elsterFFFF_new};
$form->{elsterland} = $elsterland;
FA_steuerberater_street FA_steuerberater_city FA_steuerberater_tel
FA_71 FA_dauerfrist);
- # Hier kommt dann die Plausibilitätsprüfung der ELSTERSteuernummer
+ # Hier kommt dann die Plausibilitätsprüfung der ELSTERSteuernummer
if ($form->{elstersteuernummer} ne '000000000') {
$form->{elster} = '1';
my ($callback, $href, @columns);
$form->{customer} = $form->unescape($form->{customer});
-
+
($form->{customername}, $form->{customer_id}) = split(/--/, $form->{customer});
# decimalplaces überprüfen oder auf Default 2 setzen
'marge_total' => { 'text' => $locale->text('Sales margin'), },
'marge_percent' => { 'text' => $locale->text('Sales margin %'), },
);
-
+
my %column_alignment = map { $_ => 'right' } qw(lastcost sellprice sellprice_total lastcost_total unit discount marge_total marge_percent qty);
$form->{"l_type"} = "Y";
'attachment_basename' => $locale->text('Sales Report') . strftime('_%Y%m%d', localtime time),
);
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
$report->set_columns(%column_defs);
$report->set_column_order(@columns);
$ar->{sellprice} = $ar->{sellprice} / $ar->{price_factor};
$ar->{lastcost} = $ar->{lastcost} / $ar->{price_factor};
$ar->{sellprice_total} = $ar->{qty} * $ar->{sellprice};
- $ar->{lastcost_total} = $ar->{qty} * $ar->{lastcost};
+ $ar->{lastcost_total} = $ar->{qty} * $ar->{lastcost};
# marge_percent wird neu berechnet, da Wert in invoice leer ist (Bug)
$ar->{marge_percent} = $ar->{sellprice_total} ? (($ar->{sellprice_total}-$ar->{lastcost_total}) / $ar->{sellprice_total}) : 0;
# marge_total neu berechnen
$report->add_data($headerrow_set);
# add empty row after main header
-# my $emptyheaderrow->{description}->{data} = "";
+# my $emptyheaderrow->{description}->{data} = "";
# $emptyheaderrow->{description}->{class} = "listmainsortheader";
# my $emptyheaderrow_set = [ $emptyheaderrow ];
-# $report->add_data($emptyheaderrow_set) if $form->{l_headers} eq "Y";
+# $report->add_data($emptyheaderrow_set) if $form->{l_headers} eq "Y";
};
# subsort überschriften
- if ( $idx == 0
+ if ( $idx == 0
or $ar->{ $form->{'subsort'} } ne $form->{AR}->[$idx - 1]->{ $form->{'subsort'} }
or $ar->{ $form->{'mainsort'} } ne $form->{AR}->[$idx - 1]->{ $form->{'mainsort'} }
) {
map { $subtotals1{$_} += $ar->{$_};
$subtotals2{$_} += $ar->{$_};
} @subtotal_columns;
-
- map { $totals{$_} += $ar->{$_} } @total_columns;
+
+ map { $totals{$_} += $ar->{$_} } @total_columns;
$subtotals2{sellprice} = $subtotals2{sellprice_total} / $subtotals2{qty} if $subtotals2{qty} != 0;
$subtotals1{sellprice} = $subtotals1{sellprice_total} / $subtotals1{qty} if $subtotals1{qty} != 0;
'align' => $column_alignment{$column},
};
}
-
+
$row->{description}->{class} = 'listsortdescription';
$row->{invnumber}->{link} = build_std_url("script=is.pl", 'action=edit')
} else {
$name = 'name';
};
-
+
if ($form->{l_subtotal} eq 'Y' ) {
push @{ $row_set }, create_subtotal_row_invoice(\%subtotals2, \@columns, \%column_alignment, \@subtotal_columns, 'listsubsortsubtotal', $ar->{$name}) ;
push @{ $row_set }, insert_empty_row();
};
}
- # if mainsort has changed, add mainsort subtotal and empty row
+ # if mainsort has changed, add mainsort subtotal and empty row
if (($form->{l_subtotal} eq 'Y')
&& (($idx == (scalar @{ $form->{AR} } - 1)) # last element always has a subtotal
|| ($ar->{ $form->{'mainsort'} } ne $form->{AR}->[$idx + 1]->{ $form->{'mainsort'} })
push @{ $row_set }, insert_empty_row();
};
}
-
+
$report->add_data($row_set);
$idx++;
my %myconfig = %main::myconfig;
my $row = { map { $_ => { 'data' => '', 'class' => $class, 'align' => $column_alignment->{$_}, } } @{ $columns } };
-
+
$row->{description}->{data} = "Summe " . $name;
map { $row->{$_}->{data} = $form->format_amount(\%myconfig, $totals->{$_}, 2) } qw(marge_total marge_percent);
} elsif (($form->{partnumber} && ($form->{partnumber} ne $form->{old_partnumber})) || $form->{description} || $form->{ean}) {
- $form->{no_services} = 1;
+# $form->{no_services} = 1; # services may now be transfered. fix for Bug 1383.
$form->{no_assemblies} = 0; # assemblies duerfen eingelagert werden (z.B. bei retouren)
my $parts = Common->retrieve_parts(\%myconfig, $form, 'description', 1);
'title' => $form->{title},
'attachment_basename' => strftime($locale->text('warehouse_journal_list') . '_%Y%m%d', localtime time));
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
my $all_units = AM->retrieve_units(\%myconfig, $form);
my @contents = WH->get_warehouse_journal(%filter);
'title' => $form->{title},
'attachment_basename' => strftime($locale->text('warehouse_report_list') . '_%Y%m%d', localtime time));
$report->set_options_from_form();
+ $locale->set_numberformat_wo_thousands_separator(\%myconfig) if lc($report->{options}->{output_format}) eq 'csv';
my $all_units = AM->retrieve_units(\%myconfig, $form);
my @contents = WH->get_warehouse_report(%filter);
#!/usr/bin/perl
-# Das Passwort für den Zugang zum Administrationsfrontend im Klartext.
-# Kann nur in dieser Datei geändert werden, nicht im Administrationsfrontend
+# Das Passwort für den Zugang zum Administrationsfrontend im Klartext.
+# Kann nur in dieser Datei geändert werden, nicht im Administrationsfrontend
# selber.
$self->{admin_password} = 'admin';
# Entweder 'DB' oder 'LDAP'.
#
# Wenn LDAP-Authentifizierung benutzt wird, dann kann der Benutzer sein
-# Passwort nicht über Lx-Office ändern.
+# Passwort nicht über Lx-Office ändern.
$self->{module} = 'DB';
# Verbindungsinformationen zur Datenbank mit den Benutzer- und
-# Gruppeninformationen. Wird auch dann benötigt, wenn gegen einen
-# LDAP-Server authentifiziert wird, weil dieser nur zur Passwortüberprüfung
+# Gruppeninformationen. Wird auch dann benötigt, wenn gegen einen
+# LDAP-Server authentifiziert wird, weil dieser nur zur Passwortüberprüfung
# benutzt wird. Der Rest der Benutzerdaten ist in der Datenbank hinterlegt.
#
-# Ist 'module' = 'DB' dann wird diese Datenbank auch für die
-# Passwortüberprüfung benutzt.
+# Ist 'module' = 'DB' dann wird diese Datenbank auch für die
+# Passwortüberprüfung benutzt.
$self->{DB_config} = {
'host' => 'localhost',
'port' => 5432,
'password' => '',
};
-# Wird nur benötigt, wenn 'module' = 'LDAP' ist. An diesem LDAP-Server
-# werden die Benutzerpasswörter durch einen LDAP-Bind überprüft.
+# Wird nur benötigt, wenn 'module' = 'LDAP' ist. An diesem LDAP-Server
+# werden die Benutzerpasswörter durch einen LDAP-Bind überprüft.
#
-# Es müssen mindestens die Parameter host, attribute und base_dn
+# Es müssen mindestens die Parameter host, attribute und base_dn
# angegeben werden.
#
-# tls: Verschlüsselung per TLS erzwingen
-# attribute: Das LDAP-Attribut, das den Loginnamen enthält
+# tls: Verschlüsselung per TLS erzwingen
+# attribute: Das LDAP-Attribut, das den Loginnamen enthält
# base_dn: Basis-DN, ab der der LDAP-Baum durchsucht wird
# filter: Ein optionaler LDAP-Filter. Die Zeichenkette '<%login%>' wird
# innerhalb des Filters durch den Loginnamen ersetzt.
# bind_dn und bind_password:
# Wenn zum Durchsuchen des LDAP-Baumes eine Anmeldung erforderlich
-# ist (z.B. beim ActiveDirectory), dann müssen diese beiden
+# ist (z.B. beim ActiveDirectory), dann müssen diese beiden
# Parameter gesetzt sein.
$self->{LDAP_config} = {
'host' => 'localhost',
'bind_password' => undef,
};
-# Der Name des Cookies kann geändert werden, sofern gewünscht.
+# Der Name des Cookies kann geändert werden, sofern gewünscht.
# $self->{cookie_name} = 'lx_office_erp_session_id';
-# Die Zeitspanne, bis eine inaktive Session ungültig wird, kann
-# hier geändert werden. Der Standardwert ist acht Stunden.
+# Die Zeitspanne, bis eine inaktive Session ungültig wird, kann
+# hier geändert werden. Der Standardwert ist acht Stunden.
# Die Angabe ist in Minuten.
# $self->{session_timeout} = 8 * 60;
# member file
$memberfile = "users/members";
-# Wenn Einnahmen-Überschussrechnung, dann auf 1 setzen
+# Wenn Einnahmen-Überschussrechnung, dann auf 1 setzen
# Wenn Bilanzierung (z.B. GmbH), dann auf 0 setzen
$eur = 1;
$webdav = 0;
$lizenzen = 1;
$vertreter = 0;
-$excel_templates = 0; # Minimalunterstützung für Excel-Druckvorlagen
+$excel_templates = 0; # Minimalunterstützung für Excel-Druckvorlagen
-# Zeige Felder für Mindesthaltbarkeitsdatum
+# Zeige Felder für Mindesthaltbarkeitsdatum
$show_best_before = 0;
## Support fuer OpenDocument-Vorlagen
$xvfb_bin = "/usr/bin/Xvfb";
# Das charset, in dem die Daten in der Datenbank abgelegt sind.
-$dbcharset = 'UTF-8'; # Für UNICODE UTF-8
+$dbcharset = 'UTF-8'; # Für UNICODE UTF-8
# $dbcharset = "ISO-8859-15";
$latex_bin = 'pdflatex';
# Datenbankbackups werden mit dem externen Programm "pg_dump" erledigt.
-# Wenn es nicht im aktuellen Pfad vorhanden ist, so muss hier der vollständige
+# Wenn es nicht im aktuellen Pfad vorhanden ist, so muss hier der vollständige
# Pfad eingetragen werden. Wenn die Variable auf "DISABLED" gesetzt wird,
-# so wird der Menüpunkt zum Backup von Datenbanken im Administrationsfrontend
+# so wird der Menüpunkt zum Backup von Datenbanken im Administrationsfrontend
# nicht angeboten.
-# Das gleiche gilt analog für das Wiederherstellen mittels "pg_restore".
+# Das gleiche gilt analog für das Wiederherstellen mittels "pg_restore".
$pg_dump_exe = "pg_dump";
$pg_restore_exe = "pg_restore";
# Rose::DB::Object Environment laden.
-# Die RDBO Klassen bieten für Addon Schreiber sehr einfache Interfaces zu den
+# Die RDBO Klassen bieten für Addon Schreiber sehr einfache Interfaces zu den
# bestehenden Klassen, haben aber den Nachteil, dass der Start des Programms
-# etwa 2s mehr dauert. Damit fällt die Möglichkeit Lx-Office über CGI zu
+# etwa 2s mehr dauert. Damit fällt die Möglichkeit Lx-Office über CGI zu
# betreiben weg.
$use_rdbo = 1;
# LXDebug::DEBUG2
# LXDebug::QUERY - SQL Queries
# LXDebug::TRACE - Tracing von Funktionsaufrufen
-# LXDebug::BACKTRACE_ON_ERROR - Vollständiger Aufrufpfad, wenn $form->error() aufgerufen wird
+# LXDebug::BACKTRACE_ON_ERROR - Vollständiger Aufrufpfad, wenn $form->error() aufgerufen wird
# LXDebug::REQUEST_TIMER - Timing von Requests loggen
# LXDebug::WARN - warnings
# LXDebug::ALL - alle Debugausgaben
# $LXDebug::global_level = LXDebug::TRACE | LXDebug::QUERY;
$LXDebug::global_level = LXDebug->NONE;
-# Überwachung der Inhalte von $form aktiviert oder nicht? Wenn ja,
-# dann können einzelne Variablen mit
+# Überwachung der Inhalte von $form aktiviert oder nicht? Wenn ja,
+# dann können einzelne Variablen mit
# $form->{"Watchdog::<variablenname>"} = 1;
-# überwacht werden. Bedeutet aber auch einen Geschwindigkeitsverlust,
+# überwacht werden. Bedeutet aber auch einen Geschwindigkeitsverlust,
# weshalb sie normalerweise deaktiviert ist.
$LXDebug::watch_form = 0;
# Zum debuggen von Latexausgaben. Wenn diese Option auf 1 gesetzt wird, werden
-# temporäre Dateien, die bei der Erstellung von PDFs aus Latex erzeugt werden,
-# nach Abschluß der Erstellung oder im Fehlerfall nicht gelöscht, damit man sie
+# temporäre Dateien, die bei der Erstellung von PDFs aus Latex erzeugt werden,
+# nach Abschluß der Erstellung oder im Fehlerfall nicht gelöscht, damit man sie
# untersuchen kann.
$::keep_temp_files = 0;
$lizenzen = 1;
$vertreter = 0;
-# Zeige Felder für Mindesthaltbarkeitsdatum
+# Zeige Felder für Mindesthaltbarkeitsdatum
$show_best_before = 0;
## Support fuer OpenDocument-Vorlagen
$xvfb_bin = "/usr/bin/Xvfb";
# Das charset, in dem die Daten in der Datenbank abgelegt sind.
-$dbcharset = 'UTF-8'; # Für UNICODE UTF-8
+$dbcharset = 'UTF-8'; # Für UNICODE UTF-8
# $dbcharset = "ISO-8859-15";
$latex_bin = 'pdflatex';
# Datenbankbackups werden mit dem externen Programm "pg_dump" erledigt.
-# Wenn es nicht im aktuellen Pfad vorhanden ist, so muss hier der vollständige
+# Wenn es nicht im aktuellen Pfad vorhanden ist, so muss hier der vollständige
# Pfad eingetragen werden. Wenn die Variable auf "DISABLED" gesetzt wird,
-# so wird der Menüpunkt zum Backup von Datenbanken im Administrationsfrontend
+# so wird der Menüpunkt zum Backup von Datenbanken im Administrationsfrontend
# nicht angeboten.
-# Das gleiche gilt analog für das Wiederherstellen mittels "pg_restore".
+# Das gleiche gilt analog für das Wiederherstellen mittels "pg_restore".
$pg_dump_exe = "pg_dump";
$pg_restore_exe = "pg_restore";
# LXDebug::DEBUG2
# LXDebug::QUERY - SQL Queries
# LXDebug::TRACE - Tracing von Funktionsaufrufen
-# LXDebug::BACKTRACE_ON_ERROR - Vollständiger Aufrufpfad, wenn $form->error() aufgerufen wird
+# LXDebug::BACKTRACE_ON_ERROR - Vollständiger Aufrufpfad, wenn $form->error() aufgerufen wird
# LXDebug::REQUEST_TIMER - Timing von Requests loggen
# LXDebug::WARN - warnings
# LXDebug::ALL - alle Debugausgaben
# $LXDebug::global_level = LXDebug::TRACE | LXDebug::QUERY;
$LXDebug::global_level = LXDebug::NONE;
-# Überwachung der Inhalte von $form aktiviert oder nicht? Wenn ja,
-# dann können einzelne Variablen mit
+# Überwachung der Inhalte von $form aktiviert oder nicht? Wenn ja,
+# dann können einzelne Variablen mit
# $form->{"Watchdog::<variablenname>"} = 1;
-# überwacht werden. Bedeutet aber auch einen Geschwindigkeitsverlust,
+# überwacht werden. Bedeutet aber auch einen Geschwindigkeitsverlust,
# weshalb sie normalerweise deaktiviert ist.
$LXDebug::watch_form = 0;
# Zum debuggen von Latexausgaben. Wenn diese Option auf 1 gesetzt wird, werden
-# temporäre Dateien, die bei der Erstellung von PDFs aus Latex erzeugt werden,
-# nach Abschluß der Erstellung oder im Fehlerfall nicht gelöscht, damit man sie
+# temporäre Dateien, die bei der Erstellung von PDFs aus Latex erzeugt werden,
+# nach Abschluß der Erstellung oder im Fehlerfall nicht gelöscht, damit man sie
# untersuchen kann.
$::keep_temp_files = 0;
--- /dev/null
+.ms2side__div {
+ clear: left;
+ width: 100%;
+ padding: 1px;
+ float: left;
+ background : url('') repeat-x; // HACK FOR CHROME
+}
+
+.ms2side__select {
+ float: left;
+}
+
+.ms2side__header {
+ color: blue;
+ background-color: #EEEEFF;
+}
+
+.ms2side__options, .ms2side__updown {
+ float: left;
+ font-size: 10pt;
+ margin: 0;
+ padding: 0 8px;
+ width: 40px;
+ color: black;
+ text-align: center;
+ overflow: hidden;
+}
+
+.ms2side__updown {
+ font-size: 9pt;
+}
+
+.ms2side__options p, .ms2side__updown p {
+ margin: 2px 0;
+ padding: 0;
+ cursor: hand;
+ border: 1px solid black;
+}
+
+.ms2side__options p.ms2side_hover, .ms2side__updown p.ms2side_hover {
+ background-color: #F0F0FF;
+ border-color: #0000FF;
+ cursor: hand;
+}
+
+.ms2side__options p.ms2side__hide, .ms2side__updown p.ms2side__hide {
+ cursor: default;
+ color: grey;
+ border: 1px solid grey;
+ background-color: #F0F0F0;
+}
+
+.ms2side__div select {
+ width: 220px;
+ float: left;
+}
\ No newline at end of file
}
/*
- Überschriftsbalken
+ Überschriftsbalken
*/
.listtop {
background-color: rgb(236,233,216);
.unbalanced_ledger {
background-color: #ffa0a0;
}
+
+.clearfix:after {
+ clear:both;
+ content:".";
+ display:block;
+ font-size:0;
+ height:0;
+ visibility:hidden;
+}
ist sie deutlich leichter zu lesen.
-=head1 FastCGI für Lx-Office
+=head1 FastCGI für Lx-Office
=head2 Was ist FastCGI?
Direkt aus L<http://de.wikipedia.org/wiki/FastCGI> kopiert:
- FastCGI ist ein Standard für die Einbindung externer Software zur Generierung
+ FastCGI ist ein Standard für die Einbindung externer Software zur Generierung
dynamischer Webseiten in einem Webserver. FastCGI ist vergleichbar zum Common
Gateway Interface (CGI), wurde jedoch entwickelt, um dessen
Performance-Probleme zu umgehen.
=head2 Warum FastCGI?
Perl Programme (wie Lx-Office eines ist) werden nicht statisch kompiliert.
-Stattdessen werden die Quelldateien bei jedem Start übersetzt, was bei kurzen
-Laufzeiten einen Großteil der Laufzeit ausmacht. Während SQL Ledger einen
-Großteil der Funktionalität in einzelne Module kapselt, um immer nur einen
-kleinen Teil laden zu müssen, ist die Funktionalität von Lx-Office soweit
+Stattdessen werden die Quelldateien bei jedem Start übersetzt, was bei kurzen
+Laufzeiten einen Großteil der Laufzeit ausmacht. Während SQL Ledger einen
+Großteil der Funktionalität in einzelne Module kapselt, um immer nur einen
+kleinen Teil laden zu müssen, ist die Funktionalität von Lx-Office soweit
gewachsen, dass immer mehr Module auf den Rest des Programms zugreifen.
-Zusätzlich benutzen wir umfangreiche Bibliotheken um Funktionaltät nicht selber
-entwickeln zu müssen, die zusätzliche Ladezeit kosten. All dies führt dazu dass
-ein Lx-Office Aufruf der Kernmasken mittlerweile deutlich länger dauert als
-früher, und dass davon 90% für das Laden der Module verwendet wird.
+Zusätzlich benutzen wir umfangreiche Bibliotheken um Funktionaltät nicht selber
+entwickeln zu müssen, die zusätzliche Ladezeit kosten. All dies führt dazu dass
+ein Lx-Office Aufruf der Kernmasken mittlerweile deutlich länger dauert als
+früher, und dass davon 90% für das Laden der Module verwendet wird.
Mit FastCGI werden nun die Module einmal geladen, und danach wird nur die
-eigentliche Programmlogik ausgeführt.
+eigentliche Programmlogik ausgeführt.
=head2 Kombinationen aus Webservern und Plugin.
* Apache 2.2.11 (Ubuntu) und mod_fcgid:
Als Perl Backend wird das Modul FCGI.pm verwendet. Vorsicht: FCGI 0.69 und
-höher ist extrem strict in der Behandlung von Unicode, und verweigert bestimmte
+höher ist extrem strict in der Behandlung von Unicode, und verweigert bestimmte
Eingaben von Lx-Office. Solange diese Probleme nicht behoben sind, muss auf die
-Vorgängerversion FCGI 0.68 ausgewichen werden.
+Vorgängerversion FCGI 0.68 ausgewichen werden.
-Mit cpan lässt sie sich wie folgt installieren:
+Mit cpan lässt sie sich wie folgt installieren:
force install M/MS/MSTROUT/FCGI-0.68.tar.gz
Bevor Sie versuchen eine Lx-Office Installation unter FCGI laufen zu lassen,
empfliehlt es sich die Installation ersteinmal unter CGI aufzusetzen. FCGI
macht es nicht einfach Fehler zu debuggen die beim ersten aufsetzen auftreten
-können. Sollte die Installation schon funktionieren, lesen Sie weiter.
+können. Sollte die Installation schon funktionieren, lesen Sie weiter.
Zuerst muss das FastCGI-Modul aktiviert werden. Dies kann unter
Debian/Ubuntu z.B. mit folgendem Befehl geschehen:
a2enmod fcgid
-Die Konfiguration für die Verwendung von Lx-Office mit FastCGI erfolgt
+Die Konfiguration für die Verwendung von Lx-Office mit FastCGI erfolgt
durch Anpassung der vorhandenen Alias- und Directory-Direktiven. Dabei
wird zwischen dem Installationspfad von Lx-Office im Dateisystem
("/path/to/lx-office-erp") und der URL unterschieden, unter der
Deny from All
</DirectoryMatch>
-...und für mod_fcgid muss die erste Zeile geändert werden in:
+...und für mod_fcgid muss die erste Zeile geändert werden in:
AliasMatch ^/web/path/to/lx-office-erp/[^/]+\.pl /path/to/lx-office-erp/dispatcher.fcgi
Hierdurch wird nur ein zentraler Dispatcher gestartet. Alle Zugriffe
auf die einzelnen Scripte werden auf diesen umgeleitet. Dadurch, dass
-zur Laufzeit öfter mal Scripte neu geladen werden, gibt es hier kleine
-Performance-Einbußen. Trotzdem ist diese Variante einer globalen
+zur Laufzeit öfter mal Scripte neu geladen werden, gibt es hier kleine
+Performance-Einbußen. Trotzdem ist diese Variante einer globalen
Benutzung von "AddHandler fastcgi-script .pl" vorzuziehen.
-Es ist möglich die gleiche Lx-Office Version parallel unter cgi und fastcgi zu
-betreiben. Dafür bleiben Directorydirektiven bleiben wie oben beschrieben, die
+Es ist möglich die gleiche Lx-Office Version parallel unter cgi und fastcgi zu
+betreiben. Dafür bleiben Directorydirektiven bleiben wie oben beschrieben, die
URLs werden aber umgeleitet:
# Zugriff ohne FastCGI
Achtung:
Die AddHandler Direktive vom Apache ist entgegen der Dokumentation
-anscheinend nicht lokal auf das Verzeichnis beschränkt sondern global im
+anscheinend nicht lokal auf das Verzeichnis beschränkt sondern global im
vhost.
=head2 Entwicklungsaspekte
-Wenn Änderungen in der Konfiguration von Lx-Office gemacht werden, muss der
+Wenn Änderungen in der Konfiguration von Lx-Office gemacht werden, muss der
Server neu gestartet werden.
-Bei der Entwicklung für FastCGI ist auf ein paar Fallstricke zu achten. Dadurch
-dass das Programm in einer Endlosschleife läuft, müssen folgende Aspekte
+Bei der Entwicklung für FastCGI ist auf ein paar Fallstricke zu achten. Dadurch
+dass das Programm in einer Endlosschleife läuft, müssen folgende Aspekte
geachtet werden:
=head3 Programmende und Ausnahmen: C<warn>, C<die>, C<exit>, C<carp>, C<confess>
Gleiche, mit ein paar Extraoptionen. C<warn> und C<exit> hingegen werden nicht
abgefangen. C<warn> wird direkt nach STDERR, also in Server Log eine Nachricht
schreiben (sofern in der Konfiguration nicht die Warnungen in das Lx-Office Log
-umgeleitet wurden), und C<exit> wird die Ausführung beenden.
+umgeleitet wurden), und C<exit> wird die Ausführung beenden.
Prinzipiell ist es kein Beinbruch, wenn sich der Prozess beendet, fcgi wird ihn
sofort neu starten. Allerdings sollte das die Ausnahme sein. Quintessenz: Bitte
=head3 Globale Variablen
Um zu vermeiden, dass Informationen von einem Request in einen anderen gelangen,
-müssen alle globalen Variablen vor einem Request sauber initialisiert werden.
+müssen alle globalen Variablen vor einem Request sauber initialisiert werden.
Das ist besonders wichtig im C<$::cgi> und C<$::auth> Objekt, weil diese nicht
-gelöscht werden pro Instanz, sondern persistent gehalten werden.
+gelöscht werden pro Instanz, sondern persistent gehalten werden.
In C<SL::Dispatcher> gibt es einen sauber abgetrennten Block der alle
-kanonischen globalen Variablen listet und erklärt. Bitte keine anderen
-einführen ohne das sauber zu dokumentieren.
+kanonischen globalen Variablen listet und erklärt. Bitte keine anderen
+einführen ohne das sauber zu dokumentieren.
Datenbankverbindungen wird noch ein Guide verfasst werden, wie man sichergeht,
dass man die richtige erwischt.
=head3 Encoding Awareness
-UTF-8 kodierte Installationen sind sehr anfällig gegen fehlerhfate Encodings
+UTF-8 kodierte Installationen sind sehr anfällig gegen fehlerhfate Encodings
unter FCGI. latin9 Installationen behandeln falsch kodierte Zeichen eher
unwissend, und geben sie einfach weiter. UTF-8 verweigert bei fehlerhaften
Programmpfaden kurzerhand aus ausliefern. Es wird noch daran gearbeitet alles
@item
Email::Address
@item
-IO::Wrap (aus dem Paket IO::Stringy)
-@item
List::MoreUtils
@item
PDF::API2
Weiterhin muss in der Datei @code{config/lx-erp.conf} die Variable
@code{$dbcharset} auf die Zeichenkodierung gesetzt werden, die auch
bei der Speicherung der Daten in der Datenbank verwendet wird. Diese
-ist in den meisten Fällen "ISO-8859-15".
+ist in den meisten Fällen "UTF-8".
Während die Erzeugung von reinen OpenDocument-Dateien keinerlei
weitere Software benötigt, wird zur Umwandlung dieser Dateien in PDF
* Email::Address
- * IO::Wrap (aus dem Paket IO::Stringy)
-
* List::MoreUtils
* PDF::API2
Weiterhin muss in der Datei `config/lx-erp.conf' die Variable
`$dbcharset' auf die Zeichenkodierung gesetzt werden, die auch bei der
Speicherung der Daten in der Datenbank verwendet wird. Diese ist in den
-meisten Fällen "ISO-8859-15".
+meisten Fällen "UTF-8".
Während die Erzeugung von reinen OpenDocument-Dateien keinerlei
weitere Software benötigt, wird zur Umwandlung dieser Dateien in PDF
<title>Administratorpasswort - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="prev" href="Grundlagen-zur-Benutzerauthentifizierung.html#Grundlagen-zur-Benutzerauthentifizierung" title="Grundlagen zur Benutzerauthentifizierung">
</head>
<body>
<div class="node">
-<p>
<a name="Administratorpasswort"></a>
-nächstes: <a rel="next" accesskey="n" href="Authentifizierungsdatenbank.html#Authentifizierungsdatenbank">Authentifizierungsdatenbank</a>,
-voriges: <a rel="previous" accesskey="p" href="Grundlagen-zur-Benutzerauthentifizierung.html#Grundlagen-zur-Benutzerauthentifizierung">Grundlagen zur Benutzerauthentifizierung</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Authentifizierungsdatenbank.html#Authentifizierungsdatenbank">Authentifizierungsdatenbank</a>,
+Previous: <a rel="previous" accesskey="p" href="Grundlagen-zur-Benutzerauthentifizierung.html#Grundlagen-zur-Benutzerauthentifizierung">Grundlagen zur Benutzerauthentifizierung</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>Aktuelle Hinweise - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="index.html#Top" title="Top">
<link rel="next" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete" title="Benötigte Software und Pakete">
</head>
<body>
<div class="node">
-<p>
<a name="Aktuelle-Hinweise"></a>
-nächstes: <a rel="next" accesskey="n" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete">Benötigte Software und Pakete</a>,
-voriges: <a rel="previous" accesskey="p" href="index.html#Top">Top</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete">Benötigte Software und Pakete</a>,
+Previous: <a rel="previous" accesskey="p" href="index.html#Top">Top</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Anlegen der Authentifizierungsdatenbank - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="prev" href="Name-des-Session_002dCookies.html#Name-des-Session_002dCookies" title="Name des Session-Cookies">
</head>
<body>
<div class="node">
-<p>
<a name="Anlegen-der-Authentifizierungsdatenbank"></a>
-voriges: <a rel="previous" accesskey="p" href="Name-des-Session_002dCookies.html#Name-des-Session_002dCookies">Name des Session-Cookies</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Previous: <a rel="previous" accesskey="p" href="Name-des-Session_002dCookies.html#Name-des-Session_002dCookies">Name des Session-Cookies</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>Anpassung der PostgreSQL-Konfiguration - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes" title="Installation des Programmpaketes">
<link rel="next" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration" title="Apache-Konfiguration">
</head>
<body>
<div class="node">
-<p>
<a name="Anpassung-der-PostgreSQL-Konfiguration"></a>
<a name="Anpassung-der-PostgreSQL_002dKonfiguration"></a>
-nächstes: <a rel="next" accesskey="n" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration">Apache-Konfiguration</a>,
-voriges: <a rel="previous" accesskey="p" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes">Installation des Programmpaketes</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration">Apache-Konfiguration</a>,
+Previous: <a rel="previous" accesskey="p" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes">Installation des Programmpaketes</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Apache-Konfiguration - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
<link rel="next" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
</head>
<body>
<div class="node">
-<p>
<a name="Apache-Konfiguration"></a>
<a name="Apache_002dKonfiguration"></a>
-nächstes: <a rel="next" accesskey="n" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>,
-voriges: <a rel="previous" accesskey="p" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>,
+Previous: <a rel="previous" accesskey="p" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Authentifizierungsdatenbank - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="prev" href="Administratorpasswort.html#Administratorpasswort" title="Administratorpasswort">
</head>
<body>
<div class="node">
-<p>
<a name="Authentifizierungsdatenbank"></a>
-nächstes: <a rel="next" accesskey="n" href="Passwort_00c3_00bcberpr_00c3_00bcfung.html#Passwort_00c3_00bcberpr_00c3_00bcfung">Passwortüberprüfung</a>,
-voriges: <a rel="previous" accesskey="p" href="Administratorpasswort.html#Administratorpasswort">Administratorpasswort</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Passwort_00c3_00bcberpr_00c3_00bcfung.html#Passwort_00c3_00bcberpr_00c3_00bcfung">Passwortüberprüfung</a>,
+Previous: <a rel="previous" accesskey="p" href="Administratorpasswort.html#Administratorpasswort">Administratorpasswort</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>Benötigte Software und Pakete - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Aktuelle-Hinweise.html#Aktuelle-Hinweise" title="Aktuelle Hinweise">
<link rel="next" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes" title="Installation des Programmpaketes">
</head>
<body>
<div class="node">
-<p>
<a name="Ben%c3%b6tigte-Software-und-Pakete"></a>
<a name="Ben_00c3_00b6tigte-Software-und-Pakete"></a>
-nächstes: <a rel="next" accesskey="n" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes">Installation des Programmpaketes</a>,
-voriges: <a rel="previous" accesskey="p" href="Aktuelle-Hinweise.html#Aktuelle-Hinweise">Aktuelle Hinweise</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Installation-des-Programmpaketes.html#Installation-des-Programmpaketes">Installation des Programmpaketes</a>,
+Previous: <a rel="previous" accesskey="p" href="Aktuelle-Hinweise.html#Aktuelle-Hinweise">Aktuelle Hinweise</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<li>DBI
<li>DBD::Pg
<li>Email::Address
-<li>IO::Wrap (aus dem Paket IO::Stringy)
<li>List::MoreUtils
<li>PDF::API2
<li>Template
<title>Benutzer anlegen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="prev" href="Gruppen-anlegen.html#Gruppen-anlegen" title="Gruppen anlegen">
</head>
<body>
<div class="node">
-<p>
<a name="Benutzer-anlegen"></a>
-nächstes: <a rel="next" accesskey="n" href="Gruppenmitgliedschaften-verwalten.html#Gruppenmitgliedschaften-verwalten">Gruppenmitgliedschaften verwalten</a>,
-voriges: <a rel="previous" accesskey="p" href="Gruppen-anlegen.html#Gruppen-anlegen">Gruppen anlegen</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Gruppenmitgliedschaften-verwalten.html#Gruppenmitgliedschaften-verwalten">Gruppenmitgliedschaften verwalten</a>,
+Previous: <a rel="previous" accesskey="p" href="Gruppen-anlegen.html#Gruppen-anlegen">Gruppen anlegen</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Benutzer- und Gruppenverwaltung - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="next" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen" title="OpenDocument-Vorlagen">
</head>
<body>
<div class="node">
-<p>
<a name="Benutzer--und-Gruppenverwaltung"></a>
<a name="Benutzer_002d-und-Gruppenverwaltung"></a>
-nächstes: <a rel="next" accesskey="n" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen">OpenDocument-Vorlagen</a>,
-voriges: <a rel="previous" accesskey="p" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen">OpenDocument-Vorlagen</a>,
+Previous: <a rel="previous" accesskey="p" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Benutzerauthentifizierung und Administratorpasswort - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration" title="Apache-Konfiguration">
<link rel="next" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
</head>
<body>
<div class="node">
-<p>
<a name="Benutzerauthentifizierung-und-Administratorpasswort"></a>
-nächstes: <a rel="next" accesskey="n" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>,
-voriges: <a rel="previous" accesskey="p" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration">Apache-Konfiguration</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>,
+Previous: <a rel="previous" accesskey="p" href="Apache_002dKonfiguration.html#Apache_002dKonfiguration">Apache-Konfiguration</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Datenbankbenutzer anlegen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
<link rel="prev" href="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html#Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren" title="Erweiterung für servergespeicherte Prozeduren">
</head>
<body>
<div class="node">
-<p>
<a name="Datenbankbenutzer-anlegen"></a>
-voriges: <a rel="previous" accesskey="p" href="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html#Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren">Erweiterung für servergespeicherte Prozeduren</a>,
-aufwärts: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
+<p>
+Previous: <a rel="previous" accesskey="p" href="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html#Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren">Erweiterung für servergespeicherte Prozeduren</a>,
+Up: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
<hr>
</div>
<title>Datenbanken anlegen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="prev" href="Zusammenh_00c3_00a4nge.html#Zusammenh_00c3_00a4nge" title="Zusammenhänge">
</head>
<body>
<div class="node">
-<p>
<a name="Datenbanken-anlegen"></a>
-nächstes: <a rel="next" accesskey="n" href="Gruppen-anlegen.html#Gruppen-anlegen">Gruppen anlegen</a>,
-voriges: <a rel="previous" accesskey="p" href="Zusammenh_00c3_00a4nge.html#Zusammenh_00c3_00a4nge">Zusammenhänge</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Gruppen-anlegen.html#Gruppen-anlegen">Gruppen anlegen</a>,
+Previous: <a rel="previous" accesskey="p" href="Zusammenh_00c3_00a4nge.html#Zusammenh_00c3_00a4nge">Zusammenhänge</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Erweiterung für servergespeicherte Prozeduren - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
<link rel="prev" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien" title="Änderungen an Konfigurationsdateien">
</head>
<body>
<div class="node">
-<p>
<a name="Erweiterung-f%c3%bcr-servergespeicherte-Prozeduren"></a>
<a name="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren"></a>
-nächstes: <a rel="next" accesskey="n" href="Datenbankbenutzer-anlegen.html#Datenbankbenutzer-anlegen">Datenbankbenutzer anlegen</a>,
-voriges: <a rel="previous" accesskey="p" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien">Änderungen an Konfigurationsdateien</a>,
-aufwärts: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Datenbankbenutzer-anlegen.html#Datenbankbenutzer-anlegen">Datenbankbenutzer anlegen</a>,
+Previous: <a rel="previous" accesskey="p" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien">Änderungen an Konfigurationsdateien</a>,
+Up: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
<hr>
</div>
<title>Grundlagen zur Benutzerauthentifizierung - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="next" href="Administratorpasswort.html#Administratorpasswort" title="Administratorpasswort">
</head>
<body>
<div class="node">
-<p>
<a name="Grundlagen-zur-Benutzerauthentifizierung"></a>
-nächstes: <a rel="next" accesskey="n" href="Administratorpasswort.html#Administratorpasswort">Administratorpasswort</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Administratorpasswort.html#Administratorpasswort">Administratorpasswort</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>Gruppen anlegen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="prev" href="Datenbanken-anlegen.html#Datenbanken-anlegen" title="Datenbanken anlegen">
</head>
<body>
<div class="node">
-<p>
<a name="Gruppen-anlegen"></a>
-nächstes: <a rel="next" accesskey="n" href="Benutzer-anlegen.html#Benutzer-anlegen">Benutzer anlegen</a>,
-voriges: <a rel="previous" accesskey="p" href="Datenbanken-anlegen.html#Datenbanken-anlegen">Datenbanken anlegen</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Benutzer-anlegen.html#Benutzer-anlegen">Benutzer anlegen</a>,
+Previous: <a rel="previous" accesskey="p" href="Datenbanken-anlegen.html#Datenbanken-anlegen">Datenbanken anlegen</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Gruppenmitgliedschaften verwalten - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="prev" href="Benutzer-anlegen.html#Benutzer-anlegen" title="Benutzer anlegen">
</head>
<body>
<div class="node">
-<p>
<a name="Gruppenmitgliedschaften-verwalten"></a>
-nächstes: <a rel="next" accesskey="n" href="Migration-alter-Installationen.html#Migration-alter-Installationen">Migration alter Installationen</a>,
-voriges: <a rel="previous" accesskey="p" href="Benutzer-anlegen.html#Benutzer-anlegen">Benutzer anlegen</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Migration-alter-Installationen.html#Migration-alter-Installationen">Migration alter Installationen</a>,
+Previous: <a rel="previous" accesskey="p" href="Benutzer-anlegen.html#Benutzer-anlegen">Benutzer anlegen</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Installation des Programmpaketes - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete" title="Benötigte Software und Pakete">
<link rel="next" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
</head>
<body>
<div class="node">
-<p>
<a name="Installation-des-Programmpaketes"></a>
-nächstes: <a rel="next" accesskey="n" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>,
-voriges: <a rel="previous" accesskey="p" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete">Benötigte Software und Pakete</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>,
+Previous: <a rel="previous" accesskey="p" href="Ben_00c3_00b6tigte-Software-und-Pakete.html#Ben_00c3_00b6tigte-Software-und-Pakete">Benötigte Software und Pakete</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Lx-Office ERP verwenden - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen" title="OpenDocument-Vorlagen">
<link href="http://www.gnu.org/software/texinfo/" rel="generator-home" title="Texinfo Homepage">
</head>
<body>
<div class="node">
-<p>
<a name="Lx-Office-ERP-verwenden"></a>
<a name="Lx_002dOffice-ERP-verwenden"></a>
-voriges: <a rel="previous" accesskey="p" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen">OpenDocument-Vorlagen</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Previous: <a rel="previous" accesskey="p" href="OpenDocument_002dVorlagen.html#OpenDocument_002dVorlagen">OpenDocument-Vorlagen</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<title>Migration alter Installationen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="prev" href="Gruppenmitgliedschaften-verwalten.html#Gruppenmitgliedschaften-verwalten" title="Gruppenmitgliedschaften verwalten">
</head>
<body>
<div class="node">
-<p>
<a name="Migration-alter-Installationen"></a>
-voriges: <a rel="previous" accesskey="p" href="Gruppenmitgliedschaften-verwalten.html#Gruppenmitgliedschaften-verwalten">Gruppenmitgliedschaften verwalten</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Previous: <a rel="previous" accesskey="p" href="Gruppenmitgliedschaften-verwalten.html#Gruppenmitgliedschaften-verwalten">Gruppenmitgliedschaften verwalten</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Name des Session-Cookies - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="prev" href="Passwort_00c3_00bcberpr_00c3_00bcfung.html#Passwort_00c3_00bcberpr_00c3_00bcfung" title="Passwortüberprüfung">
</head>
<body>
<div class="node">
-<p>
<a name="Name-des-Session-Cookies"></a>
<a name="Name-des-Session_002dCookies"></a>
-nächstes: <a rel="next" accesskey="n" href="Anlegen-der-Authentifizierungsdatenbank.html#Anlegen-der-Authentifizierungsdatenbank">Anlegen der Authentifizierungsdatenbank</a>,
-voriges: <a rel="previous" accesskey="p" href="Passwort_00c3_00bcberpr_00c3_00bcfung.html#Passwort_00c3_00bcberpr_00c3_00bcfung">Passwortüberprüfung</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Anlegen-der-Authentifizierungsdatenbank.html#Anlegen-der-Authentifizierungsdatenbank">Anlegen der Authentifizierungsdatenbank</a>,
+Previous: <a rel="previous" accesskey="p" href="Passwort_00c3_00bcberpr_00c3_00bcfung.html#Passwort_00c3_00bcberpr_00c3_00bcfung">Passwortüberprüfung</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>OpenDocument-Vorlagen - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="prev" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="next" href="Lx_002dOffice-ERP-verwenden.html#Lx_002dOffice-ERP-verwenden" title="Lx-Office ERP verwenden">
</head>
<body>
<div class="node">
-<p>
<a name="OpenDocument-Vorlagen"></a>
<a name="OpenDocument_002dVorlagen"></a>
-nächstes: <a rel="next" accesskey="n" href="Lx_002dOffice-ERP-verwenden.html#Lx_002dOffice-ERP-verwenden">Lx-Office ERP verwenden</a>,
-voriges: <a rel="previous" accesskey="p" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>,
-aufwärts: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Lx_002dOffice-ERP-verwenden.html#Lx_002dOffice-ERP-verwenden">Lx-Office ERP verwenden</a>,
+Previous: <a rel="previous" accesskey="p" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>,
+Up: <a rel="up" accesskey="u" href="index.html#Top">Top</a>
<hr>
</div>
<p>Weiterhin muss in der Datei <code>config/lx-erp.conf</code> die Variable
<code>$dbcharset</code> auf die Zeichenkodierung gesetzt werden, die auch
bei der Speicherung der Daten in der Datenbank verwendet wird. Diese
-ist in den meisten Fällen "ISO-8859-15".
+ist in den meisten Fällen "UTF-8".
<p>Während die Erzeugung von reinen OpenDocument-Dateien keinerlei
weitere Software benötigt, wird zur Umwandlung dieser Dateien in PDF
<title>Passwortüberprüfung - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort" title="Benutzerauthentifizierung und Administratorpasswort">
<link rel="prev" href="Authentifizierungsdatenbank.html#Authentifizierungsdatenbank" title="Authentifizierungsdatenbank">
</head>
<body>
<div class="node">
-<p>
<a name="Passwort%c3%bcberpr%c3%bcfung"></a>
<a name="Passwort_00c3_00bcberpr_00c3_00bcfung"></a>
-nächstes: <a rel="next" accesskey="n" href="Name-des-Session_002dCookies.html#Name-des-Session_002dCookies">Name des Session-Cookies</a>,
-voriges: <a rel="previous" accesskey="p" href="Authentifizierungsdatenbank.html#Authentifizierungsdatenbank">Authentifizierungsdatenbank</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Name-des-Session_002dCookies.html#Name-des-Session_002dCookies">Name des Session-Cookies</a>,
+Previous: <a rel="previous" accesskey="p" href="Authentifizierungsdatenbank.html#Authentifizierungsdatenbank">Authentifizierungsdatenbank</a>,
+Up: <a rel="up" accesskey="u" href="Benutzerauthentifizierung-und-Administratorpasswort.html#Benutzerauthentifizierung-und-Administratorpasswort">Benutzerauthentifizierung und Administratorpasswort</a>
<hr>
</div>
<title>Zeichensätze/die Verwendung von UTF-8 - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
<link rel="next" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien" title="Änderungen an Konfigurationsdateien">
</head>
<body>
<div class="node">
-<p>
<a name="Zeichens%c3%a4tze%2fdie-Verwendung-von-UTF-8"></a>
<a name="Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8"></a>
-nächstes: <a rel="next" accesskey="n" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien">Änderungen an Konfigurationsdateien</a>,
-aufwärts: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
+<p>
+Next: <a rel="next" accesskey="n" href="_00c3_0084nderungen-an-Konfigurationsdateien.html#g_t_00c3_0084nderungen-an-Konfigurationsdateien">Änderungen an Konfigurationsdateien</a>,
+Up: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
<hr>
</div>
<title>Zusammenhänge - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung" title="Benutzer- und Gruppenverwaltung">
<link rel="next" href="Datenbanken-anlegen.html#Datenbanken-anlegen" title="Datenbanken anlegen">
</head>
<body>
<div class="node">
-<p>
<a name="Zusammenh%c3%a4nge"></a>
<a name="Zusammenh_00c3_00a4nge"></a>
-nächstes: <a rel="next" accesskey="n" href="Datenbanken-anlegen.html#Datenbanken-anlegen">Datenbanken anlegen</a>,
-aufwärts: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Datenbanken-anlegen.html#Datenbanken-anlegen">Datenbanken anlegen</a>,
+Up: <a rel="up" accesskey="u" href="Benutzer_002d-und-Gruppenverwaltung.html#Benutzer_002d-und-Gruppenverwaltung">Benutzer- und Gruppenverwaltung</a>
<hr>
</div>
<title>Änderungen an Konfigurationsdateien - Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="index.html#Top">
<link rel="up" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration" title="Anpassung der PostgreSQL-Konfiguration">
<link rel="prev" href="Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8.html#Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8" title="Zeichensätze/die Verwendung von UTF-8">
</head>
<body>
<div class="node">
-<p>
<a name="%c3%84nderungen-an-Konfigurationsdateien"></a>
<a name="g_t_00c3_0084nderungen-an-Konfigurationsdateien"></a>
-nächstes: <a rel="next" accesskey="n" href="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html#Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren">Erweiterung für servergespeicherte Prozeduren</a>,
-voriges: <a rel="previous" accesskey="p" href="Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8.html#Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8">Zeichensätze/die Verwendung von UTF-8</a>,
-aufwärts: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html#Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren">Erweiterung für servergespeicherte Prozeduren</a>,
+Previous: <a rel="previous" accesskey="p" href="Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8.html#Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8">Zeichensätze/die Verwendung von UTF-8</a>,
+Up: <a rel="up" accesskey="u" href="Anpassung-der-PostgreSQL_002dKonfiguration.html#Anpassung-der-PostgreSQL_002dKonfiguration">Anpassung der PostgreSQL-Konfiguration</a>
<hr>
</div>
<title>Lx-Office Installationsanleitung</title>
<meta http-equiv="Content-Type" content="text/html">
<meta name="description" content="Lx-Office Installationsanleitung">
-<meta name="generator" content="makeinfo 4.11">
+<meta name="generator" content="makeinfo 4.13">
<link title="Top" rel="start" href="#Top">
<link href="http://www.gnu.org/software/texinfo/" rel="generator-home" title="Texinfo Homepage">
<meta http-equiv="Content-Style-Type" content="text/css">
<div class="node">
-<p>
<a name="Top"></a>
-nächstes: <a rel="next" accesskey="n" href="Aktuelle-Hinweise.html#Aktuelle-Hinweise">Aktuelle Hinweise</a>,
-aufwärts: <a rel="up" accesskey="u" href="../index.html#dir">(dir)</a>
+<p>
+Next: <a rel="next" accesskey="n" href="Aktuelle-Hinweise.html#Aktuelle-Hinweise">Aktuelle Hinweise</a>,
+Up: <a rel="up" accesskey="u" href="../index.html#dir">(dir)</a>
<hr>
</div>
neu hinzugekommen:
- Achive::Zip
-- IO::Wrap (aus dem Paket "IO::Stringy")
- Template
- Text::CSV_XS
- Text::Iconv
1 Zusammenfassung
2 Bedienung
3 Exceltemplate Syntax
-4 Einschränkungen
+4 Einschränkungen
---------------
Dieses Dokument beschreibt den Mechanismus, mit dem Exceltemplates abgearbeitet
-werden, und die Einschränkungen die damit einhergehen.
+werden, und die Einschränkungen die damit einhergehen.
---------
Der Excel Mechanismus muss in der Konfigurationsdatei aktiviert werden. Die
-Konfigurationsoption heißt:
+Konfigurationsoption heißt:
$excel_templates = 1;
Eine Excelvorlage kann dann unter dem Namen einer beliebigen anderen Vorlage mit
der Endung .xls gespeichert werden. In den normalen Verkaufsmasken taucht nun
-"Excel" als auswählbares Format auf, und kann von da an bnutzt weren wie Latex
+"Excel" als auswählbares Format auf, und kann von da an bnutzt weren wie Latex
oder OpenOffice Vorlagen.
Der Sonderfall der Angebote aus der Kundenmaske ist ebenfalls eine
Einfache Syntax: <<varname>>
Wobei "<<" und ">>" die Delimiter sind. Da Excel auf festen Breiten besteht,
-kann der Tag künstlich verlängert werden, indem weitere "<" oder ">" gegefügt
+kann der Tag künstlich verlängert werden, indem weitere "<" oder ">" gegefügt
werden. Der Tag muss nicht symmetrisch sein.
Beispiel: <<<<<varname>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
-Um die Limitierung der festen Breite zu reduzieren, können weitere Variablen in
+Um die Limitierung der festen Breite zu reduzieren, können weitere Variablen in
einem Block interpoliert werden. Whitespace wird dazwishen dann erhalten.
Beispiel: <<<<<varname1 varname2 varname3>>>>>>>>>>>>>>>>>>>>>>>>>>
-Die Variablen werden interpoliert, und linksbündig mit Leerzeichen auf die
-gewünschte Länge aufgefüllt. Ist der String zu lang, werden überzählige Zeichen
+Die Variablen werden interpoliert, und linksbündig mit Leerzeichen auf die
+gewünschte Länge aufgefüllt. Ist der String zu lang, werden überzählige Zeichen
abgeschnitten.
-Es ist ausserdem möglich Daten rechtsbündig darzustellen, wenn der Block mit
-einem Leerzeichen anfängt.
+Es ist ausserdem möglich Daten rechtsbündig darzustellen, wenn der Block mit
+einem Leerzeichen anfängt.
Beispiel: <<<<<< varname>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
-würde rechtsbündig triggern. Wenn bei rechtsbündiger Ausrichtung Text
+würde rechtsbündig triggern. Wenn bei rechtsbündiger Ausrichtung Text
abgeschnitten werden muss, wird er vom linken Ende entfernt.
-Einschränkungen
+Einschränkungen
---------------
-Das Excelformat bis 2002 ist ein binäres Format, und kann nicht mit vertretbarem
-Aufwand editiert werden. Der Templatemechanismus beschränkt sich daher darauf,
+Das Excelformat bis 2002 ist ein binäres Format, und kann nicht mit vertretbarem
+Aufwand editiert werden. Der Templatemechanismus beschränkt sich daher darauf,
Textstellen _exakt_ durch einen anderen Text zu ersetzen.
Aus dem gleichen Grund sind die Templatekonstrukte <% if %> und <% foreach %>
--- /dev/null
+/*!
+ * jQuery Form Plugin
+ * version: 2.52 (07-DEC-2010)
+ * @requires jQuery v1.3.2 or later
+ *
+ * Examples and documentation at: http://malsup.com/jquery/form/
+ * Dual licensed under the MIT and GPL licenses:
+ * http://www.opensource.org/licenses/mit-license.php
+ * http://www.gnu.org/licenses/gpl.html
+ */
+;(function($) {
+
+/*
+ Usage Note:
+ -----------
+ Do not use both ajaxSubmit and ajaxForm on the same form. These
+ functions are intended to be exclusive. Use ajaxSubmit if you want
+ to bind your own submit handler to the form. For example,
+
+ $(document).ready(function() {
+ $('#myForm').bind('submit', function(e) {
+ e.preventDefault(); // <-- important
+ $(this).ajaxSubmit({
+ target: '#output'
+ });
+ });
+ });
+
+ Use ajaxForm when you want the plugin to manage all the event binding
+ for you. For example,
+
+ $(document).ready(function() {
+ $('#myForm').ajaxForm({
+ target: '#output'
+ });
+ });
+
+ When using ajaxForm, the ajaxSubmit function will be invoked for you
+ at the appropriate time.
+*/
+
+/**
+ * ajaxSubmit() provides a mechanism for immediately submitting
+ * an HTML form using AJAX.
+ */
+$.fn.ajaxSubmit = function(options) {
+ // fast fail if nothing selected (http://dev.jquery.com/ticket/2752)
+ if (!this.length) {
+ log('ajaxSubmit: skipping submit process - no element selected');
+ return this;
+ }
+
+ if (typeof options == 'function') {
+ options = { success: options };
+ }
+
+ var action = this.attr('action');
+ var url = (typeof action === 'string') ? $.trim(action) : '';
+ if (url) {
+ // clean url (don't include hash vaue)
+ url = (url.match(/^([^#]+)/)||[])[1];
+ }
+ url = url || window.location.href || '';
+
+ options = $.extend(true, {
+ url: url,
+ type: this.attr('method') || 'GET',
+ iframeSrc: /^https/i.test(window.location.href || '') ? 'javascript:false' : 'about:blank'
+ }, options);
+
+ // hook for manipulating the form data before it is extracted;
+ // convenient for use with rich editors like tinyMCE or FCKEditor
+ var veto = {};
+ this.trigger('form-pre-serialize', [this, options, veto]);
+ if (veto.veto) {
+ log('ajaxSubmit: submit vetoed via form-pre-serialize trigger');
+ return this;
+ }
+
+ // provide opportunity to alter form data before it is serialized
+ if (options.beforeSerialize && options.beforeSerialize(this, options) === false) {
+ log('ajaxSubmit: submit aborted via beforeSerialize callback');
+ return this;
+ }
+
+ var n,v,a = this.formToArray(options.semantic);
+ if (options.data) {
+ options.extraData = options.data;
+ for (n in options.data) {
+ if(options.data[n] instanceof Array) {
+ for (var k in options.data[n]) {
+ a.push( { name: n, value: options.data[n][k] } );
+ }
+ }
+ else {
+ v = options.data[n];
+ v = $.isFunction(v) ? v() : v; // if value is fn, invoke it
+ a.push( { name: n, value: v } );
+ }
+ }
+ }
+
+ // give pre-submit callback an opportunity to abort the submit
+ if (options.beforeSubmit && options.beforeSubmit(a, this, options) === false) {
+ log('ajaxSubmit: submit aborted via beforeSubmit callback');
+ return this;
+ }
+
+ // fire vetoable 'validate' event
+ this.trigger('form-submit-validate', [a, this, options, veto]);
+ if (veto.veto) {
+ log('ajaxSubmit: submit vetoed via form-submit-validate trigger');
+ return this;
+ }
+
+ var q = $.param(a);
+
+ if (options.type.toUpperCase() == 'GET') {
+ options.url += (options.url.indexOf('?') >= 0 ? '&' : '?') + q;
+ options.data = null; // data is null for 'get'
+ }
+ else {
+ options.data = q; // data is the query string for 'post'
+ }
+
+ var $form = this, callbacks = [];
+ if (options.resetForm) {
+ callbacks.push(function() { $form.resetForm(); });
+ }
+ if (options.clearForm) {
+ callbacks.push(function() { $form.clearForm(); });
+ }
+
+ // perform a load on the target only if dataType is not provided
+ if (!options.dataType && options.target) {
+ var oldSuccess = options.success || function(){};
+ callbacks.push(function(data) {
+ var fn = options.replaceTarget ? 'replaceWith' : 'html';
+ $(options.target)[fn](data).each(oldSuccess, arguments);
+ });
+ }
+ else if (options.success) {
+ callbacks.push(options.success);
+ }
+
+ options.success = function(data, status, xhr) { // jQuery 1.4+ passes xhr as 3rd arg
+ var context = options.context || options; // jQuery 1.4+ supports scope context
+ for (var i=0, max=callbacks.length; i < max; i++) {
+ callbacks[i].apply(context, [data, status, xhr || $form, $form]);
+ }
+ };
+
+ // are there files to upload?
+ var fileInputs = $('input:file', this).length > 0;
+ var mp = 'multipart/form-data';
+ var multipart = ($form.attr('enctype') == mp || $form.attr('encoding') == mp);
+
+ // options.iframe allows user to force iframe mode
+ // 06-NOV-09: now defaulting to iframe mode if file input is detected
+ if (options.iframe !== false && (fileInputs || options.iframe || multipart)) {
+ // hack to fix Safari hang (thanks to Tim Molendijk for this)
+ // see: http://groups.google.com/group/jquery-dev/browse_thread/thread/36395b7ab510dd5d
+ if (options.closeKeepAlive) {
+ $.get(options.closeKeepAlive, fileUpload);
+ }
+ else {
+ fileUpload();
+ }
+ }
+ else {
+ $.ajax(options);
+ }
+
+ // fire 'notify' event
+ this.trigger('form-submit-notify', [this, options]);
+ return this;
+
+
+ // private function for handling file uploads (hat tip to YAHOO!)
+ function fileUpload() {
+ var form = $form[0];
+
+ if ($(':input[name=submit],:input[id=submit]', form).length) {
+ // if there is an input with a name or id of 'submit' then we won't be
+ // able to invoke the submit fn on the form (at least not x-browser)
+ alert('Error: Form elements must not have name or id of "submit".');
+ return;
+ }
+
+ var s = $.extend(true, {}, $.ajaxSettings, options);
+ s.context = s.context || s;
+ var id = 'jqFormIO' + (new Date().getTime()), fn = '_'+id;
+ window[fn] = function() {
+ var f = $io.data('form-plugin-onload');
+ if (f) {
+ f();
+ window[fn] = undefined;
+ try { delete window[fn]; } catch(e){}
+ }
+ }
+ var $io = $('<iframe id="' + id + '" name="' + id + '" src="'+ s.iframeSrc +'" onload="window[\'_\'+this.id]()" />');
+ var io = $io[0];
+
+ $io.css({ position: 'absolute', top: '-1000px', left: '-1000px' });
+
+ var xhr = { // mock object
+ aborted: 0,
+ responseText: null,
+ responseXML: null,
+ status: 0,
+ statusText: 'n/a',
+ getAllResponseHeaders: function() {},
+ getResponseHeader: function() {},
+ setRequestHeader: function() {},
+ abort: function() {
+ this.aborted = 1;
+ $io.attr('src', s.iframeSrc); // abort op in progress
+ }
+ };
+
+ var g = s.global;
+ // trigger ajax global events so that activity/block indicators work like normal
+ if (g && ! $.active++) {
+ $.event.trigger("ajaxStart");
+ }
+ if (g) {
+ $.event.trigger("ajaxSend", [xhr, s]);
+ }
+
+ if (s.beforeSend && s.beforeSend.call(s.context, xhr, s) === false) {
+ if (s.global) {
+ $.active--;
+ }
+ return;
+ }
+ if (xhr.aborted) {
+ return;
+ }
+
+ var cbInvoked = false;
+ var timedOut = 0;
+
+ // add submitting element to data if we know it
+ var sub = form.clk;
+ if (sub) {
+ var n = sub.name;
+ if (n && !sub.disabled) {
+ s.extraData = s.extraData || {};
+ s.extraData[n] = sub.value;
+ if (sub.type == "image") {
+ s.extraData[n+'.x'] = form.clk_x;
+ s.extraData[n+'.y'] = form.clk_y;
+ }
+ }
+ }
+
+ // take a breath so that pending repaints get some cpu time before the upload starts
+ function doSubmit() {
+ // make sure form attrs are set
+ var t = $form.attr('target'), a = $form.attr('action');
+
+ // update form attrs in IE friendly way
+ form.setAttribute('target',id);
+ if (form.getAttribute('method') != 'POST') {
+ form.setAttribute('method', 'POST');
+ }
+ if (form.getAttribute('action') != s.url) {
+ form.setAttribute('action', s.url);
+ }
+
+ // ie borks in some cases when setting encoding
+ if (! s.skipEncodingOverride) {
+ $form.attr({
+ encoding: 'multipart/form-data',
+ enctype: 'multipart/form-data'
+ });
+ }
+
+ // support timout
+ if (s.timeout) {
+ setTimeout(function() { timedOut = true; cb(); }, s.timeout);
+ }
+
+ // add "extra" data to form if provided in options
+ var extraInputs = [];
+ try {
+ if (s.extraData) {
+ for (var n in s.extraData) {
+ extraInputs.push(
+ $('<input type="hidden" name="'+n+'" value="'+s.extraData[n]+'" />')
+ .appendTo(form)[0]);
+ }
+ }
+
+ // add iframe to doc and submit the form
+ $io.appendTo('body');
+ $io.data('form-plugin-onload', cb);
+ form.submit();
+ }
+ finally {
+ // reset attrs and remove "extra" input elements
+ form.setAttribute('action',a);
+ if(t) {
+ form.setAttribute('target', t);
+ } else {
+ $form.removeAttr('target');
+ }
+ $(extraInputs).remove();
+ }
+ }
+
+ if (s.forceSync) {
+ doSubmit();
+ }
+ else {
+ setTimeout(doSubmit, 10); // this lets dom updates render
+ }
+
+ var data, doc, domCheckCount = 50;
+
+ function cb() {
+ if (cbInvoked) {
+ return;
+ }
+
+ $io.removeData('form-plugin-onload');
+
+ var ok = true;
+ try {
+ if (timedOut) {
+ throw 'timeout';
+ }
+ // extract the server response from the iframe
+ doc = io.contentWindow ? io.contentWindow.document : io.contentDocument ? io.contentDocument : io.document;
+
+ var isXml = s.dataType == 'xml' || doc.XMLDocument || $.isXMLDoc(doc);
+ log('isXml='+isXml);
+ if (!isXml && window.opera && (doc.body == null || doc.body.innerHTML == '')) {
+ if (--domCheckCount) {
+ // in some browsers (Opera) the iframe DOM is not always traversable when
+ // the onload callback fires, so we loop a bit to accommodate
+ log('requeing onLoad callback, DOM not available');
+ setTimeout(cb, 250);
+ return;
+ }
+ // let this fall through because server response could be an empty document
+ //log('Could not access iframe DOM after mutiple tries.');
+ //throw 'DOMException: not available';
+ }
+
+ //log('response detected');
+ cbInvoked = true;
+ xhr.responseText = doc.documentElement ? doc.documentElement.innerHTML : null;
+ xhr.responseXML = doc.XMLDocument ? doc.XMLDocument : doc;
+ xhr.getResponseHeader = function(header){
+ var headers = {'content-type': s.dataType};
+ return headers[header];
+ };
+
+ var scr = /(json|script)/.test(s.dataType);
+ if (scr || s.textarea) {
+ // see if user embedded response in textarea
+ var ta = doc.getElementsByTagName('textarea')[0];
+ if (ta) {
+ xhr.responseText = ta.value;
+ }
+ else if (scr) {
+ // account for browsers injecting pre around json response
+ var pre = doc.getElementsByTagName('pre')[0];
+ var b = doc.getElementsByTagName('body')[0];
+ if (pre) {
+ xhr.responseText = pre.textContent;
+ }
+ else if (b) {
+ xhr.responseText = b.innerHTML;
+ }
+ }
+ }
+ else if (s.dataType == 'xml' && !xhr.responseXML && xhr.responseText != null) {
+ xhr.responseXML = toXml(xhr.responseText);
+ }
+ data = $.httpData(xhr, s.dataType);
+ }
+ catch(e){
+ log('error caught:',e);
+ ok = false;
+ xhr.error = e;
+ $.handleError(s, xhr, 'error', e);
+ }
+
+ if (xhr.aborted) {
+ log('upload aborted');
+ ok = false;
+ }
+
+ // ordering of these callbacks/triggers is odd, but that's how $.ajax does it
+ if (ok) {
+ s.success.call(s.context, data, 'success', xhr);
+ if (g) {
+ $.event.trigger("ajaxSuccess", [xhr, s]);
+ }
+ }
+ if (g) {
+ $.event.trigger("ajaxComplete", [xhr, s]);
+ }
+ if (g && ! --$.active) {
+ $.event.trigger("ajaxStop");
+ }
+ if (s.complete) {
+ s.complete.call(s.context, xhr, ok ? 'success' : 'error');
+ }
+
+ // clean up
+ setTimeout(function() {
+ $io.removeData('form-plugin-onload');
+ $io.remove();
+ xhr.responseXML = null;
+ }, 100);
+ }
+
+ function toXml(s, doc) {
+ if (window.ActiveXObject) {
+ doc = new ActiveXObject('Microsoft.XMLDOM');
+ doc.async = 'false';
+ doc.loadXML(s);
+ }
+ else {
+ doc = (new DOMParser()).parseFromString(s, 'text/xml');
+ }
+ return (doc && doc.documentElement && doc.documentElement.tagName != 'parsererror') ? doc : null;
+ }
+ }
+};
+
+/**
+ * ajaxForm() provides a mechanism for fully automating form submission.
+ *
+ * The advantages of using this method instead of ajaxSubmit() are:
+ *
+ * 1: This method will include coordinates for <input type="image" /> elements (if the element
+ * is used to submit the form).
+ * 2. This method will include the submit element's name/value data (for the element that was
+ * used to submit the form).
+ * 3. This method binds the submit() method to the form for you.
+ *
+ * The options argument for ajaxForm works exactly as it does for ajaxSubmit. ajaxForm merely
+ * passes the options argument along after properly binding events for submit elements and
+ * the form itself.
+ */
+$.fn.ajaxForm = function(options) {
+ // in jQuery 1.3+ we can fix mistakes with the ready state
+ if (this.length === 0) {
+ var o = { s: this.selector, c: this.context };
+ if (!$.isReady && o.s) {
+ log('DOM not ready, queuing ajaxForm');
+ $(function() {
+ $(o.s,o.c).ajaxForm(options);
+ });
+ return this;
+ }
+ // is your DOM ready? http://docs.jquery.com/Tutorials:Introducing_$(document).ready()
+ log('terminating; zero elements found by selector' + ($.isReady ? '' : ' (DOM not ready)'));
+ return this;
+ }
+
+ return this.ajaxFormUnbind().bind('submit.form-plugin', function(e) {
+ if (!e.isDefaultPrevented()) { // if event has been canceled, don't proceed
+ e.preventDefault();
+ $(this).ajaxSubmit(options);
+ }
+ }).bind('click.form-plugin', function(e) {
+ var target = e.target;
+ var $el = $(target);
+ if (!($el.is(":submit,input:image"))) {
+ // is this a child element of the submit el? (ex: a span within a button)
+ var t = $el.closest(':submit');
+ if (t.length == 0) {
+ return;
+ }
+ target = t[0];
+ }
+ var form = this;
+ form.clk = target;
+ if (target.type == 'image') {
+ if (e.offsetX != undefined) {
+ form.clk_x = e.offsetX;
+ form.clk_y = e.offsetY;
+ } else if (typeof $.fn.offset == 'function') { // try to use dimensions plugin
+ var offset = $el.offset();
+ form.clk_x = e.pageX - offset.left;
+ form.clk_y = e.pageY - offset.top;
+ } else {
+ form.clk_x = e.pageX - target.offsetLeft;
+ form.clk_y = e.pageY - target.offsetTop;
+ }
+ }
+ // clear form vars
+ setTimeout(function() { form.clk = form.clk_x = form.clk_y = null; }, 100);
+ });
+};
+
+// ajaxFormUnbind unbinds the event handlers that were bound by ajaxForm
+$.fn.ajaxFormUnbind = function() {
+ return this.unbind('submit.form-plugin click.form-plugin');
+};
+
+/**
+ * formToArray() gathers form element data into an array of objects that can
+ * be passed to any of the following ajax functions: $.get, $.post, or load.
+ * Each object in the array has both a 'name' and 'value' property. An example of
+ * an array for a simple login form might be:
+ *
+ * [ { name: 'username', value: 'jresig' }, { name: 'password', value: 'secret' } ]
+ *
+ * It is this array that is passed to pre-submit callback functions provided to the
+ * ajaxSubmit() and ajaxForm() methods.
+ */
+$.fn.formToArray = function(semantic) {
+ var a = [];
+ if (this.length === 0) {
+ return a;
+ }
+
+ var form = this[0];
+ var els = semantic ? form.getElementsByTagName('*') : form.elements;
+ if (!els) {
+ return a;
+ }
+
+ var i,j,n,v,el,max,jmax;
+ for(i=0, max=els.length; i < max; i++) {
+ el = els[i];
+ n = el.name;
+ if (!n) {
+ continue;
+ }
+
+ if (semantic && form.clk && el.type == "image") {
+ // handle image inputs on the fly when semantic == true
+ if(!el.disabled && form.clk == el) {
+ a.push({name: n, value: $(el).val()});
+ a.push({name: n+'.x', value: form.clk_x}, {name: n+'.y', value: form.clk_y});
+ }
+ continue;
+ }
+
+ v = $.fieldValue(el, true);
+ if (v && v.constructor == Array) {
+ for(j=0, jmax=v.length; j < jmax; j++) {
+ a.push({name: n, value: v[j]});
+ }
+ }
+ else if (v !== null && typeof v != 'undefined') {
+ a.push({name: n, value: v});
+ }
+ }
+
+ if (!semantic && form.clk) {
+ // input type=='image' are not found in elements array! handle it here
+ var $input = $(form.clk), input = $input[0];
+ n = input.name;
+ if (n && !input.disabled && input.type == 'image') {
+ a.push({name: n, value: $input.val()});
+ a.push({name: n+'.x', value: form.clk_x}, {name: n+'.y', value: form.clk_y});
+ }
+ }
+ return a;
+};
+
+/**
+ * Serializes form data into a 'submittable' string. This method will return a string
+ * in the format: name1=value1&name2=value2
+ */
+$.fn.formSerialize = function(semantic) {
+ //hand off to jQuery.param for proper encoding
+ return $.param(this.formToArray(semantic));
+};
+
+/**
+ * Serializes all field elements in the jQuery object into a query string.
+ * This method will return a string in the format: name1=value1&name2=value2
+ */
+$.fn.fieldSerialize = function(successful) {
+ var a = [];
+ this.each(function() {
+ var n = this.name;
+ if (!n) {
+ return;
+ }
+ var v = $.fieldValue(this, successful);
+ if (v && v.constructor == Array) {
+ for (var i=0,max=v.length; i < max; i++) {
+ a.push({name: n, value: v[i]});
+ }
+ }
+ else if (v !== null && typeof v != 'undefined') {
+ a.push({name: this.name, value: v});
+ }
+ });
+ //hand off to jQuery.param for proper encoding
+ return $.param(a);
+};
+
+/**
+ * Returns the value(s) of the element in the matched set. For example, consider the following form:
+ *
+ * <form><fieldset>
+ * <input name="A" type="text" />
+ * <input name="A" type="text" />
+ * <input name="B" type="checkbox" value="B1" />
+ * <input name="B" type="checkbox" value="B2"/>
+ * <input name="C" type="radio" value="C1" />
+ * <input name="C" type="radio" value="C2" />
+ * </fieldset></form>
+ *
+ * var v = $(':text').fieldValue();
+ * // if no values are entered into the text inputs
+ * v == ['','']
+ * // if values entered into the text inputs are 'foo' and 'bar'
+ * v == ['foo','bar']
+ *
+ * var v = $(':checkbox').fieldValue();
+ * // if neither checkbox is checked
+ * v === undefined
+ * // if both checkboxes are checked
+ * v == ['B1', 'B2']
+ *
+ * var v = $(':radio').fieldValue();
+ * // if neither radio is checked
+ * v === undefined
+ * // if first radio is checked
+ * v == ['C1']
+ *
+ * The successful argument controls whether or not the field element must be 'successful'
+ * (per http://www.w3.org/TR/html4/interact/forms.html#successful-controls).
+ * The default value of the successful argument is true. If this value is false the value(s)
+ * for each element is returned.
+ *
+ * Note: This method *always* returns an array. If no valid value can be determined the
+ * array will be empty, otherwise it will contain one or more values.
+ */
+$.fn.fieldValue = function(successful) {
+ for (var val=[], i=0, max=this.length; i < max; i++) {
+ var el = this[i];
+ var v = $.fieldValue(el, successful);
+ if (v === null || typeof v == 'undefined' || (v.constructor == Array && !v.length)) {
+ continue;
+ }
+ v.constructor == Array ? $.merge(val, v) : val.push(v);
+ }
+ return val;
+};
+
+/**
+ * Returns the value of the field element.
+ */
+$.fieldValue = function(el, successful) {
+ var n = el.name, t = el.type, tag = el.tagName.toLowerCase();
+ if (successful === undefined) {
+ successful = true;
+ }
+
+ if (successful && (!n || el.disabled || t == 'reset' || t == 'button' ||
+ (t == 'checkbox' || t == 'radio') && !el.checked ||
+ (t == 'submit' || t == 'image') && el.form && el.form.clk != el ||
+ tag == 'select' && el.selectedIndex == -1)) {
+ return null;
+ }
+
+ if (tag == 'select') {
+ var index = el.selectedIndex;
+ if (index < 0) {
+ return null;
+ }
+ var a = [], ops = el.options;
+ var one = (t == 'select-one');
+ var max = (one ? index+1 : ops.length);
+ for(var i=(one ? index : 0); i < max; i++) {
+ var op = ops[i];
+ if (op.selected) {
+ var v = op.value;
+ if (!v) { // extra pain for IE...
+ v = (op.attributes && op.attributes['value'] && !(op.attributes['value'].specified)) ? op.text : op.value;
+ }
+ if (one) {
+ return v;
+ }
+ a.push(v);
+ }
+ }
+ return a;
+ }
+ return $(el).val();
+};
+
+/**
+ * Clears the form data. Takes the following actions on the form's input fields:
+ * - input text fields will have their 'value' property set to the empty string
+ * - select elements will have their 'selectedIndex' property set to -1
+ * - checkbox and radio inputs will have their 'checked' property set to false
+ * - inputs of type submit, button, reset, and hidden will *not* be effected
+ * - button elements will *not* be effected
+ */
+$.fn.clearForm = function() {
+ return this.each(function() {
+ $('input,select,textarea', this).clearFields();
+ });
+};
+
+/**
+ * Clears the selected form elements.
+ */
+$.fn.clearFields = $.fn.clearInputs = function() {
+ return this.each(function() {
+ var t = this.type, tag = this.tagName.toLowerCase();
+ if (t == 'text' || t == 'password' || tag == 'textarea') {
+ this.value = '';
+ }
+ else if (t == 'checkbox' || t == 'radio') {
+ this.checked = false;
+ }
+ else if (tag == 'select') {
+ this.selectedIndex = -1;
+ }
+ });
+};
+
+/**
+ * Resets the form data. Causes all form elements to be reset to their original value.
+ */
+$.fn.resetForm = function() {
+ return this.each(function() {
+ // guard against an input with the name of 'reset'
+ // note that IE reports the reset function as an 'object'
+ if (typeof this.reset == 'function' || (typeof this.reset == 'object' && !this.reset.nodeType)) {
+ this.reset();
+ }
+ });
+};
+
+/**
+ * Enables or disables any matching elements.
+ */
+$.fn.enable = function(b) {
+ if (b === undefined) {
+ b = true;
+ }
+ return this.each(function() {
+ this.disabled = !b;
+ });
+};
+
+/**
+ * Checks/unchecks any matching checkboxes or radio buttons and
+ * selects/deselects and matching option elements.
+ */
+$.fn.selected = function(select) {
+ if (select === undefined) {
+ select = true;
+ }
+ return this.each(function() {
+ var t = this.type;
+ if (t == 'checkbox' || t == 'radio') {
+ this.checked = select;
+ }
+ else if (this.tagName.toLowerCase() == 'option') {
+ var $sel = $(this).parent('select');
+ if (select && $sel[0] && $sel[0].type == 'select-one') {
+ // deselect all other options
+ $sel.find('option').selected(false);
+ }
+ this.selected = select;
+ }
+ });
+};
+
+// helper fn for console logging
+// set $.fn.ajaxSubmit.debug to true to enable debug logging
+function log() {
+ if ($.fn.ajaxSubmit.debug) {
+ var msg = '[jquery.form] ' + Array.prototype.join.call(arguments,'');
+ if (window.console && window.console.log) {
+ window.console.log(msg);
+ }
+ else if (window.opera && window.opera.postError) {
+ window.opera.postError(msg);
+ }
+ }
+};
+
+})(jQuery);
-jquery/jquery-1.3.2.min.js
\ No newline at end of file
+jquery/jquery-1.4.4.min.js
\ No newline at end of file
--- /dev/null
+/*
+ * multiselect2side jQuery plugin
+ *
+ * Copyright (c) 2010 Giovanni Casassa (senamion.com - senamion.it)
+ *
+ * Dual licensed under the MIT (MIT-LICENSE.txt)
+ * and GPL (GPL-LICENSE.txt) licenses.
+ *
+ * http://www.senamion.com
+ *
+ */
+
+(function($) {
+ jQuery.fn.multiselect2side = function (o) {
+ o = $.extend({
+ selectedPosition: 'right',
+ moveOptions: true,
+ labelTop: 'Top',
+ labelBottom: 'Bottom',
+ labelUp: 'Up',
+ labelDown: 'Down',
+ labelSort: 'Sort',
+ labelsx: 'Available',
+ labeldx: 'Selected',
+ maxSelected: -1,
+ leftSel: null,
+ rightSel: null,
+
+ sortOptions: function() {
+ o.leftSel.sortOptions();
+ o.rightSel.sortOptions();
+ }
+ }, o);
+
+ return this.each(function () {
+ var el = $(this);
+
+ var hiddenName = $(this).attr("name");
+ var originalName = $(this).attr("name");
+ if (originalName.indexOf('[') != -1)
+ originalName = originalName.substring(0, originalName.indexOf('['));
+
+ var nameDx = originalName + "ms2side__dx";
+ var idDx = originalName + "ms2side__dx";
+ var nameSx = originalName + "ms2side__sx";
+ var hiddenId = originalName + "ms2side_hidden";
+ var size = $(this).attr("size");
+ $(this).attr("name", originalName + "ms2side__orig");
+ // SIZE MIN
+ if (size < 6) {
+ $(this).attr("size", "6");
+ size = 6;
+ }
+
+ // UP AND DOWN
+ var divUpDown =
+ "<div class='ms2side__updown'>" +
+ "<p class='SelSort' title='Sort'>" + o.labelSort + "</p>" +
+ "<p class='MoveTop' title='Move on top selected option'>" + o.labelTop + "</p>" +
+ "<p class='MoveUp' title='Move up selected option'>" + o.labelUp + "</p>" +
+ "<p class='MoveDown' title='Move down selected option'>" + o.labelDown + "</p>" +
+ "<p class='MoveBottom' title='Move on bottom selected option'>" + o.labelBottom + "</p>" +
+ "</div>";
+
+ // CREATE NEW ELEMENT (AND HIDE IT) AFTER THE HIDDED ORGINAL SELECT
+ var htmlToAdd =
+ "<div class='ms2side__div'>" +
+ ((o.selectedPosition != 'right' && o.moveOptions) ? divUpDown : "") +
+ "<div class='ms2side__select'>" +
+ (o.labelsx ? ("<div class='ms2side__header'>" + o.labelsx + "</div>") : "") +
+ "<select title='" + o.labelsx + "' name='" + nameSx + "' id='" + nameSx + "' size='" + size + "' multiple='multiple' ></select>" +
+ "</div>" +
+ "<div class='ms2side__options'>" +
+ ((o.selectedPosition == 'right')
+ ?
+ ("<p class='AddOne' title='Add Selected'>›</p>" +
+ "<p class='AddAll' title='Add All'>»</p>" +
+ "<p class='RemoveOne' title='Remove Selected'>‹</p>" +
+ "<p class='RemoveAll' title='Remove All'>«</p>")
+ :
+ ("<p class='AddOne' title='Add Selected'>‹</p>" +
+ "<p class='AddAll' title='Add All'>«</p>" +
+ "<p class='RemoveOne' title='Remove Selected'>›</p>" +
+ "<p class='RemoveAll' title='Remove All'>»</p>")
+ ) +
+ "</div>" +
+ "<div class='ms2side__select'>" +
+ (o.labeldx ? ("<div class='ms2side__header'>" + o.labeldx + "</div>") : "") +
+ "<select title='" + o.labeldx + "' name='" + nameDx + "' id='" + idDx + "' size='" + size + "' multiple='multiple' ></select>" +
+ "</div>" +
+ "<span id=\"" + hiddenId + "\"></span>" +
+ ((o.selectedPosition == 'right' && o.moveOptions) ? divUpDown : "") +
+ "</div>";
+ $(this).after(htmlToAdd).hide();
+ $("#" + hiddenId).hide();
+
+ // ELEMENTS
+ var allSel = $(this).next().find("select");
+ var leftSel = (o.selectedPosition == 'right') ? allSel.eq(0) : allSel.eq(1);
+ var rightSel = (o.selectedPosition == 'right') ? allSel.eq(1) : allSel.eq(0);
+ // HEIGHT DIV
+ var heightDiv = $(".ms2side__select").eq(0).height();
+ o.leftSel = leftSel;
+ o.rightSel = rightSel;
+
+ // CENTER MOVE OPTIONS AND UPDOWN OPTIONS
+ $(this).next().find('.ms2side__options, .ms2side__updown').each(function(){
+ var top = ((heightDiv/2) - ($(this).height()/2));
+ if (top > 0)
+ $(this).css('padding-top', top + 'px' );
+ });
+
+ // MOVE SELECTED OPTION TO RIGHT, NOT SELECTED TO LEFT
+ $(this).find("option:selected").clone().appendTo(rightSel);
+ $(this).find("option:not(:selected)").clone().appendTo(leftSel);
+
+ // Mark all unselected.
+ rightSel.find("option").attr("selected", false);
+
+ // ON CHANGE REFRESH ALL BUTTON STATUS
+ allSel.change(function() {
+ var div = $(this).parent().parent();
+ var selectSx = leftSel.children();
+ var selectDx = rightSel.children();
+ var selectedSx = leftSel.find("option:selected");
+ var selectedDx = rightSel.find("option:selected");
+ var hiddenCont = $("#" + hiddenId);
+
+ if (selectedSx.size() == 0 || (o.maxSelected >= 0 && (selectedSx.size() + selectDx.size()) > o.maxSelected))
+ div.find(".AddOne").addClass('ms2side__hide');
+ else
+ div.find(".AddOne").removeClass('ms2side__hide');
+
+ // FIRST HIDE ALL
+ div.find(".RemoveOne, .MoveUp, .MoveDown, .MoveTop, .MoveBottom, .SelSort").addClass('ms2side__hide');
+ // if (selectDx.size() > 1)
+ // div.find(".SelSort").removeClass('ms2side__hide');
+ if (selectedDx.size() > 0) {
+ div.find(".RemoveOne").removeClass('ms2side__hide');
+ // // ALL SELECTED - NO MOVE
+ // if (selectedDx.size() < selectDx.size()) { // FOR NOW (JOE) && selectedDx.size() == 1
+ // if (selectedDx.val() != selectDx.val()) // FIRST OPTION, NO UP AND TOP BUTTON
+ // div.find(".MoveUp, .MoveTop").removeClass('ms2side__hide');
+ // if (selectedDx.last().val() != selectDx.last().val()) // LAST OPTION, NO DOWN AND BOTTOM BUTTON
+ // div.find(".MoveDown, .MoveBottom").removeClass('ms2side__hide');
+ // }
+ }
+
+ if (selectSx.size() == 0 || (o.maxSelected >= 0 && selectSx.size() >= o.maxSelected))
+ div.find(".AddAll").addClass('ms2side__hide');
+ else
+ div.find(".AddAll").removeClass('ms2side__hide');
+
+ if (selectDx.size() == 0)
+ div.find(".RemoveAll").addClass('ms2side__hide');
+ else
+ div.find(".RemoveAll").removeClass('ms2side__hide');
+
+ // Rebuild hidden inputs...
+ hiddenCont.empty();
+ rightSel.find("option").each(function(idx, option) {
+ $('<input type="hidden"/>').attr("name", hiddenName).attr("value", $(option).attr("value")).appendTo(hiddenCont);
+ });
+ });
+
+ // DOUBLE CLICK ON LEFT SELECT OPTION
+ leftSel.dblclick(function () {
+ $(this).find("option:selected").each(function(i, selected){
+
+ if (o.maxSelected < 0 || rightSel.children().size() < o.maxSelected) {
+ $(this).remove().appendTo(rightSel);
+ el.find("[value=" + $(selected).val() + "]").attr("selected", true).remove().appendTo(el);
+ }
+ });
+ $(this).trigger('change');
+ o.sortOptions();
+ });
+
+ // DOUBLE CLICK ON RIGHT SELECT OPTION
+ rightSel.dblclick(function () {
+ $(this).find("option:selected").each(function(i, selected){
+ $(this).remove().appendTo(leftSel);
+ el.find("[value=" + $(selected).val() + "]").attr("selected", false).remove().appendTo(el);
+ });
+ $(this).trigger('change');
+ o.sortOptions();
+ });
+
+ // CLICK ON OPTION
+ $(this).next().find('.ms2side__options').children().click(function () {
+ if (!$(this).hasClass("ms2side__hide")) {
+ if ($(this).hasClass("AddOne")) {
+ leftSel.find("option:selected").each(function(i, selected){
+ $(this).remove().appendTo(rightSel);
+ el.find("[value=" + $(selected).val() + "]").attr("selected", true).remove().appendTo(el);
+ });
+ o.sortOptions();
+
+ } else if ($(this).hasClass("AddAll")) { // ALL SELECTED
+ leftSel.children().appendTo(rightSel);
+ leftSel.children().remove();
+ el.find('option').attr("selected", true);
+ // el.children().attr("selected", true); -- PROBLEM WITH OPTGROUP
+ o.sortOptions();
+
+ } else if ($(this).hasClass("RemoveOne")) {
+ rightSel.find("option:selected").each(function(i, selected){
+ $(this).remove().appendTo(leftSel);
+ el.find("[value=" + $(selected).val() + "]").attr("selected", false).remove().appendTo(el);
+ });
+ o.sortOptions();
+
+ } else if ($(this).hasClass("RemoveAll")) { // ALL REMOVED
+ rightSel.children().appendTo(leftSel);
+ rightSel.children().remove();
+ el.find('option').attr("selected", false);
+ //el.children().attr("selected", false); -- PROBLEM WITH OPTGROUP
+ o.sortOptions();
+ }
+ }
+
+ leftSel.trigger('change');
+ });
+
+ // CLICK ON UP - DOWN
+ $(this).next().find('.ms2side__updown').children().click(function () {
+ var selectedDx = rightSel.find("option:selected");
+ var selectDx = rightSel.find("option");
+
+ if (!$(this).hasClass("ms2side__hide")) {
+ if ($(this).hasClass("SelSort")) {
+ // SORT SELECTED ELEMENT
+ selectDx.sort(function(a, b) {
+ var compA = $(a).text().toUpperCase();
+ var compB = $(b).text().toUpperCase();
+ return (compA < compB) ? -1 : (compA > compB) ? 1 : 0;
+ })
+ // FIRST REMOVE FROM ORIGINAL SELECT
+ el.find("option:selected").remove();
+ // AFTER ADD ON ORIGINAL AND RIGHT SELECT
+ selectDx.each(function() {
+ rightSel.append($(this).clone().attr("selected", true));
+ el.append($(this).attr("selected", true));
+ });
+
+ } else if ($(this).hasClass("MoveUp")) {
+ var prev = selectedDx.first().prev();
+ var hPrev = el.find("[value=" + prev.val() + "]");
+
+ selectedDx.each(function() {
+ $(this).insertBefore(prev);
+ el.find("[value=" + $(this).val() + "]").insertBefore(hPrev); // HIDDEN SELECT
+ });
+
+ } else if ($(this).hasClass("MoveDown")) {
+ var next = selectedDx.last().next();
+ var hNext = el.find("[value=" + next.val() + "]");
+
+ selectedDx.each(function() {
+ $(this).insertAfter(next);
+ el.find("[value=" + $(this).val() + "]").insertAfter(hNext); // HIDDEN SELECT
+ });
+
+ } else if ($(this).hasClass("MoveTop")) {
+ var first = selectDx.first();
+ var hFirst = el.find("[value=" + first.val() + "]");
+
+ selectedDx.each(function() {
+ $(this).insertBefore(first);
+ el.find("[value=" + $(this).val() + "]").insertBefore(hFirst); // HIDDEN SELECT
+ });
+
+ } else if ($(this).hasClass("MoveBottom")) {
+ var last = selectDx.last();
+ var hLast = el.find("[value=" + last.val() + "]");
+
+ selectedDx.each(function() {
+ last = $(this).insertAfter(last); // WITH last = SAME POSITION OF SELECTED OPTION AFTER MOVE
+ hLast = el.find("[value=" + $(this).val() + "]").insertAfter(hLast); // HIDDEN SELECT
+ });
+ }
+ }
+
+ leftSel.trigger('change');
+ });
+
+ // HOVER ON OPTION
+ $(this).next().find('.ms2side__options, .ms2side__updown').children().hover(
+ function () {
+ $(this).addClass('ms2side_hover');
+ },
+ function () {
+ $(this).removeClass('ms2side_hover');
+ }
+ );
+
+ // UPDATE BUTTON ON START
+ leftSel.trigger('change');
+ o.sortOptions();
+ // SHOW WHEN ALL READY
+ $(this).next().show();
+ });
+ };
+})(jQuery);
--- /dev/null
+/*
+ *
+ * Copyright (c) 2006-2010 Sam Collett (http://www.texotela.co.uk)
+ * Dual licensed under the MIT (http://www.opensource.org/licenses/mit-license.php)
+ * and GPL (http://www.opensource.org/licenses/gpl-license.php) licenses.
+ *
+ * Version 2.2.5
+ * Demo: http://www.texotela.co.uk/code/jquery/select/
+ *
+ *
+ */
+
+;(function($) {
+
+/**
+ * Adds (single/multiple) options to a select box (or series of select boxes)
+ *
+ * @name addOption
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @example $("#myselect").addOption("Value", "Text"); // add single value (will be selected)
+ * @example $("#myselect").addOption("Value 2", "Text 2", false); // add single value (won't be selected)
+ * @example $("#myselect").addOption({"foo":"bar","bar":"baz"}, false); // add multiple values, but don't select
+ *
+ */
+$.fn.addOption = function()
+{
+ var add = function(el, v, t, sO, index)
+ {
+ var option = document.createElement("option");
+ option.value = v, option.text = t;
+ // get options
+ var o = el.options;
+ // get number of options
+ var oL = o.length;
+ if(!el.cache)
+ {
+ el.cache = {};
+ // loop through existing options, adding to cache
+ for(var i = 0; i < oL; i++)
+ {
+ el.cache[o[i].value] = i;
+ }
+ }
+ if (index || index == 0)
+ {
+ // we're going to insert these starting at a specific index...
+ // this has the side effect of el.cache[v] being the
+ // correct value for the typeof check below
+ var ti = option;
+ for(var ii =index; ii <= oL; ii++)
+ {
+ var tmp = el.options[ii];
+ el.options[ii] = ti;
+ o[ii] = ti;
+ el.cache[o[ii].value] = ii;
+ ti = tmp;
+ }
+ }
+
+ // add to cache if it isn't already
+ if(typeof el.cache[v] == "undefined") el.cache[v] = oL;
+ el.options[el.cache[v]] = option;
+ if(sO)
+ {
+ option.selected = true;
+ }
+ };
+
+ var a = arguments;
+ if(a.length == 0) return this;
+ // select option when added? default is true
+ var sO = true;
+ // multiple items
+ var m = false;
+ // other variables
+ var items, v, t;
+ if(typeof(a[0]) == "object")
+ {
+ m = true;
+ items = a[0];
+ }
+ if(a.length >= 2)
+ {
+ if(typeof(a[1]) == "boolean")
+ {
+ sO = a[1];
+ startindex = a[2];
+ }
+ else if(typeof(a[2]) == "boolean")
+ {
+ sO = a[2];
+ startindex = a[1];
+ }
+ else
+ {
+ startindex = a[1];
+ }
+ if(!m)
+ {
+ v = a[0];
+ t = a[1];
+ }
+ }
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return;
+ if(m)
+ {
+ for(var item in items)
+ {
+ add(this, item, items[item], sO, startindex);
+ startindex += 1;
+ }
+ }
+ else
+ {
+ add(this, v, t, sO, startindex);
+ }
+ }
+ );
+ return this;
+};
+
+/**
+ * Add options via ajax
+ *
+ * @name ajaxAddOption
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @param String url Page to get options from (must be valid JSON)
+ * @param Object params (optional) Any parameters to send with the request
+ * @param Boolean select (optional) Select the added options, default true
+ * @param Function fn (optional) Call this function with the select object as param after completion
+ * @param Array args (optional) Array with params to pass to the function afterwards
+ * @example $("#myselect").ajaxAddOption("myoptions.php");
+ * @example $("#myselect").ajaxAddOption("myoptions.php", {"code" : "007"});
+ * @example $("#myselect").ajaxAddOption("myoptions.php", {"code" : "007"}, false, sortoptions, [{"dir": "desc"}]);
+ *
+ */
+$.fn.ajaxAddOption = function(url, params, select, fn, args)
+{
+ if(typeof(url) != "string") return this;
+ if(typeof(params) != "object") params = {};
+ if(typeof(select) != "boolean") select = true;
+ this.each(
+ function()
+ {
+ var el = this;
+ $.getJSON(url,
+ params,
+ function(r)
+ {
+ $(el).addOption(r, select);
+ if(typeof fn == "function")
+ {
+ if(typeof args == "object")
+ {
+ fn.apply(el, args);
+ }
+ else
+ {
+ fn.call(el);
+ }
+ }
+ }
+ );
+ }
+ );
+ return this;
+};
+
+/**
+ * Removes an option (by value or index) from a select box (or series of select boxes)
+ *
+ * @name removeOption
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @param String|RegExp|Number what Option to remove
+ * @param Boolean selectedOnly (optional) Remove only if it has been selected (default false)
+ * @example $("#myselect").removeOption("Value"); // remove by value
+ * @example $("#myselect").removeOption(/^val/i); // remove options with a value starting with 'val'
+ * @example $("#myselect").removeOption(/./); // remove all options
+ * @example $("#myselect").removeOption(/./, true); // remove all options that have been selected
+ * @example $("#myselect").removeOption(0); // remove by index
+ * @example $("#myselect").removeOption(["myselect_1","myselect_2"]); // values contained in passed array
+ *
+ */
+$.fn.removeOption = function()
+{
+ var a = arguments;
+ if(a.length == 0) return this;
+ var ta = typeof(a[0]);
+ var v, index;
+ // has to be a string or regular expression (object in IE, function in Firefox)
+ if(ta == "string" || ta == "object" || ta == "function" )
+ {
+ v = a[0];
+ // if an array, remove items
+ if(v.constructor == Array)
+ {
+ var l = v.length;
+ for(var i = 0; i<l; i++)
+ {
+ this.removeOption(v[i], a[1]);
+ }
+ return this;
+ }
+ }
+ else if(ta == "number") index = a[0];
+ else return this;
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return;
+ // clear cache
+ if(this.cache) this.cache = null;
+ // does the option need to be removed?
+ var remove = false;
+ // get options
+ var o = this.options;
+ if(!!v)
+ {
+ // get number of options
+ var oL = o.length;
+ for(var i=oL-1; i>=0; i--)
+ {
+ if(v.constructor == RegExp)
+ {
+ if(o[i].value.match(v))
+ {
+ remove = true;
+ }
+ }
+ else if(o[i].value == v)
+ {
+ remove = true;
+ }
+ // if the option is only to be removed if selected
+ if(remove && a[1] === true) remove = o[i].selected;
+ if(remove)
+ {
+ o[i] = null;
+ }
+ remove = false;
+ }
+ }
+ else
+ {
+ // only remove if selected?
+ if(a[1] === true)
+ {
+ remove = o[index].selected;
+ }
+ else
+ {
+ remove = true;
+ }
+ if(remove)
+ {
+ this.remove(index);
+ }
+ }
+ }
+ );
+ return this;
+};
+
+/**
+ * Sort options (ascending or descending) in a select box (or series of select boxes)
+ *
+ * @name sortOptions
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @param Boolean ascending (optional) Sort ascending (true/undefined), or descending (false)
+ * @example // ascending
+ * $("#myselect").sortOptions(); // or $("#myselect").sortOptions(true);
+ * @example // descending
+ * $("#myselect").sortOptions(false);
+ *
+ */
+$.fn.sortOptions = function(ascending)
+{
+ // get selected values first
+ var sel = $(this).selectedValues();
+ var a = typeof(ascending) == "undefined" ? true : !!ascending;
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return;
+ // get options
+ var o = this.options;
+ // get number of options
+ var oL = o.length;
+ // create an array for sorting
+ var sA = [];
+ // loop through options, adding to sort array
+ for(var i = 0; i<oL; i++)
+ {
+ sA[i] = {
+ v: o[i].value,
+ t: o[i].text
+ }
+ }
+ // sort items in array
+ sA.sort(
+ function(o1, o2)
+ {
+ // option text is made lowercase for case insensitive sorting
+ o1t = o1.t.toLowerCase(), o2t = o2.t.toLowerCase();
+ // if options are the same, no sorting is needed
+ if(o1t == o2t) return 0;
+ if(a)
+ {
+ return o1t < o2t ? -1 : 1;
+ }
+ else
+ {
+ return o1t > o2t ? -1 : 1;
+ }
+ }
+ );
+ // change the options to match the sort array
+ for(var i = 0; i<oL; i++)
+ {
+ o[i].text = sA[i].t;
+ o[i].value = sA[i].v;
+ }
+ }
+ ).selectOptions(sel, true); // select values, clearing existing ones
+ return this;
+};
+/**
+ * Selects an option by value
+ *
+ * @name selectOptions
+ * @author Mathias Bank (http://www.mathias-bank.de), original function
+ * @author Sam Collett (http://www.texotela.co.uk), addition of regular expression matching
+ * @type jQuery
+ * @param String|RegExp|Array value Which options should be selected
+ * can be a string or regular expression, or an array of strings / regular expressions
+ * @param Boolean clear Clear existing selected options, default false
+ * @example $("#myselect").selectOptions("val1"); // with the value 'val1'
+ * @example $("#myselect").selectOptions(["val1","val2","val3"]); // with the values 'val1' 'val2' 'val3'
+ * @example $("#myselect").selectOptions(/^val/i); // with the value starting with 'val', case insensitive
+ *
+ */
+$.fn.selectOptions = function(value, clear)
+{
+ var v = value;
+ var vT = typeof(value);
+ // handle arrays
+ if(vT == "object" && v.constructor == Array)
+ {
+ var $this = this;
+ $.each(v, function()
+ {
+ $this.selectOptions(this, clear);
+ }
+ );
+ };
+ var c = clear || false;
+ // has to be a string or regular expression (object in IE, function in Firefox)
+ if(vT != "string" && vT != "function" && vT != "object") return this;
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return this;
+ // get options
+ var o = this.options;
+ // get number of options
+ var oL = o.length;
+ for(var i = 0; i<oL; i++)
+ {
+ if(v.constructor == RegExp)
+ {
+ if(o[i].value.match(v))
+ {
+ o[i].selected = true;
+ }
+ else if(c)
+ {
+ o[i].selected = false;
+ }
+ }
+ else
+ {
+ if(o[i].value == v)
+ {
+ o[i].selected = true;
+ }
+ else if(c)
+ {
+ o[i].selected = false;
+ }
+ }
+ }
+ }
+ );
+ return this;
+};
+
+/**
+ * Copy options to another select
+ *
+ * @name copyOptions
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @param String to Element to copy to
+ * @param String which (optional) Specifies which options should be copied - 'all' or 'selected'. Default is 'selected'
+ * @example $("#myselect").copyOptions("#myselect2"); // copy selected options from 'myselect' to 'myselect2'
+ * @example $("#myselect").copyOptions("#myselect2","selected"); // same as above
+ * @example $("#myselect").copyOptions("#myselect2","all"); // copy all options from 'myselect' to 'myselect2'
+ *
+ */
+$.fn.copyOptions = function(to, which)
+{
+ var w = which || "selected";
+ if($(to).size() == 0) return this;
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return this;
+ // get options
+ var o = this.options;
+ // get number of options
+ var oL = o.length;
+ for(var i = 0; i<oL; i++)
+ {
+ if(w == "all" || (w == "selected" && o[i].selected))
+ {
+ $(to).addOption(o[i].value, o[i].text);
+ }
+ }
+ }
+ );
+ return this;
+};
+
+/**
+ * Checks if a select box has an option with the supplied value
+ *
+ * @name containsOption
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type Boolean|jQuery
+ * @param String|RegExp value Which value to check for. Can be a string or regular expression
+ * @param Function fn (optional) Function to apply if an option with the given value is found.
+ * Use this if you don't want to break the chaining
+ * @example if($("#myselect").containsOption("val1")) alert("Has an option with the value 'val1'");
+ * @example if($("#myselect").containsOption(/^val/i)) alert("Has an option with the value starting with 'val'");
+ * @example $("#myselect").containsOption("val1", copyoption).doSomethingElseWithSelect(); // calls copyoption (user defined function) for any options found, chain is continued
+ *
+ */
+$.fn.containsOption = function(value, fn)
+{
+ var found = false;
+ var v = value;
+ var vT = typeof(v);
+ var fT = typeof(fn);
+ // has to be a string or regular expression (object in IE, function in Firefox)
+ if(vT != "string" && vT != "function" && vT != "object") return fT == "function" ? this: found;
+ this.each(
+ function()
+ {
+ if(this.nodeName.toLowerCase() != "select") return this;
+ // option already found
+ if(found && fT != "function") return false;
+ // get options
+ var o = this.options;
+ // get number of options
+ var oL = o.length;
+ for(var i = 0; i<oL; i++)
+ {
+ if(v.constructor == RegExp)
+ {
+ if (o[i].value.match(v))
+ {
+ found = true;
+ if(fT == "function") fn.call(o[i], i);
+ }
+ }
+ else
+ {
+ if (o[i].value == v)
+ {
+ found = true;
+ if(fT == "function") fn.call(o[i], i);
+ }
+ }
+ }
+ }
+ );
+ return fT == "function" ? this : found;
+};
+
+/**
+ * Returns values which have been selected
+ *
+ * @name selectedValues
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type Array
+ * @example $("#myselect").selectedValues();
+ *
+ */
+$.fn.selectedValues = function()
+{
+ var v = [];
+ this.selectedOptions().each(
+ function()
+ {
+ v[v.length] = this.value;
+ }
+ );
+ return v;
+};
+
+/**
+ * Returns text which has been selected
+ *
+ * @name selectedTexts
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type Array
+ * @example $("#myselect").selectedTexts();
+ *
+ */
+$.fn.selectedTexts = function()
+{
+ var t = [];
+ this.selectedOptions().each(
+ function()
+ {
+ t[t.length] = this.text;
+ }
+ );
+ return t;
+};
+
+/**
+ * Returns options which have been selected
+ *
+ * @name selectedOptions
+ * @author Sam Collett (http://www.texotela.co.uk)
+ * @type jQuery
+ * @example $("#myselect").selectedOptions();
+ *
+ */
+$.fn.selectedOptions = function()
+{
+ return this.find("option:selected");
+};
+
+})(jQuery);
\ No newline at end of file
--- /dev/null
+/*!
+ * jQuery JavaScript Library v1.4.4
+ * http://jquery.com/
+ *
+ * Copyright 2010, John Resig
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * Includes Sizzle.js
+ * http://sizzlejs.com/
+ * Copyright 2010, The Dojo Foundation
+ * Released under the MIT, BSD, and GPL Licenses.
+ *
+ * Date: Thu Nov 11 19:04:53 2010 -0500
+ */
+(function( window, undefined ) {
+
+// Use the correct document accordingly with window argument (sandbox)
+var document = window.document;
+var jQuery = (function() {
+
+// Define a local copy of jQuery
+var jQuery = function( selector, context ) {
+ // The jQuery object is actually just the init constructor 'enhanced'
+ return new jQuery.fn.init( selector, context );
+ },
+
+ // Map over jQuery in case of overwrite
+ _jQuery = window.jQuery,
+
+ // Map over the $ in case of overwrite
+ _$ = window.$,
+
+ // A central reference to the root jQuery(document)
+ rootjQuery,
+
+ // A simple way to check for HTML strings or ID strings
+ // (both of which we optimize for)
+ quickExpr = /^(?:[^<]*(<[\w\W]+>)[^>]*$|#([\w\-]+)$)/,
+
+ // Is it a simple selector
+ isSimple = /^.[^:#\[\.,]*$/,
+
+ // Check if a string has a non-whitespace character in it
+ rnotwhite = /\S/,
+ rwhite = /\s/,
+
+ // Used for trimming whitespace
+ trimLeft = /^\s+/,
+ trimRight = /\s+$/,
+
+ // Check for non-word characters
+ rnonword = /\W/,
+
+ // Check for digits
+ rdigit = /\d/,
+
+ // Match a standalone tag
+ rsingleTag = /^<(\w+)\s*\/?>(?:<\/\1>)?$/,
+
+ // JSON RegExp
+ rvalidchars = /^[\],:{}\s]*$/,
+ rvalidescape = /\\(?:["\\\/bfnrt]|u[0-9a-fA-F]{4})/g,
+ rvalidtokens = /"[^"\\\n\r]*"|true|false|null|-?\d+(?:\.\d*)?(?:[eE][+\-]?\d+)?/g,
+ rvalidbraces = /(?:^|:|,)(?:\s*\[)+/g,
+
+ // Useragent RegExp
+ rwebkit = /(webkit)[ \/]([\w.]+)/,
+ ropera = /(opera)(?:.*version)?[ \/]([\w.]+)/,
+ rmsie = /(msie) ([\w.]+)/,
+ rmozilla = /(mozilla)(?:.*? rv:([\w.]+))?/,
+
+ // Keep a UserAgent string for use with jQuery.browser
+ userAgent = navigator.userAgent,
+
+ // For matching the engine and version of the browser
+ browserMatch,
+
+ // Has the ready events already been bound?
+ readyBound = false,
+
+ // The functions to execute on DOM ready
+ readyList = [],
+
+ // The ready event handler
+ DOMContentLoaded,
+
+ // Save a reference to some core methods
+ toString = Object.prototype.toString,
+ hasOwn = Object.prototype.hasOwnProperty,
+ push = Array.prototype.push,
+ slice = Array.prototype.slice,
+ trim = String.prototype.trim,
+ indexOf = Array.prototype.indexOf,
+
+ // [[Class]] -> type pairs
+ class2type = {};
+
+jQuery.fn = jQuery.prototype = {
+ init: function( selector, context ) {
+ var match, elem, ret, doc;
+
+ // Handle $(""), $(null), or $(undefined)
+ if ( !selector ) {
+ return this;
+ }
+
+ // Handle $(DOMElement)
+ if ( selector.nodeType ) {
+ this.context = this[0] = selector;
+ this.length = 1;
+ return this;
+ }
+
+ // The body element only exists once, optimize finding it
+ if ( selector === "body" && !context && document.body ) {
+ this.context = document;
+ this[0] = document.body;
+ this.selector = "body";
+ this.length = 1;
+ return this;
+ }
+
+ // Handle HTML strings
+ if ( typeof selector === "string" ) {
+ // Are we dealing with HTML string or an ID?
+ match = quickExpr.exec( selector );
+
+ // Verify a match, and that no context was specified for #id
+ if ( match && (match[1] || !context) ) {
+
+ // HANDLE: $(html) -> $(array)
+ if ( match[1] ) {
+ doc = (context ? context.ownerDocument || context : document);
+
+ // If a single string is passed in and it's a single tag
+ // just do a createElement and skip the rest
+ ret = rsingleTag.exec( selector );
+
+ if ( ret ) {
+ if ( jQuery.isPlainObject( context ) ) {
+ selector = [ document.createElement( ret[1] ) ];
+ jQuery.fn.attr.call( selector, context, true );
+
+ } else {
+ selector = [ doc.createElement( ret[1] ) ];
+ }
+
+ } else {
+ ret = jQuery.buildFragment( [ match[1] ], [ doc ] );
+ selector = (ret.cacheable ? ret.fragment.cloneNode(true) : ret.fragment).childNodes;
+ }
+
+ return jQuery.merge( this, selector );
+
+ // HANDLE: $("#id")
+ } else {
+ elem = document.getElementById( match[2] );
+
+ // Check parentNode to catch when Blackberry 4.6 returns
+ // nodes that are no longer in the document #6963
+ if ( elem && elem.parentNode ) {
+ // Handle the case where IE and Opera return items
+ // by name instead of ID
+ if ( elem.id !== match[2] ) {
+ return rootjQuery.find( selector );
+ }
+
+ // Otherwise, we inject the element directly into the jQuery object
+ this.length = 1;
+ this[0] = elem;
+ }
+
+ this.context = document;
+ this.selector = selector;
+ return this;
+ }
+
+ // HANDLE: $("TAG")
+ } else if ( !context && !rnonword.test( selector ) ) {
+ this.selector = selector;
+ this.context = document;
+ selector = document.getElementsByTagName( selector );
+ return jQuery.merge( this, selector );
+
+ // HANDLE: $(expr, $(...))
+ } else if ( !context || context.jquery ) {
+ return (context || rootjQuery).find( selector );
+
+ // HANDLE: $(expr, context)
+ // (which is just equivalent to: $(context).find(expr)
+ } else {
+ return jQuery( context ).find( selector );
+ }
+
+ // HANDLE: $(function)
+ // Shortcut for document ready
+ } else if ( jQuery.isFunction( selector ) ) {
+ return rootjQuery.ready( selector );
+ }
+
+ if (selector.selector !== undefined) {
+ this.selector = selector.selector;
+ this.context = selector.context;
+ }
+
+ return jQuery.makeArray( selector, this );
+ },
+
+ // Start with an empty selector
+ selector: "",
+
+ // The current version of jQuery being used
+ jquery: "1.4.4",
+
+ // The default length of a jQuery object is 0
+ length: 0,
+
+ // The number of elements contained in the matched element set
+ size: function() {
+ return this.length;
+ },
+
+ toArray: function() {
+ return slice.call( this, 0 );
+ },
+
+ // Get the Nth element in the matched element set OR
+ // Get the whole matched element set as a clean array
+ get: function( num ) {
+ return num == null ?
+
+ // Return a 'clean' array
+ this.toArray() :
+
+ // Return just the object
+ ( num < 0 ? this.slice(num)[ 0 ] : this[ num ] );
+ },
+
+ // Take an array of elements and push it onto the stack
+ // (returning the new matched element set)
+ pushStack: function( elems, name, selector ) {
+ // Build a new jQuery matched element set
+ var ret = jQuery();
+
+ if ( jQuery.isArray( elems ) ) {
+ push.apply( ret, elems );
+
+ } else {
+ jQuery.merge( ret, elems );
+ }
+
+ // Add the old object onto the stack (as a reference)
+ ret.prevObject = this;
+
+ ret.context = this.context;
+
+ if ( name === "find" ) {
+ ret.selector = this.selector + (this.selector ? " " : "") + selector;
+ } else if ( name ) {
+ ret.selector = this.selector + "." + name + "(" + selector + ")";
+ }
+
+ // Return the newly-formed element set
+ return ret;
+ },
+
+ // Execute a callback for every element in the matched set.
+ // (You can seed the arguments with an array of args, but this is
+ // only used internally.)
+ each: function( callback, args ) {
+ return jQuery.each( this, callback, args );
+ },
+
+ ready: function( fn ) {
+ // Attach the listeners
+ jQuery.bindReady();
+
+ // If the DOM is already ready
+ if ( jQuery.isReady ) {
+ // Execute the function immediately
+ fn.call( document, jQuery );
+
+ // Otherwise, remember the function for later
+ } else if ( readyList ) {
+ // Add the function to the wait list
+ readyList.push( fn );
+ }
+
+ return this;
+ },
+
+ eq: function( i ) {
+ return i === -1 ?
+ this.slice( i ) :
+ this.slice( i, +i + 1 );
+ },
+
+ first: function() {
+ return this.eq( 0 );
+ },
+
+ last: function() {
+ return this.eq( -1 );
+ },
+
+ slice: function() {
+ return this.pushStack( slice.apply( this, arguments ),
+ "slice", slice.call(arguments).join(",") );
+ },
+
+ map: function( callback ) {
+ return this.pushStack( jQuery.map(this, function( elem, i ) {
+ return callback.call( elem, i, elem );
+ }));
+ },
+
+ end: function() {
+ return this.prevObject || jQuery(null);
+ },
+
+ // For internal use only.
+ // Behaves like an Array's method, not like a jQuery method.
+ push: push,
+ sort: [].sort,
+ splice: [].splice
+};
+
+// Give the init function the jQuery prototype for later instantiation
+jQuery.fn.init.prototype = jQuery.fn;
+
+jQuery.extend = jQuery.fn.extend = function() {
+ var options, name, src, copy, copyIsArray, clone,
+ target = arguments[0] || {},
+ i = 1,
+ length = arguments.length,
+ deep = false;
+
+ // Handle a deep copy situation
+ if ( typeof target === "boolean" ) {
+ deep = target;
+ target = arguments[1] || {};
+ // skip the boolean and the target
+ i = 2;
+ }
+
+ // Handle case when target is a string or something (possible in deep copy)
+ if ( typeof target !== "object" && !jQuery.isFunction(target) ) {
+ target = {};
+ }
+
+ // extend jQuery itself if only one argument is passed
+ if ( length === i ) {
+ target = this;
+ --i;
+ }
+
+ for ( ; i < length; i++ ) {
+ // Only deal with non-null/undefined values
+ if ( (options = arguments[ i ]) != null ) {
+ // Extend the base object
+ for ( name in options ) {
+ src = target[ name ];
+ copy = options[ name ];
+
+ // Prevent never-ending loop
+ if ( target === copy ) {
+ continue;
+ }
+
+ // Recurse if we're merging plain objects or arrays
+ if ( deep && copy && ( jQuery.isPlainObject(copy) || (copyIsArray = jQuery.isArray(copy)) ) ) {
+ if ( copyIsArray ) {
+ copyIsArray = false;
+ clone = src && jQuery.isArray(src) ? src : [];
+
+ } else {
+ clone = src && jQuery.isPlainObject(src) ? src : {};
+ }
+
+ // Never move original objects, clone them
+ target[ name ] = jQuery.extend( deep, clone, copy );
+
+ // Don't bring in undefined values
+ } else if ( copy !== undefined ) {
+ target[ name ] = copy;
+ }
+ }
+ }
+ }
+
+ // Return the modified object
+ return target;
+};
+
+jQuery.extend({
+ noConflict: function( deep ) {
+ window.$ = _$;
+
+ if ( deep ) {
+ window.jQuery = _jQuery;
+ }
+
+ return jQuery;
+ },
+
+ // Is the DOM ready to be used? Set to true once it occurs.
+ isReady: false,
+
+ // A counter to track how many items to wait for before
+ // the ready event fires. See #6781
+ readyWait: 1,
+
+ // Handle when the DOM is ready
+ ready: function( wait ) {
+ // A third-party is pushing the ready event forwards
+ if ( wait === true ) {
+ jQuery.readyWait--;
+ }
+
+ // Make sure that the DOM is not already loaded
+ if ( !jQuery.readyWait || (wait !== true && !jQuery.isReady) ) {
+ // Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443).
+ if ( !document.body ) {
+ return setTimeout( jQuery.ready, 1 );
+ }
+
+ // Remember that the DOM is ready
+ jQuery.isReady = true;
+
+ // If a normal DOM Ready event fired, decrement, and wait if need be
+ if ( wait !== true && --jQuery.readyWait > 0 ) {
+ return;
+ }
+
+ // If there are functions bound, to execute
+ if ( readyList ) {
+ // Execute all of them
+ var fn,
+ i = 0,
+ ready = readyList;
+
+ // Reset the list of functions
+ readyList = null;
+
+ while ( (fn = ready[ i++ ]) ) {
+ fn.call( document, jQuery );
+ }
+
+ // Trigger any bound ready events
+ if ( jQuery.fn.trigger ) {
+ jQuery( document ).trigger( "ready" ).unbind( "ready" );
+ }
+ }
+ }
+ },
+
+ bindReady: function() {
+ if ( readyBound ) {
+ return;
+ }
+
+ readyBound = true;
+
+ // Catch cases where $(document).ready() is called after the
+ // browser event has already occurred.
+ if ( document.readyState === "complete" ) {
+ // Handle it asynchronously to allow scripts the opportunity to delay ready
+ return setTimeout( jQuery.ready, 1 );
+ }
+
+ // Mozilla, Opera and webkit nightlies currently support this event
+ if ( document.addEventListener ) {
+ // Use the handy event callback
+ document.addEventListener( "DOMContentLoaded", DOMContentLoaded, false );
+
+ // A fallback to window.onload, that will always work
+ window.addEventListener( "load", jQuery.ready, false );
+
+ // If IE event model is used
+ } else if ( document.attachEvent ) {
+ // ensure firing before onload,
+ // maybe late but safe also for iframes
+ document.attachEvent("onreadystatechange", DOMContentLoaded);
+
+ // A fallback to window.onload, that will always work
+ window.attachEvent( "onload", jQuery.ready );
+
+ // If IE and not a frame
+ // continually check to see if the document is ready
+ var toplevel = false;
+
+ try {
+ toplevel = window.frameElement == null;
+ } catch(e) {}
+
+ if ( document.documentElement.doScroll && toplevel ) {
+ doScrollCheck();
+ }
+ }
+ },
+
+ // See test/unit/core.js for details concerning isFunction.
+ // Since version 1.3, DOM methods and functions like alert
+ // aren't supported. They return false on IE (#2968).
+ isFunction: function( obj ) {
+ return jQuery.type(obj) === "function";
+ },
+
+ isArray: Array.isArray || function( obj ) {
+ return jQuery.type(obj) === "array";
+ },
+
+ // A crude way of determining if an object is a window
+ isWindow: function( obj ) {
+ return obj && typeof obj === "object" && "setInterval" in obj;
+ },
+
+ isNaN: function( obj ) {
+ return obj == null || !rdigit.test( obj ) || isNaN( obj );
+ },
+
+ type: function( obj ) {
+ return obj == null ?
+ String( obj ) :
+ class2type[ toString.call(obj) ] || "object";
+ },
+
+ isPlainObject: function( obj ) {
+ // Must be an Object.
+ // Because of IE, we also have to check the presence of the constructor property.
+ // Make sure that DOM nodes and window objects don't pass through, as well
+ if ( !obj || jQuery.type(obj) !== "object" || obj.nodeType || jQuery.isWindow( obj ) ) {
+ return false;
+ }
+
+ // Not own constructor property must be Object
+ if ( obj.constructor &&
+ !hasOwn.call(obj, "constructor") &&
+ !hasOwn.call(obj.constructor.prototype, "isPrototypeOf") ) {
+ return false;
+ }
+
+ // Own properties are enumerated firstly, so to speed up,
+ // if last one is own, then all properties are own.
+
+ var key;
+ for ( key in obj ) {}
+
+ return key === undefined || hasOwn.call( obj, key );
+ },
+
+ isEmptyObject: function( obj ) {
+ for ( var name in obj ) {
+ return false;
+ }
+ return true;
+ },
+
+ error: function( msg ) {
+ throw msg;
+ },
+
+ parseJSON: function( data ) {
+ if ( typeof data !== "string" || !data ) {
+ return null;
+ }
+
+ // Make sure leading/trailing whitespace is removed (IE can't handle it)
+ data = jQuery.trim( data );
+
+ // Make sure the incoming data is actual JSON
+ // Logic borrowed from http://json.org/json2.js
+ if ( rvalidchars.test(data.replace(rvalidescape, "@")
+ .replace(rvalidtokens, "]")
+ .replace(rvalidbraces, "")) ) {
+
+ // Try to use the native JSON parser first
+ return window.JSON && window.JSON.parse ?
+ window.JSON.parse( data ) :
+ (new Function("return " + data))();
+
+ } else {
+ jQuery.error( "Invalid JSON: " + data );
+ }
+ },
+
+ noop: function() {},
+
+ // Evalulates a script in a global context
+ globalEval: function( data ) {
+ if ( data && rnotwhite.test(data) ) {
+ // Inspired by code by Andrea Giammarchi
+ // http://webreflection.blogspot.com/2007/08/global-scope-evaluation-and-dom.html
+ var head = document.getElementsByTagName("head")[0] || document.documentElement,
+ script = document.createElement("script");
+
+ script.type = "text/javascript";
+
+ if ( jQuery.support.scriptEval ) {
+ script.appendChild( document.createTextNode( data ) );
+ } else {
+ script.text = data;
+ }
+
+ // Use insertBefore instead of appendChild to circumvent an IE6 bug.
+ // This arises when a base node is used (#2709).
+ head.insertBefore( script, head.firstChild );
+ head.removeChild( script );
+ }
+ },
+
+ nodeName: function( elem, name ) {
+ return elem.nodeName && elem.nodeName.toUpperCase() === name.toUpperCase();
+ },
+
+ // args is for internal usage only
+ each: function( object, callback, args ) {
+ var name, i = 0,
+ length = object.length,
+ isObj = length === undefined || jQuery.isFunction(object);
+
+ if ( args ) {
+ if ( isObj ) {
+ for ( name in object ) {
+ if ( callback.apply( object[ name ], args ) === false ) {
+ break;
+ }
+ }
+ } else {
+ for ( ; i < length; ) {
+ if ( callback.apply( object[ i++ ], args ) === false ) {
+ break;
+ }
+ }
+ }
+
+ // A special, fast, case for the most common use of each
+ } else {
+ if ( isObj ) {
+ for ( name in object ) {
+ if ( callback.call( object[ name ], name, object[ name ] ) === false ) {
+ break;
+ }
+ }
+ } else {
+ for ( var value = object[0];
+ i < length && callback.call( value, i, value ) !== false; value = object[++i] ) {}
+ }
+ }
+
+ return object;
+ },
+
+ // Use native String.trim function wherever possible
+ trim: trim ?
+ function( text ) {
+ return text == null ?
+ "" :
+ trim.call( text );
+ } :
+
+ // Otherwise use our own trimming functionality
+ function( text ) {
+ return text == null ?
+ "" :
+ text.toString().replace( trimLeft, "" ).replace( trimRight, "" );
+ },
+
+ // results is for internal usage only
+ makeArray: function( array, results ) {
+ var ret = results || [];
+
+ if ( array != null ) {
+ // The window, strings (and functions) also have 'length'
+ // The extra typeof function check is to prevent crashes
+ // in Safari 2 (See: #3039)
+ // Tweaked logic slightly to handle Blackberry 4.7 RegExp issues #6930
+ var type = jQuery.type(array);
+
+ if ( array.length == null || type === "string" || type === "function" || type === "regexp" || jQuery.isWindow( array ) ) {
+ push.call( ret, array );
+ } else {
+ jQuery.merge( ret, array );
+ }
+ }
+
+ return ret;
+ },
+
+ inArray: function( elem, array ) {
+ if ( array.indexOf ) {
+ return array.indexOf( elem );
+ }
+
+ for ( var i = 0, length = array.length; i < length; i++ ) {
+ if ( array[ i ] === elem ) {
+ return i;
+ }
+ }
+
+ return -1;
+ },
+
+ merge: function( first, second ) {
+ var i = first.length,
+ j = 0;
+
+ if ( typeof second.length === "number" ) {
+ for ( var l = second.length; j < l; j++ ) {
+ first[ i++ ] = second[ j ];
+ }
+
+ } else {
+ while ( second[j] !== undefined ) {
+ first[ i++ ] = second[ j++ ];
+ }
+ }
+
+ first.length = i;
+
+ return first;
+ },
+
+ grep: function( elems, callback, inv ) {
+ var ret = [], retVal;
+ inv = !!inv;
+
+ // Go through the array, only saving the items
+ // that pass the validator function
+ for ( var i = 0, length = elems.length; i < length; i++ ) {
+ retVal = !!callback( elems[ i ], i );
+ if ( inv !== retVal ) {
+ ret.push( elems[ i ] );
+ }
+ }
+
+ return ret;
+ },
+
+ // arg is for internal usage only
+ map: function( elems, callback, arg ) {
+ var ret = [], value;
+
+ // Go through the array, translating each of the items to their
+ // new value (or values).
+ for ( var i = 0, length = elems.length; i < length; i++ ) {
+ value = callback( elems[ i ], i, arg );
+
+ if ( value != null ) {
+ ret[ ret.length ] = value;
+ }
+ }
+
+ return ret.concat.apply( [], ret );
+ },
+
+ // A global GUID counter for objects
+ guid: 1,
+
+ proxy: function( fn, proxy, thisObject ) {
+ if ( arguments.length === 2 ) {
+ if ( typeof proxy === "string" ) {
+ thisObject = fn;
+ fn = thisObject[ proxy ];
+ proxy = undefined;
+
+ } else if ( proxy && !jQuery.isFunction( proxy ) ) {
+ thisObject = proxy;
+ proxy = undefined;
+ }
+ }
+
+ if ( !proxy && fn ) {
+ proxy = function() {
+ return fn.apply( thisObject || this, arguments );
+ };
+ }
+
+ // Set the guid of unique handler to the same of original handler, so it can be removed
+ if ( fn ) {
+ proxy.guid = fn.guid = fn.guid || proxy.guid || jQuery.guid++;
+ }
+
+ // So proxy can be declared as an argument
+ return proxy;
+ },
+
+ // Mutifunctional method to get and set values to a collection
+ // The value/s can be optionally by executed if its a function
+ access: function( elems, key, value, exec, fn, pass ) {
+ var length = elems.length;
+
+ // Setting many attributes
+ if ( typeof key === "object" ) {
+ for ( var k in key ) {
+ jQuery.access( elems, k, key[k], exec, fn, value );
+ }
+ return elems;
+ }
+
+ // Setting one attribute
+ if ( value !== undefined ) {
+ // Optionally, function values get executed if exec is true
+ exec = !pass && exec && jQuery.isFunction(value);
+
+ for ( var i = 0; i < length; i++ ) {
+ fn( elems[i], key, exec ? value.call( elems[i], i, fn( elems[i], key ) ) : value, pass );
+ }
+
+ return elems;
+ }
+
+ // Getting an attribute
+ return length ? fn( elems[0], key ) : undefined;
+ },
+
+ now: function() {
+ return (new Date()).getTime();
+ },
+
+ // Use of jQuery.browser is frowned upon.
+ // More details: http://docs.jquery.com/Utilities/jQuery.browser
+ uaMatch: function( ua ) {
+ ua = ua.toLowerCase();
+
+ var match = rwebkit.exec( ua ) ||
+ ropera.exec( ua ) ||
+ rmsie.exec( ua ) ||
+ ua.indexOf("compatible") < 0 && rmozilla.exec( ua ) ||
+ [];
+
+ return { browser: match[1] || "", version: match[2] || "0" };
+ },
+
+ browser: {}
+});
+
+// Populate the class2type map
+jQuery.each("Boolean Number String Function Array Date RegExp Object".split(" "), function(i, name) {
+ class2type[ "[object " + name + "]" ] = name.toLowerCase();
+});
+
+browserMatch = jQuery.uaMatch( userAgent );
+if ( browserMatch.browser ) {
+ jQuery.browser[ browserMatch.browser ] = true;
+ jQuery.browser.version = browserMatch.version;
+}
+
+// Deprecated, use jQuery.browser.webkit instead
+if ( jQuery.browser.webkit ) {
+ jQuery.browser.safari = true;
+}
+
+if ( indexOf ) {
+ jQuery.inArray = function( elem, array ) {
+ return indexOf.call( array, elem );
+ };
+}
+
+// Verify that \s matches non-breaking spaces
+// (IE fails on this test)
+if ( !rwhite.test( "\xA0" ) ) {
+ trimLeft = /^[\s\xA0]+/;
+ trimRight = /[\s\xA0]+$/;
+}
+
+// All jQuery objects should point back to these
+rootjQuery = jQuery(document);
+
+// Cleanup functions for the document ready method
+if ( document.addEventListener ) {
+ DOMContentLoaded = function() {
+ document.removeEventListener( "DOMContentLoaded", DOMContentLoaded, false );
+ jQuery.ready();
+ };
+
+} else if ( document.attachEvent ) {
+ DOMContentLoaded = function() {
+ // Make sure body exists, at least, in case IE gets a little overzealous (ticket #5443).
+ if ( document.readyState === "complete" ) {
+ document.detachEvent( "onreadystatechange", DOMContentLoaded );
+ jQuery.ready();
+ }
+ };
+}
+
+// The DOM ready check for Internet Explorer
+function doScrollCheck() {
+ if ( jQuery.isReady ) {
+ return;
+ }
+
+ try {
+ // If IE is used, use the trick by Diego Perini
+ // http://javascript.nwbox.com/IEContentLoaded/
+ document.documentElement.doScroll("left");
+ } catch(e) {
+ setTimeout( doScrollCheck, 1 );
+ return;
+ }
+
+ // and execute any waiting functions
+ jQuery.ready();
+}
+
+// Expose jQuery to the global object
+return (window.jQuery = window.$ = jQuery);
+
+})();
+
+
+(function() {
+
+ jQuery.support = {};
+
+ var root = document.documentElement,
+ script = document.createElement("script"),
+ div = document.createElement("div"),
+ id = "script" + jQuery.now();
+
+ div.style.display = "none";
+ div.innerHTML = " <link/><table></table><a href='/a' style='color:red;float:left;opacity:.55;'>a</a><input type='checkbox'/>";
+
+ var all = div.getElementsByTagName("*"),
+ a = div.getElementsByTagName("a")[0],
+ select = document.createElement("select"),
+ opt = select.appendChild( document.createElement("option") );
+
+ // Can't get basic test support
+ if ( !all || !all.length || !a ) {
+ return;
+ }
+
+ jQuery.support = {
+ // IE strips leading whitespace when .innerHTML is used
+ leadingWhitespace: div.firstChild.nodeType === 3,
+
+ // Make sure that tbody elements aren't automatically inserted
+ // IE will insert them into empty tables
+ tbody: !div.getElementsByTagName("tbody").length,
+
+ // Make sure that link elements get serialized correctly by innerHTML
+ // This requires a wrapper element in IE
+ htmlSerialize: !!div.getElementsByTagName("link").length,
+
+ // Get the style information from getAttribute
+ // (IE uses .cssText insted)
+ style: /red/.test( a.getAttribute("style") ),
+
+ // Make sure that URLs aren't manipulated
+ // (IE normalizes it by default)
+ hrefNormalized: a.getAttribute("href") === "/a",
+
+ // Make sure that element opacity exists
+ // (IE uses filter instead)
+ // Use a regex to work around a WebKit issue. See #5145
+ opacity: /^0.55$/.test( a.style.opacity ),
+
+ // Verify style float existence
+ // (IE uses styleFloat instead of cssFloat)
+ cssFloat: !!a.style.cssFloat,
+
+ // Make sure that if no value is specified for a checkbox
+ // that it defaults to "on".
+ // (WebKit defaults to "" instead)
+ checkOn: div.getElementsByTagName("input")[0].value === "on",
+
+ // Make sure that a selected-by-default option has a working selected property.
+ // (WebKit defaults to false instead of true, IE too, if it's in an optgroup)
+ optSelected: opt.selected,
+
+ // Will be defined later
+ deleteExpando: true,
+ optDisabled: false,
+ checkClone: false,
+ scriptEval: false,
+ noCloneEvent: true,
+ boxModel: null,
+ inlineBlockNeedsLayout: false,
+ shrinkWrapBlocks: false,
+ reliableHiddenOffsets: true
+ };
+
+ // Make sure that the options inside disabled selects aren't marked as disabled
+ // (WebKit marks them as diabled)
+ select.disabled = true;
+ jQuery.support.optDisabled = !opt.disabled;
+
+ script.type = "text/javascript";
+ try {
+ script.appendChild( document.createTextNode( "window." + id + "=1;" ) );
+ } catch(e) {}
+
+ root.insertBefore( script, root.firstChild );
+
+ // Make sure that the execution of code works by injecting a script
+ // tag with appendChild/createTextNode
+ // (IE doesn't support this, fails, and uses .text instead)
+ if ( window[ id ] ) {
+ jQuery.support.scriptEval = true;
+ delete window[ id ];
+ }
+
+ // Test to see if it's possible to delete an expando from an element
+ // Fails in Internet Explorer
+ try {
+ delete script.test;
+
+ } catch(e) {
+ jQuery.support.deleteExpando = false;
+ }
+
+ root.removeChild( script );
+
+ if ( div.attachEvent && div.fireEvent ) {
+ div.attachEvent("onclick", function click() {
+ // Cloning a node shouldn't copy over any
+ // bound event handlers (IE does this)
+ jQuery.support.noCloneEvent = false;
+ div.detachEvent("onclick", click);
+ });
+ div.cloneNode(true).fireEvent("onclick");
+ }
+
+ div = document.createElement("div");
+ div.innerHTML = "<input type='radio' name='radiotest' checked='checked'/>";
+
+ var fragment = document.createDocumentFragment();
+ fragment.appendChild( div.firstChild );
+
+ // WebKit doesn't clone checked state correctly in fragments
+ jQuery.support.checkClone = fragment.cloneNode(true).cloneNode(true).lastChild.checked;
+
+ // Figure out if the W3C box model works as expected
+ // document.body must exist before we can do this
+ jQuery(function() {
+ var div = document.createElement("div");
+ div.style.width = div.style.paddingLeft = "1px";
+
+ document.body.appendChild( div );
+ jQuery.boxModel = jQuery.support.boxModel = div.offsetWidth === 2;
+
+ if ( "zoom" in div.style ) {
+ // Check if natively block-level elements act like inline-block
+ // elements when setting their display to 'inline' and giving
+ // them layout
+ // (IE < 8 does this)
+ div.style.display = "inline";
+ div.style.zoom = 1;
+ jQuery.support.inlineBlockNeedsLayout = div.offsetWidth === 2;
+
+ // Check if elements with layout shrink-wrap their children
+ // (IE 6 does this)
+ div.style.display = "";
+ div.innerHTML = "<div style='width:4px;'></div>";
+ jQuery.support.shrinkWrapBlocks = div.offsetWidth !== 2;
+ }
+
+ div.innerHTML = "<table><tr><td style='padding:0;display:none'></td><td>t</td></tr></table>";
+ var tds = div.getElementsByTagName("td");
+
+ // Check if table cells still have offsetWidth/Height when they are set
+ // to display:none and there are still other visible table cells in a
+ // table row; if so, offsetWidth/Height are not reliable for use when
+ // determining if an element has been hidden directly using
+ // display:none (it is still safe to use offsets if a parent element is
+ // hidden; don safety goggles and see bug #4512 for more information).
+ // (only IE 8 fails this test)
+ jQuery.support.reliableHiddenOffsets = tds[0].offsetHeight === 0;
+
+ tds[0].style.display = "";
+ tds[1].style.display = "none";
+
+ // Check if empty table cells still have offsetWidth/Height
+ // (IE < 8 fail this test)
+ jQuery.support.reliableHiddenOffsets = jQuery.support.reliableHiddenOffsets && tds[0].offsetHeight === 0;
+ div.innerHTML = "";
+
+ document.body.removeChild( div ).style.display = "none";
+ div = tds = null;
+ });
+
+ // Technique from Juriy Zaytsev
+ // http://thinkweb2.com/projects/prototype/detecting-event-support-without-browser-sniffing/
+ var eventSupported = function( eventName ) {
+ var el = document.createElement("div");
+ eventName = "on" + eventName;
+
+ var isSupported = (eventName in el);
+ if ( !isSupported ) {
+ el.setAttribute(eventName, "return;");
+ isSupported = typeof el[eventName] === "function";
+ }
+ el = null;
+
+ return isSupported;
+ };
+
+ jQuery.support.submitBubbles = eventSupported("submit");
+ jQuery.support.changeBubbles = eventSupported("change");
+
+ // release memory in IE
+ root = script = div = all = a = null;
+})();
+
+
+
+var windowData = {},
+ rbrace = /^(?:\{.*\}|\[.*\])$/;
+
+jQuery.extend({
+ cache: {},
+
+ // Please use with caution
+ uuid: 0,
+
+ // Unique for each copy of jQuery on the page
+ expando: "jQuery" + jQuery.now(),
+
+ // The following elements throw uncatchable exceptions if you
+ // attempt to add expando properties to them.
+ noData: {
+ "embed": true,
+ // Ban all objects except for Flash (which handle expandos)
+ "object": "clsid:D27CDB6E-AE6D-11cf-96B8-444553540000",
+ "applet": true
+ },
+
+ data: function( elem, name, data ) {
+ if ( !jQuery.acceptData( elem ) ) {
+ return;
+ }
+
+ elem = elem == window ?
+ windowData :
+ elem;
+
+ var isNode = elem.nodeType,
+ id = isNode ? elem[ jQuery.expando ] : null,
+ cache = jQuery.cache, thisCache;
+
+ if ( isNode && !id && typeof name === "string" && data === undefined ) {
+ return;
+ }
+
+ // Get the data from the object directly
+ if ( !isNode ) {
+ cache = elem;
+
+ // Compute a unique ID for the element
+ } else if ( !id ) {
+ elem[ jQuery.expando ] = id = ++jQuery.uuid;
+ }
+
+ // Avoid generating a new cache unless none exists and we
+ // want to manipulate it.
+ if ( typeof name === "object" ) {
+ if ( isNode ) {
+ cache[ id ] = jQuery.extend(cache[ id ], name);
+
+ } else {
+ jQuery.extend( cache, name );
+ }
+
+ } else if ( isNode && !cache[ id ] ) {
+ cache[ id ] = {};
+ }
+
+ thisCache = isNode ? cache[ id ] : cache;
+
+ // Prevent overriding the named cache with undefined values
+ if ( data !== undefined ) {
+ thisCache[ name ] = data;
+ }
+
+ return typeof name === "string" ? thisCache[ name ] : thisCache;
+ },
+
+ removeData: function( elem, name ) {
+ if ( !jQuery.acceptData( elem ) ) {
+ return;
+ }
+
+ elem = elem == window ?
+ windowData :
+ elem;
+
+ var isNode = elem.nodeType,
+ id = isNode ? elem[ jQuery.expando ] : elem,
+ cache = jQuery.cache,
+ thisCache = isNode ? cache[ id ] : id;
+
+ // If we want to remove a specific section of the element's data
+ if ( name ) {
+ if ( thisCache ) {
+ // Remove the section of cache data
+ delete thisCache[ name ];
+
+ // If we've removed all the data, remove the element's cache
+ if ( isNode && jQuery.isEmptyObject(thisCache) ) {
+ jQuery.removeData( elem );
+ }
+ }
+
+ // Otherwise, we want to remove all of the element's data
+ } else {
+ if ( isNode && jQuery.support.deleteExpando ) {
+ delete elem[ jQuery.expando ];
+
+ } else if ( elem.removeAttribute ) {
+ elem.removeAttribute( jQuery.expando );
+
+ // Completely remove the data cache
+ } else if ( isNode ) {
+ delete cache[ id ];
+
+ // Remove all fields from the object
+ } else {
+ for ( var n in elem ) {
+ delete elem[ n ];
+ }
+ }
+ }
+ },
+
+ // A method for determining if a DOM node can handle the data expando
+ acceptData: function( elem ) {
+ if ( elem.nodeName ) {
+ var match = jQuery.noData[ elem.nodeName.toLowerCase() ];
+
+ if ( match ) {
+ return !(match === true || elem.getAttribute("classid") !== match);
+ }
+ }
+
+ return true;
+ }
+});
+
+jQuery.fn.extend({
+ data: function( key, value ) {
+ var data = null;
+
+ if ( typeof key === "undefined" ) {
+ if ( this.length ) {
+ var attr = this[0].attributes, name;
+ data = jQuery.data( this[0] );
+
+ for ( var i = 0, l = attr.length; i < l; i++ ) {
+ name = attr[i].name;
+
+ if ( name.indexOf( "data-" ) === 0 ) {
+ name = name.substr( 5 );
+ dataAttr( this[0], name, data[ name ] );
+ }
+ }
+ }
+
+ return data;
+
+ } else if ( typeof key === "object" ) {
+ return this.each(function() {
+ jQuery.data( this, key );
+ });
+ }
+
+ var parts = key.split(".");
+ parts[1] = parts[1] ? "." + parts[1] : "";
+
+ if ( value === undefined ) {
+ data = this.triggerHandler("getData" + parts[1] + "!", [parts[0]]);
+
+ // Try to fetch any internally stored data first
+ if ( data === undefined && this.length ) {
+ data = jQuery.data( this[0], key );
+ data = dataAttr( this[0], key, data );
+ }
+
+ return data === undefined && parts[1] ?
+ this.data( parts[0] ) :
+ data;
+
+ } else {
+ return this.each(function() {
+ var $this = jQuery( this ),
+ args = [ parts[0], value ];
+
+ $this.triggerHandler( "setData" + parts[1] + "!", args );
+ jQuery.data( this, key, value );
+ $this.triggerHandler( "changeData" + parts[1] + "!", args );
+ });
+ }
+ },
+
+ removeData: function( key ) {
+ return this.each(function() {
+ jQuery.removeData( this, key );
+ });
+ }
+});
+
+function dataAttr( elem, key, data ) {
+ // If nothing was found internally, try to fetch any
+ // data from the HTML5 data-* attribute
+ if ( data === undefined && elem.nodeType === 1 ) {
+ data = elem.getAttribute( "data-" + key );
+
+ if ( typeof data === "string" ) {
+ try {
+ data = data === "true" ? true :
+ data === "false" ? false :
+ data === "null" ? null :
+ !jQuery.isNaN( data ) ? parseFloat( data ) :
+ rbrace.test( data ) ? jQuery.parseJSON( data ) :
+ data;
+ } catch( e ) {}
+
+ // Make sure we set the data so it isn't changed later
+ jQuery.data( elem, key, data );
+
+ } else {
+ data = undefined;
+ }
+ }
+
+ return data;
+}
+
+
+
+
+jQuery.extend({
+ queue: function( elem, type, data ) {
+ if ( !elem ) {
+ return;
+ }
+
+ type = (type || "fx") + "queue";
+ var q = jQuery.data( elem, type );
+
+ // Speed up dequeue by getting out quickly if this is just a lookup
+ if ( !data ) {
+ return q || [];
+ }
+
+ if ( !q || jQuery.isArray(data) ) {
+ q = jQuery.data( elem, type, jQuery.makeArray(data) );
+
+ } else {
+ q.push( data );
+ }
+
+ return q;
+ },
+
+ dequeue: function( elem, type ) {
+ type = type || "fx";
+
+ var queue = jQuery.queue( elem, type ),
+ fn = queue.shift();
+
+ // If the fx queue is dequeued, always remove the progress sentinel
+ if ( fn === "inprogress" ) {
+ fn = queue.shift();
+ }
+
+ if ( fn ) {
+ // Add a progress sentinel to prevent the fx queue from being
+ // automatically dequeued
+ if ( type === "fx" ) {
+ queue.unshift("inprogress");
+ }
+
+ fn.call(elem, function() {
+ jQuery.dequeue(elem, type);
+ });
+ }
+ }
+});
+
+jQuery.fn.extend({
+ queue: function( type, data ) {
+ if ( typeof type !== "string" ) {
+ data = type;
+ type = "fx";
+ }
+
+ if ( data === undefined ) {
+ return jQuery.queue( this[0], type );
+ }
+ return this.each(function( i ) {
+ var queue = jQuery.queue( this, type, data );
+
+ if ( type === "fx" && queue[0] !== "inprogress" ) {
+ jQuery.dequeue( this, type );
+ }
+ });
+ },
+ dequeue: function( type ) {
+ return this.each(function() {
+ jQuery.dequeue( this, type );
+ });
+ },
+
+ // Based off of the plugin by Clint Helfers, with permission.
+ // http://blindsignals.com/index.php/2009/07/jquery-delay/
+ delay: function( time, type ) {
+ time = jQuery.fx ? jQuery.fx.speeds[time] || time : time;
+ type = type || "fx";
+
+ return this.queue( type, function() {
+ var elem = this;
+ setTimeout(function() {
+ jQuery.dequeue( elem, type );
+ }, time );
+ });
+ },
+
+ clearQueue: function( type ) {
+ return this.queue( type || "fx", [] );
+ }
+});
+
+
+
+
+var rclass = /[\n\t]/g,
+ rspaces = /\s+/,
+ rreturn = /\r/g,
+ rspecialurl = /^(?:href|src|style)$/,
+ rtype = /^(?:button|input)$/i,
+ rfocusable = /^(?:button|input|object|select|textarea)$/i,
+ rclickable = /^a(?:rea)?$/i,
+ rradiocheck = /^(?:radio|checkbox)$/i;
+
+jQuery.props = {
+ "for": "htmlFor",
+ "class": "className",
+ readonly: "readOnly",
+ maxlength: "maxLength",
+ cellspacing: "cellSpacing",
+ rowspan: "rowSpan",
+ colspan: "colSpan",
+ tabindex: "tabIndex",
+ usemap: "useMap",
+ frameborder: "frameBorder"
+};
+
+jQuery.fn.extend({
+ attr: function( name, value ) {
+ return jQuery.access( this, name, value, true, jQuery.attr );
+ },
+
+ removeAttr: function( name, fn ) {
+ return this.each(function(){
+ jQuery.attr( this, name, "" );
+ if ( this.nodeType === 1 ) {
+ this.removeAttribute( name );
+ }
+ });
+ },
+
+ addClass: function( value ) {
+ if ( jQuery.isFunction(value) ) {
+ return this.each(function(i) {
+ var self = jQuery(this);
+ self.addClass( value.call(this, i, self.attr("class")) );
+ });
+ }
+
+ if ( value && typeof value === "string" ) {
+ var classNames = (value || "").split( rspaces );
+
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ var elem = this[i];
+
+ if ( elem.nodeType === 1 ) {
+ if ( !elem.className ) {
+ elem.className = value;
+
+ } else {
+ var className = " " + elem.className + " ",
+ setClass = elem.className;
+
+ for ( var c = 0, cl = classNames.length; c < cl; c++ ) {
+ if ( className.indexOf( " " + classNames[c] + " " ) < 0 ) {
+ setClass += " " + classNames[c];
+ }
+ }
+ elem.className = jQuery.trim( setClass );
+ }
+ }
+ }
+ }
+
+ return this;
+ },
+
+ removeClass: function( value ) {
+ if ( jQuery.isFunction(value) ) {
+ return this.each(function(i) {
+ var self = jQuery(this);
+ self.removeClass( value.call(this, i, self.attr("class")) );
+ });
+ }
+
+ if ( (value && typeof value === "string") || value === undefined ) {
+ var classNames = (value || "").split( rspaces );
+
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ var elem = this[i];
+
+ if ( elem.nodeType === 1 && elem.className ) {
+ if ( value ) {
+ var className = (" " + elem.className + " ").replace(rclass, " ");
+ for ( var c = 0, cl = classNames.length; c < cl; c++ ) {
+ className = className.replace(" " + classNames[c] + " ", " ");
+ }
+ elem.className = jQuery.trim( className );
+
+ } else {
+ elem.className = "";
+ }
+ }
+ }
+ }
+
+ return this;
+ },
+
+ toggleClass: function( value, stateVal ) {
+ var type = typeof value,
+ isBool = typeof stateVal === "boolean";
+
+ if ( jQuery.isFunction( value ) ) {
+ return this.each(function(i) {
+ var self = jQuery(this);
+ self.toggleClass( value.call(this, i, self.attr("class"), stateVal), stateVal );
+ });
+ }
+
+ return this.each(function() {
+ if ( type === "string" ) {
+ // toggle individual class names
+ var className,
+ i = 0,
+ self = jQuery( this ),
+ state = stateVal,
+ classNames = value.split( rspaces );
+
+ while ( (className = classNames[ i++ ]) ) {
+ // check each className given, space seperated list
+ state = isBool ? state : !self.hasClass( className );
+ self[ state ? "addClass" : "removeClass" ]( className );
+ }
+
+ } else if ( type === "undefined" || type === "boolean" ) {
+ if ( this.className ) {
+ // store className if set
+ jQuery.data( this, "__className__", this.className );
+ }
+
+ // toggle whole className
+ this.className = this.className || value === false ? "" : jQuery.data( this, "__className__" ) || "";
+ }
+ });
+ },
+
+ hasClass: function( selector ) {
+ var className = " " + selector + " ";
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ if ( (" " + this[i].className + " ").replace(rclass, " ").indexOf( className ) > -1 ) {
+ return true;
+ }
+ }
+
+ return false;
+ },
+
+ val: function( value ) {
+ if ( !arguments.length ) {
+ var elem = this[0];
+
+ if ( elem ) {
+ if ( jQuery.nodeName( elem, "option" ) ) {
+ // attributes.value is undefined in Blackberry 4.7 but
+ // uses .value. See #6932
+ var val = elem.attributes.value;
+ return !val || val.specified ? elem.value : elem.text;
+ }
+
+ // We need to handle select boxes special
+ if ( jQuery.nodeName( elem, "select" ) ) {
+ var index = elem.selectedIndex,
+ values = [],
+ options = elem.options,
+ one = elem.type === "select-one";
+
+ // Nothing was selected
+ if ( index < 0 ) {
+ return null;
+ }
+
+ // Loop through all the selected options
+ for ( var i = one ? index : 0, max = one ? index + 1 : options.length; i < max; i++ ) {
+ var option = options[ i ];
+
+ // Don't return options that are disabled or in a disabled optgroup
+ if ( option.selected && (jQuery.support.optDisabled ? !option.disabled : option.getAttribute("disabled") === null) &&
+ (!option.parentNode.disabled || !jQuery.nodeName( option.parentNode, "optgroup" )) ) {
+
+ // Get the specific value for the option
+ value = jQuery(option).val();
+
+ // We don't need an array for one selects
+ if ( one ) {
+ return value;
+ }
+
+ // Multi-Selects return an array
+ values.push( value );
+ }
+ }
+
+ return values;
+ }
+
+ // Handle the case where in Webkit "" is returned instead of "on" if a value isn't specified
+ if ( rradiocheck.test( elem.type ) && !jQuery.support.checkOn ) {
+ return elem.getAttribute("value") === null ? "on" : elem.value;
+ }
+
+
+ // Everything else, we just grab the value
+ return (elem.value || "").replace(rreturn, "");
+
+ }
+
+ return undefined;
+ }
+
+ var isFunction = jQuery.isFunction(value);
+
+ return this.each(function(i) {
+ var self = jQuery(this), val = value;
+
+ if ( this.nodeType !== 1 ) {
+ return;
+ }
+
+ if ( isFunction ) {
+ val = value.call(this, i, self.val());
+ }
+
+ // Treat null/undefined as ""; convert numbers to string
+ if ( val == null ) {
+ val = "";
+ } else if ( typeof val === "number" ) {
+ val += "";
+ } else if ( jQuery.isArray(val) ) {
+ val = jQuery.map(val, function (value) {
+ return value == null ? "" : value + "";
+ });
+ }
+
+ if ( jQuery.isArray(val) && rradiocheck.test( this.type ) ) {
+ this.checked = jQuery.inArray( self.val(), val ) >= 0;
+
+ } else if ( jQuery.nodeName( this, "select" ) ) {
+ var values = jQuery.makeArray(val);
+
+ jQuery( "option", this ).each(function() {
+ this.selected = jQuery.inArray( jQuery(this).val(), values ) >= 0;
+ });
+
+ if ( !values.length ) {
+ this.selectedIndex = -1;
+ }
+
+ } else {
+ this.value = val;
+ }
+ });
+ }
+});
+
+jQuery.extend({
+ attrFn: {
+ val: true,
+ css: true,
+ html: true,
+ text: true,
+ data: true,
+ width: true,
+ height: true,
+ offset: true
+ },
+
+ attr: function( elem, name, value, pass ) {
+ // don't set attributes on text and comment nodes
+ if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 ) {
+ return undefined;
+ }
+
+ if ( pass && name in jQuery.attrFn ) {
+ return jQuery(elem)[name](value);
+ }
+
+ var notxml = elem.nodeType !== 1 || !jQuery.isXMLDoc( elem ),
+ // Whether we are setting (or getting)
+ set = value !== undefined;
+
+ // Try to normalize/fix the name
+ name = notxml && jQuery.props[ name ] || name;
+
+ // These attributes require special treatment
+ var special = rspecialurl.test( name );
+
+ // Safari mis-reports the default selected property of an option
+ // Accessing the parent's selectedIndex property fixes it
+ if ( name === "selected" && !jQuery.support.optSelected ) {
+ var parent = elem.parentNode;
+ if ( parent ) {
+ parent.selectedIndex;
+
+ // Make sure that it also works with optgroups, see #5701
+ if ( parent.parentNode ) {
+ parent.parentNode.selectedIndex;
+ }
+ }
+ }
+
+ // If applicable, access the attribute via the DOM 0 way
+ // 'in' checks fail in Blackberry 4.7 #6931
+ if ( (name in elem || elem[ name ] !== undefined) && notxml && !special ) {
+ if ( set ) {
+ // We can't allow the type property to be changed (since it causes problems in IE)
+ if ( name === "type" && rtype.test( elem.nodeName ) && elem.parentNode ) {
+ jQuery.error( "type property can't be changed" );
+ }
+
+ if ( value === null ) {
+ if ( elem.nodeType === 1 ) {
+ elem.removeAttribute( name );
+ }
+
+ } else {
+ elem[ name ] = value;
+ }
+ }
+
+ // browsers index elements by id/name on forms, give priority to attributes.
+ if ( jQuery.nodeName( elem, "form" ) && elem.getAttributeNode(name) ) {
+ return elem.getAttributeNode( name ).nodeValue;
+ }
+
+ // elem.tabIndex doesn't always return the correct value when it hasn't been explicitly set
+ // http://fluidproject.org/blog/2008/01/09/getting-setting-and-removing-tabindex-values-with-javascript/
+ if ( name === "tabIndex" ) {
+ var attributeNode = elem.getAttributeNode( "tabIndex" );
+
+ return attributeNode && attributeNode.specified ?
+ attributeNode.value :
+ rfocusable.test( elem.nodeName ) || rclickable.test( elem.nodeName ) && elem.href ?
+ 0 :
+ undefined;
+ }
+
+ return elem[ name ];
+ }
+
+ if ( !jQuery.support.style && notxml && name === "style" ) {
+ if ( set ) {
+ elem.style.cssText = "" + value;
+ }
+
+ return elem.style.cssText;
+ }
+
+ if ( set ) {
+ // convert the value to a string (all browsers do this but IE) see #1070
+ elem.setAttribute( name, "" + value );
+ }
+
+ // Ensure that missing attributes return undefined
+ // Blackberry 4.7 returns "" from getAttribute #6938
+ if ( !elem.attributes[ name ] && (elem.hasAttribute && !elem.hasAttribute( name )) ) {
+ return undefined;
+ }
+
+ var attr = !jQuery.support.hrefNormalized && notxml && special ?
+ // Some attributes require a special call on IE
+ elem.getAttribute( name, 2 ) :
+ elem.getAttribute( name );
+
+ // Non-existent attributes return null, we normalize to undefined
+ return attr === null ? undefined : attr;
+ }
+});
+
+
+
+
+var rnamespaces = /\.(.*)$/,
+ rformElems = /^(?:textarea|input|select)$/i,
+ rperiod = /\./g,
+ rspace = / /g,
+ rescape = /[^\w\s.|`]/g,
+ fcleanup = function( nm ) {
+ return nm.replace(rescape, "\\$&");
+ },
+ focusCounts = { focusin: 0, focusout: 0 };
+
+/*
+ * A number of helper functions used for managing events.
+ * Many of the ideas behind this code originated from
+ * Dean Edwards' addEvent library.
+ */
+jQuery.event = {
+
+ // Bind an event to an element
+ // Original by Dean Edwards
+ add: function( elem, types, handler, data ) {
+ if ( elem.nodeType === 3 || elem.nodeType === 8 ) {
+ return;
+ }
+
+ // For whatever reason, IE has trouble passing the window object
+ // around, causing it to be cloned in the process
+ if ( jQuery.isWindow( elem ) && ( elem !== window && !elem.frameElement ) ) {
+ elem = window;
+ }
+
+ if ( handler === false ) {
+ handler = returnFalse;
+ } else if ( !handler ) {
+ // Fixes bug #7229. Fix recommended by jdalton
+ return;
+ }
+
+ var handleObjIn, handleObj;
+
+ if ( handler.handler ) {
+ handleObjIn = handler;
+ handler = handleObjIn.handler;
+ }
+
+ // Make sure that the function being executed has a unique ID
+ if ( !handler.guid ) {
+ handler.guid = jQuery.guid++;
+ }
+
+ // Init the element's event structure
+ var elemData = jQuery.data( elem );
+
+ // If no elemData is found then we must be trying to bind to one of the
+ // banned noData elements
+ if ( !elemData ) {
+ return;
+ }
+
+ // Use a key less likely to result in collisions for plain JS objects.
+ // Fixes bug #7150.
+ var eventKey = elem.nodeType ? "events" : "__events__",
+ events = elemData[ eventKey ],
+ eventHandle = elemData.handle;
+
+ if ( typeof events === "function" ) {
+ // On plain objects events is a fn that holds the the data
+ // which prevents this data from being JSON serialized
+ // the function does not need to be called, it just contains the data
+ eventHandle = events.handle;
+ events = events.events;
+
+ } else if ( !events ) {
+ if ( !elem.nodeType ) {
+ // On plain objects, create a fn that acts as the holder
+ // of the values to avoid JSON serialization of event data
+ elemData[ eventKey ] = elemData = function(){};
+ }
+
+ elemData.events = events = {};
+ }
+
+ if ( !eventHandle ) {
+ elemData.handle = eventHandle = function() {
+ // Handle the second event of a trigger and when
+ // an event is called after a page has unloaded
+ return typeof jQuery !== "undefined" && !jQuery.event.triggered ?
+ jQuery.event.handle.apply( eventHandle.elem, arguments ) :
+ undefined;
+ };
+ }
+
+ // Add elem as a property of the handle function
+ // This is to prevent a memory leak with non-native events in IE.
+ eventHandle.elem = elem;
+
+ // Handle multiple events separated by a space
+ // jQuery(...).bind("mouseover mouseout", fn);
+ types = types.split(" ");
+
+ var type, i = 0, namespaces;
+
+ while ( (type = types[ i++ ]) ) {
+ handleObj = handleObjIn ?
+ jQuery.extend({}, handleObjIn) :
+ { handler: handler, data: data };
+
+ // Namespaced event handlers
+ if ( type.indexOf(".") > -1 ) {
+ namespaces = type.split(".");
+ type = namespaces.shift();
+ handleObj.namespace = namespaces.slice(0).sort().join(".");
+
+ } else {
+ namespaces = [];
+ handleObj.namespace = "";
+ }
+
+ handleObj.type = type;
+ if ( !handleObj.guid ) {
+ handleObj.guid = handler.guid;
+ }
+
+ // Get the current list of functions bound to this event
+ var handlers = events[ type ],
+ special = jQuery.event.special[ type ] || {};
+
+ // Init the event handler queue
+ if ( !handlers ) {
+ handlers = events[ type ] = [];
+
+ // Check for a special event handler
+ // Only use addEventListener/attachEvent if the special
+ // events handler returns false
+ if ( !special.setup || special.setup.call( elem, data, namespaces, eventHandle ) === false ) {
+ // Bind the global event handler to the element
+ if ( elem.addEventListener ) {
+ elem.addEventListener( type, eventHandle, false );
+
+ } else if ( elem.attachEvent ) {
+ elem.attachEvent( "on" + type, eventHandle );
+ }
+ }
+ }
+
+ if ( special.add ) {
+ special.add.call( elem, handleObj );
+
+ if ( !handleObj.handler.guid ) {
+ handleObj.handler.guid = handler.guid;
+ }
+ }
+
+ // Add the function to the element's handler list
+ handlers.push( handleObj );
+
+ // Keep track of which events have been used, for global triggering
+ jQuery.event.global[ type ] = true;
+ }
+
+ // Nullify elem to prevent memory leaks in IE
+ elem = null;
+ },
+
+ global: {},
+
+ // Detach an event or set of events from an element
+ remove: function( elem, types, handler, pos ) {
+ // don't do events on text and comment nodes
+ if ( elem.nodeType === 3 || elem.nodeType === 8 ) {
+ return;
+ }
+
+ if ( handler === false ) {
+ handler = returnFalse;
+ }
+
+ var ret, type, fn, j, i = 0, all, namespaces, namespace, special, eventType, handleObj, origType,
+ eventKey = elem.nodeType ? "events" : "__events__",
+ elemData = jQuery.data( elem ),
+ events = elemData && elemData[ eventKey ];
+
+ if ( !elemData || !events ) {
+ return;
+ }
+
+ if ( typeof events === "function" ) {
+ elemData = events;
+ events = events.events;
+ }
+
+ // types is actually an event object here
+ if ( types && types.type ) {
+ handler = types.handler;
+ types = types.type;
+ }
+
+ // Unbind all events for the element
+ if ( !types || typeof types === "string" && types.charAt(0) === "." ) {
+ types = types || "";
+
+ for ( type in events ) {
+ jQuery.event.remove( elem, type + types );
+ }
+
+ return;
+ }
+
+ // Handle multiple events separated by a space
+ // jQuery(...).unbind("mouseover mouseout", fn);
+ types = types.split(" ");
+
+ while ( (type = types[ i++ ]) ) {
+ origType = type;
+ handleObj = null;
+ all = type.indexOf(".") < 0;
+ namespaces = [];
+
+ if ( !all ) {
+ // Namespaced event handlers
+ namespaces = type.split(".");
+ type = namespaces.shift();
+
+ namespace = new RegExp("(^|\\.)" +
+ jQuery.map( namespaces.slice(0).sort(), fcleanup ).join("\\.(?:.*\\.)?") + "(\\.|$)");
+ }
+
+ eventType = events[ type ];
+
+ if ( !eventType ) {
+ continue;
+ }
+
+ if ( !handler ) {
+ for ( j = 0; j < eventType.length; j++ ) {
+ handleObj = eventType[ j ];
+
+ if ( all || namespace.test( handleObj.namespace ) ) {
+ jQuery.event.remove( elem, origType, handleObj.handler, j );
+ eventType.splice( j--, 1 );
+ }
+ }
+
+ continue;
+ }
+
+ special = jQuery.event.special[ type ] || {};
+
+ for ( j = pos || 0; j < eventType.length; j++ ) {
+ handleObj = eventType[ j ];
+
+ if ( handler.guid === handleObj.guid ) {
+ // remove the given handler for the given type
+ if ( all || namespace.test( handleObj.namespace ) ) {
+ if ( pos == null ) {
+ eventType.splice( j--, 1 );
+ }
+
+ if ( special.remove ) {
+ special.remove.call( elem, handleObj );
+ }
+ }
+
+ if ( pos != null ) {
+ break;
+ }
+ }
+ }
+
+ // remove generic event handler if no more handlers exist
+ if ( eventType.length === 0 || pos != null && eventType.length === 1 ) {
+ if ( !special.teardown || special.teardown.call( elem, namespaces ) === false ) {
+ jQuery.removeEvent( elem, type, elemData.handle );
+ }
+
+ ret = null;
+ delete events[ type ];
+ }
+ }
+
+ // Remove the expando if it's no longer used
+ if ( jQuery.isEmptyObject( events ) ) {
+ var handle = elemData.handle;
+ if ( handle ) {
+ handle.elem = null;
+ }
+
+ delete elemData.events;
+ delete elemData.handle;
+
+ if ( typeof elemData === "function" ) {
+ jQuery.removeData( elem, eventKey );
+
+ } else if ( jQuery.isEmptyObject( elemData ) ) {
+ jQuery.removeData( elem );
+ }
+ }
+ },
+
+ // bubbling is internal
+ trigger: function( event, data, elem /*, bubbling */ ) {
+ // Event object or event type
+ var type = event.type || event,
+ bubbling = arguments[3];
+
+ if ( !bubbling ) {
+ event = typeof event === "object" ?
+ // jQuery.Event object
+ event[ jQuery.expando ] ? event :
+ // Object literal
+ jQuery.extend( jQuery.Event(type), event ) :
+ // Just the event type (string)
+ jQuery.Event(type);
+
+ if ( type.indexOf("!") >= 0 ) {
+ event.type = type = type.slice(0, -1);
+ event.exclusive = true;
+ }
+
+ // Handle a global trigger
+ if ( !elem ) {
+ // Don't bubble custom events when global (to avoid too much overhead)
+ event.stopPropagation();
+
+ // Only trigger if we've ever bound an event for it
+ if ( jQuery.event.global[ type ] ) {
+ jQuery.each( jQuery.cache, function() {
+ if ( this.events && this.events[type] ) {
+ jQuery.event.trigger( event, data, this.handle.elem );
+ }
+ });
+ }
+ }
+
+ // Handle triggering a single element
+
+ // don't do events on text and comment nodes
+ if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 ) {
+ return undefined;
+ }
+
+ // Clean up in case it is reused
+ event.result = undefined;
+ event.target = elem;
+
+ // Clone the incoming data, if any
+ data = jQuery.makeArray( data );
+ data.unshift( event );
+ }
+
+ event.currentTarget = elem;
+
+ // Trigger the event, it is assumed that "handle" is a function
+ var handle = elem.nodeType ?
+ jQuery.data( elem, "handle" ) :
+ (jQuery.data( elem, "__events__" ) || {}).handle;
+
+ if ( handle ) {
+ handle.apply( elem, data );
+ }
+
+ var parent = elem.parentNode || elem.ownerDocument;
+
+ // Trigger an inline bound script
+ try {
+ if ( !(elem && elem.nodeName && jQuery.noData[elem.nodeName.toLowerCase()]) ) {
+ if ( elem[ "on" + type ] && elem[ "on" + type ].apply( elem, data ) === false ) {
+ event.result = false;
+ event.preventDefault();
+ }
+ }
+
+ // prevent IE from throwing an error for some elements with some event types, see #3533
+ } catch (inlineError) {}
+
+ if ( !event.isPropagationStopped() && parent ) {
+ jQuery.event.trigger( event, data, parent, true );
+
+ } else if ( !event.isDefaultPrevented() ) {
+ var old,
+ target = event.target,
+ targetType = type.replace( rnamespaces, "" ),
+ isClick = jQuery.nodeName( target, "a" ) && targetType === "click",
+ special = jQuery.event.special[ targetType ] || {};
+
+ if ( (!special._default || special._default.call( elem, event ) === false) &&
+ !isClick && !(target && target.nodeName && jQuery.noData[target.nodeName.toLowerCase()]) ) {
+
+ try {
+ if ( target[ targetType ] ) {
+ // Make sure that we don't accidentally re-trigger the onFOO events
+ old = target[ "on" + targetType ];
+
+ if ( old ) {
+ target[ "on" + targetType ] = null;
+ }
+
+ jQuery.event.triggered = true;
+ target[ targetType ]();
+ }
+
+ // prevent IE from throwing an error for some elements with some event types, see #3533
+ } catch (triggerError) {}
+
+ if ( old ) {
+ target[ "on" + targetType ] = old;
+ }
+
+ jQuery.event.triggered = false;
+ }
+ }
+ },
+
+ handle: function( event ) {
+ var all, handlers, namespaces, namespace_re, events,
+ namespace_sort = [],
+ args = jQuery.makeArray( arguments );
+
+ event = args[0] = jQuery.event.fix( event || window.event );
+ event.currentTarget = this;
+
+ // Namespaced event handlers
+ all = event.type.indexOf(".") < 0 && !event.exclusive;
+
+ if ( !all ) {
+ namespaces = event.type.split(".");
+ event.type = namespaces.shift();
+ namespace_sort = namespaces.slice(0).sort();
+ namespace_re = new RegExp("(^|\\.)" + namespace_sort.join("\\.(?:.*\\.)?") + "(\\.|$)");
+ }
+
+ event.namespace = event.namespace || namespace_sort.join(".");
+
+ events = jQuery.data(this, this.nodeType ? "events" : "__events__");
+
+ if ( typeof events === "function" ) {
+ events = events.events;
+ }
+
+ handlers = (events || {})[ event.type ];
+
+ if ( events && handlers ) {
+ // Clone the handlers to prevent manipulation
+ handlers = handlers.slice(0);
+
+ for ( var j = 0, l = handlers.length; j < l; j++ ) {
+ var handleObj = handlers[ j ];
+
+ // Filter the functions by class
+ if ( all || namespace_re.test( handleObj.namespace ) ) {
+ // Pass in a reference to the handler function itself
+ // So that we can later remove it
+ event.handler = handleObj.handler;
+ event.data = handleObj.data;
+ event.handleObj = handleObj;
+
+ var ret = handleObj.handler.apply( this, args );
+
+ if ( ret !== undefined ) {
+ event.result = ret;
+ if ( ret === false ) {
+ event.preventDefault();
+ event.stopPropagation();
+ }
+ }
+
+ if ( event.isImmediatePropagationStopped() ) {
+ break;
+ }
+ }
+ }
+ }
+
+ return event.result;
+ },
+
+ props: "altKey attrChange attrName bubbles button cancelable charCode clientX clientY ctrlKey currentTarget data detail eventPhase fromElement handler keyCode layerX layerY metaKey newValue offsetX offsetY pageX pageY prevValue relatedNode relatedTarget screenX screenY shiftKey srcElement target toElement view wheelDelta which".split(" "),
+
+ fix: function( event ) {
+ if ( event[ jQuery.expando ] ) {
+ return event;
+ }
+
+ // store a copy of the original event object
+ // and "clone" to set read-only properties
+ var originalEvent = event;
+ event = jQuery.Event( originalEvent );
+
+ for ( var i = this.props.length, prop; i; ) {
+ prop = this.props[ --i ];
+ event[ prop ] = originalEvent[ prop ];
+ }
+
+ // Fix target property, if necessary
+ if ( !event.target ) {
+ // Fixes #1925 where srcElement might not be defined either
+ event.target = event.srcElement || document;
+ }
+
+ // check if target is a textnode (safari)
+ if ( event.target.nodeType === 3 ) {
+ event.target = event.target.parentNode;
+ }
+
+ // Add relatedTarget, if necessary
+ if ( !event.relatedTarget && event.fromElement ) {
+ event.relatedTarget = event.fromElement === event.target ? event.toElement : event.fromElement;
+ }
+
+ // Calculate pageX/Y if missing and clientX/Y available
+ if ( event.pageX == null && event.clientX != null ) {
+ var doc = document.documentElement,
+ body = document.body;
+
+ event.pageX = event.clientX + (doc && doc.scrollLeft || body && body.scrollLeft || 0) - (doc && doc.clientLeft || body && body.clientLeft || 0);
+ event.pageY = event.clientY + (doc && doc.scrollTop || body && body.scrollTop || 0) - (doc && doc.clientTop || body && body.clientTop || 0);
+ }
+
+ // Add which for key events
+ if ( event.which == null && (event.charCode != null || event.keyCode != null) ) {
+ event.which = event.charCode != null ? event.charCode : event.keyCode;
+ }
+
+ // Add metaKey to non-Mac browsers (use ctrl for PC's and Meta for Macs)
+ if ( !event.metaKey && event.ctrlKey ) {
+ event.metaKey = event.ctrlKey;
+ }
+
+ // Add which for click: 1 === left; 2 === middle; 3 === right
+ // Note: button is not normalized, so don't use it
+ if ( !event.which && event.button !== undefined ) {
+ event.which = (event.button & 1 ? 1 : ( event.button & 2 ? 3 : ( event.button & 4 ? 2 : 0 ) ));
+ }
+
+ return event;
+ },
+
+ // Deprecated, use jQuery.guid instead
+ guid: 1E8,
+
+ // Deprecated, use jQuery.proxy instead
+ proxy: jQuery.proxy,
+
+ special: {
+ ready: {
+ // Make sure the ready event is setup
+ setup: jQuery.bindReady,
+ teardown: jQuery.noop
+ },
+
+ live: {
+ add: function( handleObj ) {
+ jQuery.event.add( this,
+ liveConvert( handleObj.origType, handleObj.selector ),
+ jQuery.extend({}, handleObj, {handler: liveHandler, guid: handleObj.handler.guid}) );
+ },
+
+ remove: function( handleObj ) {
+ jQuery.event.remove( this, liveConvert( handleObj.origType, handleObj.selector ), handleObj );
+ }
+ },
+
+ beforeunload: {
+ setup: function( data, namespaces, eventHandle ) {
+ // We only want to do this special case on windows
+ if ( jQuery.isWindow( this ) ) {
+ this.onbeforeunload = eventHandle;
+ }
+ },
+
+ teardown: function( namespaces, eventHandle ) {
+ if ( this.onbeforeunload === eventHandle ) {
+ this.onbeforeunload = null;
+ }
+ }
+ }
+ }
+};
+
+jQuery.removeEvent = document.removeEventListener ?
+ function( elem, type, handle ) {
+ if ( elem.removeEventListener ) {
+ elem.removeEventListener( type, handle, false );
+ }
+ } :
+ function( elem, type, handle ) {
+ if ( elem.detachEvent ) {
+ elem.detachEvent( "on" + type, handle );
+ }
+ };
+
+jQuery.Event = function( src ) {
+ // Allow instantiation without the 'new' keyword
+ if ( !this.preventDefault ) {
+ return new jQuery.Event( src );
+ }
+
+ // Event object
+ if ( src && src.type ) {
+ this.originalEvent = src;
+ this.type = src.type;
+ // Event type
+ } else {
+ this.type = src;
+ }
+
+ // timeStamp is buggy for some events on Firefox(#3843)
+ // So we won't rely on the native value
+ this.timeStamp = jQuery.now();
+
+ // Mark it as fixed
+ this[ jQuery.expando ] = true;
+};
+
+function returnFalse() {
+ return false;
+}
+function returnTrue() {
+ return true;
+}
+
+// jQuery.Event is based on DOM3 Events as specified by the ECMAScript Language Binding
+// http://www.w3.org/TR/2003/WD-DOM-Level-3-Events-20030331/ecma-script-binding.html
+jQuery.Event.prototype = {
+ preventDefault: function() {
+ this.isDefaultPrevented = returnTrue;
+
+ var e = this.originalEvent;
+ if ( !e ) {
+ return;
+ }
+
+ // if preventDefault exists run it on the original event
+ if ( e.preventDefault ) {
+ e.preventDefault();
+
+ // otherwise set the returnValue property of the original event to false (IE)
+ } else {
+ e.returnValue = false;
+ }
+ },
+ stopPropagation: function() {
+ this.isPropagationStopped = returnTrue;
+
+ var e = this.originalEvent;
+ if ( !e ) {
+ return;
+ }
+ // if stopPropagation exists run it on the original event
+ if ( e.stopPropagation ) {
+ e.stopPropagation();
+ }
+ // otherwise set the cancelBubble property of the original event to true (IE)
+ e.cancelBubble = true;
+ },
+ stopImmediatePropagation: function() {
+ this.isImmediatePropagationStopped = returnTrue;
+ this.stopPropagation();
+ },
+ isDefaultPrevented: returnFalse,
+ isPropagationStopped: returnFalse,
+ isImmediatePropagationStopped: returnFalse
+};
+
+// Checks if an event happened on an element within another element
+// Used in jQuery.event.special.mouseenter and mouseleave handlers
+var withinElement = function( event ) {
+ // Check if mouse(over|out) are still within the same parent element
+ var parent = event.relatedTarget;
+
+ // Firefox sometimes assigns relatedTarget a XUL element
+ // which we cannot access the parentNode property of
+ try {
+ // Traverse up the tree
+ while ( parent && parent !== this ) {
+ parent = parent.parentNode;
+ }
+
+ if ( parent !== this ) {
+ // set the correct event type
+ event.type = event.data;
+
+ // handle event if we actually just moused on to a non sub-element
+ jQuery.event.handle.apply( this, arguments );
+ }
+
+ // assuming we've left the element since we most likely mousedover a xul element
+ } catch(e) { }
+},
+
+// In case of event delegation, we only need to rename the event.type,
+// liveHandler will take care of the rest.
+delegate = function( event ) {
+ event.type = event.data;
+ jQuery.event.handle.apply( this, arguments );
+};
+
+// Create mouseenter and mouseleave events
+jQuery.each({
+ mouseenter: "mouseover",
+ mouseleave: "mouseout"
+}, function( orig, fix ) {
+ jQuery.event.special[ orig ] = {
+ setup: function( data ) {
+ jQuery.event.add( this, fix, data && data.selector ? delegate : withinElement, orig );
+ },
+ teardown: function( data ) {
+ jQuery.event.remove( this, fix, data && data.selector ? delegate : withinElement );
+ }
+ };
+});
+
+// submit delegation
+if ( !jQuery.support.submitBubbles ) {
+
+ jQuery.event.special.submit = {
+ setup: function( data, namespaces ) {
+ if ( this.nodeName.toLowerCase() !== "form" ) {
+ jQuery.event.add(this, "click.specialSubmit", function( e ) {
+ var elem = e.target,
+ type = elem.type;
+
+ if ( (type === "submit" || type === "image") && jQuery( elem ).closest("form").length ) {
+ e.liveFired = undefined;
+ return trigger( "submit", this, arguments );
+ }
+ });
+
+ jQuery.event.add(this, "keypress.specialSubmit", function( e ) {
+ var elem = e.target,
+ type = elem.type;
+
+ if ( (type === "text" || type === "password") && jQuery( elem ).closest("form").length && e.keyCode === 13 ) {
+ e.liveFired = undefined;
+ return trigger( "submit", this, arguments );
+ }
+ });
+
+ } else {
+ return false;
+ }
+ },
+
+ teardown: function( namespaces ) {
+ jQuery.event.remove( this, ".specialSubmit" );
+ }
+ };
+
+}
+
+// change delegation, happens here so we have bind.
+if ( !jQuery.support.changeBubbles ) {
+
+ var changeFilters,
+
+ getVal = function( elem ) {
+ var type = elem.type, val = elem.value;
+
+ if ( type === "radio" || type === "checkbox" ) {
+ val = elem.checked;
+
+ } else if ( type === "select-multiple" ) {
+ val = elem.selectedIndex > -1 ?
+ jQuery.map( elem.options, function( elem ) {
+ return elem.selected;
+ }).join("-") :
+ "";
+
+ } else if ( elem.nodeName.toLowerCase() === "select" ) {
+ val = elem.selectedIndex;
+ }
+
+ return val;
+ },
+
+ testChange = function testChange( e ) {
+ var elem = e.target, data, val;
+
+ if ( !rformElems.test( elem.nodeName ) || elem.readOnly ) {
+ return;
+ }
+
+ data = jQuery.data( elem, "_change_data" );
+ val = getVal(elem);
+
+ // the current data will be also retrieved by beforeactivate
+ if ( e.type !== "focusout" || elem.type !== "radio" ) {
+ jQuery.data( elem, "_change_data", val );
+ }
+
+ if ( data === undefined || val === data ) {
+ return;
+ }
+
+ if ( data != null || val ) {
+ e.type = "change";
+ e.liveFired = undefined;
+ return jQuery.event.trigger( e, arguments[1], elem );
+ }
+ };
+
+ jQuery.event.special.change = {
+ filters: {
+ focusout: testChange,
+
+ beforedeactivate: testChange,
+
+ click: function( e ) {
+ var elem = e.target, type = elem.type;
+
+ if ( type === "radio" || type === "checkbox" || elem.nodeName.toLowerCase() === "select" ) {
+ return testChange.call( this, e );
+ }
+ },
+
+ // Change has to be called before submit
+ // Keydown will be called before keypress, which is used in submit-event delegation
+ keydown: function( e ) {
+ var elem = e.target, type = elem.type;
+
+ if ( (e.keyCode === 13 && elem.nodeName.toLowerCase() !== "textarea") ||
+ (e.keyCode === 32 && (type === "checkbox" || type === "radio")) ||
+ type === "select-multiple" ) {
+ return testChange.call( this, e );
+ }
+ },
+
+ // Beforeactivate happens also before the previous element is blurred
+ // with this event you can't trigger a change event, but you can store
+ // information
+ beforeactivate: function( e ) {
+ var elem = e.target;
+ jQuery.data( elem, "_change_data", getVal(elem) );
+ }
+ },
+
+ setup: function( data, namespaces ) {
+ if ( this.type === "file" ) {
+ return false;
+ }
+
+ for ( var type in changeFilters ) {
+ jQuery.event.add( this, type + ".specialChange", changeFilters[type] );
+ }
+
+ return rformElems.test( this.nodeName );
+ },
+
+ teardown: function( namespaces ) {
+ jQuery.event.remove( this, ".specialChange" );
+
+ return rformElems.test( this.nodeName );
+ }
+ };
+
+ changeFilters = jQuery.event.special.change.filters;
+
+ // Handle when the input is .focus()'d
+ changeFilters.focus = changeFilters.beforeactivate;
+}
+
+function trigger( type, elem, args ) {
+ args[0].type = type;
+ return jQuery.event.handle.apply( elem, args );
+}
+
+// Create "bubbling" focus and blur events
+if ( document.addEventListener ) {
+ jQuery.each({ focus: "focusin", blur: "focusout" }, function( orig, fix ) {
+ jQuery.event.special[ fix ] = {
+ setup: function() {
+ if ( focusCounts[fix]++ === 0 ) {
+ document.addEventListener( orig, handler, true );
+ }
+ },
+ teardown: function() {
+ if ( --focusCounts[fix] === 0 ) {
+ document.removeEventListener( orig, handler, true );
+ }
+ }
+ };
+
+ function handler( e ) {
+ e = jQuery.event.fix( e );
+ e.type = fix;
+ return jQuery.event.trigger( e, null, e.target );
+ }
+ });
+}
+
+jQuery.each(["bind", "one"], function( i, name ) {
+ jQuery.fn[ name ] = function( type, data, fn ) {
+ // Handle object literals
+ if ( typeof type === "object" ) {
+ for ( var key in type ) {
+ this[ name ](key, data, type[key], fn);
+ }
+ return this;
+ }
+
+ if ( jQuery.isFunction( data ) || data === false ) {
+ fn = data;
+ data = undefined;
+ }
+
+ var handler = name === "one" ? jQuery.proxy( fn, function( event ) {
+ jQuery( this ).unbind( event, handler );
+ return fn.apply( this, arguments );
+ }) : fn;
+
+ if ( type === "unload" && name !== "one" ) {
+ this.one( type, data, fn );
+
+ } else {
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ jQuery.event.add( this[i], type, handler, data );
+ }
+ }
+
+ return this;
+ };
+});
+
+jQuery.fn.extend({
+ unbind: function( type, fn ) {
+ // Handle object literals
+ if ( typeof type === "object" && !type.preventDefault ) {
+ for ( var key in type ) {
+ this.unbind(key, type[key]);
+ }
+
+ } else {
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ jQuery.event.remove( this[i], type, fn );
+ }
+ }
+
+ return this;
+ },
+
+ delegate: function( selector, types, data, fn ) {
+ return this.live( types, data, fn, selector );
+ },
+
+ undelegate: function( selector, types, fn ) {
+ if ( arguments.length === 0 ) {
+ return this.unbind( "live" );
+
+ } else {
+ return this.die( types, null, fn, selector );
+ }
+ },
+
+ trigger: function( type, data ) {
+ return this.each(function() {
+ jQuery.event.trigger( type, data, this );
+ });
+ },
+
+ triggerHandler: function( type, data ) {
+ if ( this[0] ) {
+ var event = jQuery.Event( type );
+ event.preventDefault();
+ event.stopPropagation();
+ jQuery.event.trigger( event, data, this[0] );
+ return event.result;
+ }
+ },
+
+ toggle: function( fn ) {
+ // Save reference to arguments for access in closure
+ var args = arguments,
+ i = 1;
+
+ // link all the functions, so any of them can unbind this click handler
+ while ( i < args.length ) {
+ jQuery.proxy( fn, args[ i++ ] );
+ }
+
+ return this.click( jQuery.proxy( fn, function( event ) {
+ // Figure out which function to execute
+ var lastToggle = ( jQuery.data( this, "lastToggle" + fn.guid ) || 0 ) % i;
+ jQuery.data( this, "lastToggle" + fn.guid, lastToggle + 1 );
+
+ // Make sure that clicks stop
+ event.preventDefault();
+
+ // and execute the function
+ return args[ lastToggle ].apply( this, arguments ) || false;
+ }));
+ },
+
+ hover: function( fnOver, fnOut ) {
+ return this.mouseenter( fnOver ).mouseleave( fnOut || fnOver );
+ }
+});
+
+var liveMap = {
+ focus: "focusin",
+ blur: "focusout",
+ mouseenter: "mouseover",
+ mouseleave: "mouseout"
+};
+
+jQuery.each(["live", "die"], function( i, name ) {
+ jQuery.fn[ name ] = function( types, data, fn, origSelector /* Internal Use Only */ ) {
+ var type, i = 0, match, namespaces, preType,
+ selector = origSelector || this.selector,
+ context = origSelector ? this : jQuery( this.context );
+
+ if ( typeof types === "object" && !types.preventDefault ) {
+ for ( var key in types ) {
+ context[ name ]( key, data, types[key], selector );
+ }
+
+ return this;
+ }
+
+ if ( jQuery.isFunction( data ) ) {
+ fn = data;
+ data = undefined;
+ }
+
+ types = (types || "").split(" ");
+
+ while ( (type = types[ i++ ]) != null ) {
+ match = rnamespaces.exec( type );
+ namespaces = "";
+
+ if ( match ) {
+ namespaces = match[0];
+ type = type.replace( rnamespaces, "" );
+ }
+
+ if ( type === "hover" ) {
+ types.push( "mouseenter" + namespaces, "mouseleave" + namespaces );
+ continue;
+ }
+
+ preType = type;
+
+ if ( type === "focus" || type === "blur" ) {
+ types.push( liveMap[ type ] + namespaces );
+ type = type + namespaces;
+
+ } else {
+ type = (liveMap[ type ] || type) + namespaces;
+ }
+
+ if ( name === "live" ) {
+ // bind live handler
+ for ( var j = 0, l = context.length; j < l; j++ ) {
+ jQuery.event.add( context[j], "live." + liveConvert( type, selector ),
+ { data: data, selector: selector, handler: fn, origType: type, origHandler: fn, preType: preType } );
+ }
+
+ } else {
+ // unbind live handler
+ context.unbind( "live." + liveConvert( type, selector ), fn );
+ }
+ }
+
+ return this;
+ };
+});
+
+function liveHandler( event ) {
+ var stop, maxLevel, related, match, handleObj, elem, j, i, l, data, close, namespace, ret,
+ elems = [],
+ selectors = [],
+ events = jQuery.data( this, this.nodeType ? "events" : "__events__" );
+
+ if ( typeof events === "function" ) {
+ events = events.events;
+ }
+
+ // Make sure we avoid non-left-click bubbling in Firefox (#3861)
+ if ( event.liveFired === this || !events || !events.live || event.button && event.type === "click" ) {
+ return;
+ }
+
+ if ( event.namespace ) {
+ namespace = new RegExp("(^|\\.)" + event.namespace.split(".").join("\\.(?:.*\\.)?") + "(\\.|$)");
+ }
+
+ event.liveFired = this;
+
+ var live = events.live.slice(0);
+
+ for ( j = 0; j < live.length; j++ ) {
+ handleObj = live[j];
+
+ if ( handleObj.origType.replace( rnamespaces, "" ) === event.type ) {
+ selectors.push( handleObj.selector );
+
+ } else {
+ live.splice( j--, 1 );
+ }
+ }
+
+ match = jQuery( event.target ).closest( selectors, event.currentTarget );
+
+ for ( i = 0, l = match.length; i < l; i++ ) {
+ close = match[i];
+
+ for ( j = 0; j < live.length; j++ ) {
+ handleObj = live[j];
+
+ if ( close.selector === handleObj.selector && (!namespace || namespace.test( handleObj.namespace )) ) {
+ elem = close.elem;
+ related = null;
+
+ // Those two events require additional checking
+ if ( handleObj.preType === "mouseenter" || handleObj.preType === "mouseleave" ) {
+ event.type = handleObj.preType;
+ related = jQuery( event.relatedTarget ).closest( handleObj.selector )[0];
+ }
+
+ if ( !related || related !== elem ) {
+ elems.push({ elem: elem, handleObj: handleObj, level: close.level });
+ }
+ }
+ }
+ }
+
+ for ( i = 0, l = elems.length; i < l; i++ ) {
+ match = elems[i];
+
+ if ( maxLevel && match.level > maxLevel ) {
+ break;
+ }
+
+ event.currentTarget = match.elem;
+ event.data = match.handleObj.data;
+ event.handleObj = match.handleObj;
+
+ ret = match.handleObj.origHandler.apply( match.elem, arguments );
+
+ if ( ret === false || event.isPropagationStopped() ) {
+ maxLevel = match.level;
+
+ if ( ret === false ) {
+ stop = false;
+ }
+ if ( event.isImmediatePropagationStopped() ) {
+ break;
+ }
+ }
+ }
+
+ return stop;
+}
+
+function liveConvert( type, selector ) {
+ return (type && type !== "*" ? type + "." : "") + selector.replace(rperiod, "`").replace(rspace, "&");
+}
+
+jQuery.each( ("blur focus focusin focusout load resize scroll unload click dblclick " +
+ "mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave " +
+ "change select submit keydown keypress keyup error").split(" "), function( i, name ) {
+
+ // Handle event binding
+ jQuery.fn[ name ] = function( data, fn ) {
+ if ( fn == null ) {
+ fn = data;
+ data = null;
+ }
+
+ return arguments.length > 0 ?
+ this.bind( name, data, fn ) :
+ this.trigger( name );
+ };
+
+ if ( jQuery.attrFn ) {
+ jQuery.attrFn[ name ] = true;
+ }
+});
+
+// Prevent memory leaks in IE
+// Window isn't included so as not to unbind existing unload events
+// More info:
+// - http://isaacschlueter.com/2006/10/msie-memory-leaks/
+if ( window.attachEvent && !window.addEventListener ) {
+ jQuery(window).bind("unload", function() {
+ for ( var id in jQuery.cache ) {
+ if ( jQuery.cache[ id ].handle ) {
+ // Try/Catch is to handle iframes being unloaded, see #4280
+ try {
+ jQuery.event.remove( jQuery.cache[ id ].handle.elem );
+ } catch(e) {}
+ }
+ }
+ });
+}
+
+
+/*!
+ * Sizzle CSS Selector Engine - v1.0
+ * Copyright 2009, The Dojo Foundation
+ * Released under the MIT, BSD, and GPL Licenses.
+ * More information: http://sizzlejs.com/
+ */
+(function(){
+
+var chunker = /((?:\((?:\([^()]+\)|[^()]+)+\)|\[(?:\[[^\[\]]*\]|['"][^'"]*['"]|[^\[\]'"]+)+\]|\\.|[^ >+~,(\[\\]+)+|[>+~])(\s*,\s*)?((?:.|\r|\n)*)/g,
+ done = 0,
+ toString = Object.prototype.toString,
+ hasDuplicate = false,
+ baseHasDuplicate = true;
+
+// Here we check if the JavaScript engine is using some sort of
+// optimization where it does not always call our comparision
+// function. If that is the case, discard the hasDuplicate value.
+// Thus far that includes Google Chrome.
+[0, 0].sort(function() {
+ baseHasDuplicate = false;
+ return 0;
+});
+
+var Sizzle = function( selector, context, results, seed ) {
+ results = results || [];
+ context = context || document;
+
+ var origContext = context;
+
+ if ( context.nodeType !== 1 && context.nodeType !== 9 ) {
+ return [];
+ }
+
+ if ( !selector || typeof selector !== "string" ) {
+ return results;
+ }
+
+ var m, set, checkSet, extra, ret, cur, pop, i,
+ prune = true,
+ contextXML = Sizzle.isXML( context ),
+ parts = [],
+ soFar = selector;
+
+ // Reset the position of the chunker regexp (start from head)
+ do {
+ chunker.exec( "" );
+ m = chunker.exec( soFar );
+
+ if ( m ) {
+ soFar = m[3];
+
+ parts.push( m[1] );
+
+ if ( m[2] ) {
+ extra = m[3];
+ break;
+ }
+ }
+ } while ( m );
+
+ if ( parts.length > 1 && origPOS.exec( selector ) ) {
+
+ if ( parts.length === 2 && Expr.relative[ parts[0] ] ) {
+ set = posProcess( parts[0] + parts[1], context );
+
+ } else {
+ set = Expr.relative[ parts[0] ] ?
+ [ context ] :
+ Sizzle( parts.shift(), context );
+
+ while ( parts.length ) {
+ selector = parts.shift();
+
+ if ( Expr.relative[ selector ] ) {
+ selector += parts.shift();
+ }
+
+ set = posProcess( selector, set );
+ }
+ }
+
+ } else {
+ // Take a shortcut and set the context if the root selector is an ID
+ // (but not if it'll be faster if the inner selector is an ID)
+ if ( !seed && parts.length > 1 && context.nodeType === 9 && !contextXML &&
+ Expr.match.ID.test(parts[0]) && !Expr.match.ID.test(parts[parts.length - 1]) ) {
+
+ ret = Sizzle.find( parts.shift(), context, contextXML );
+ context = ret.expr ?
+ Sizzle.filter( ret.expr, ret.set )[0] :
+ ret.set[0];
+ }
+
+ if ( context ) {
+ ret = seed ?
+ { expr: parts.pop(), set: makeArray(seed) } :
+ Sizzle.find( parts.pop(), parts.length === 1 && (parts[0] === "~" || parts[0] === "+") && context.parentNode ? context.parentNode : context, contextXML );
+
+ set = ret.expr ?
+ Sizzle.filter( ret.expr, ret.set ) :
+ ret.set;
+
+ if ( parts.length > 0 ) {
+ checkSet = makeArray( set );
+
+ } else {
+ prune = false;
+ }
+
+ while ( parts.length ) {
+ cur = parts.pop();
+ pop = cur;
+
+ if ( !Expr.relative[ cur ] ) {
+ cur = "";
+ } else {
+ pop = parts.pop();
+ }
+
+ if ( pop == null ) {
+ pop = context;
+ }
+
+ Expr.relative[ cur ]( checkSet, pop, contextXML );
+ }
+
+ } else {
+ checkSet = parts = [];
+ }
+ }
+
+ if ( !checkSet ) {
+ checkSet = set;
+ }
+
+ if ( !checkSet ) {
+ Sizzle.error( cur || selector );
+ }
+
+ if ( toString.call(checkSet) === "[object Array]" ) {
+ if ( !prune ) {
+ results.push.apply( results, checkSet );
+
+ } else if ( context && context.nodeType === 1 ) {
+ for ( i = 0; checkSet[i] != null; i++ ) {
+ if ( checkSet[i] && (checkSet[i] === true || checkSet[i].nodeType === 1 && Sizzle.contains(context, checkSet[i])) ) {
+ results.push( set[i] );
+ }
+ }
+
+ } else {
+ for ( i = 0; checkSet[i] != null; i++ ) {
+ if ( checkSet[i] && checkSet[i].nodeType === 1 ) {
+ results.push( set[i] );
+ }
+ }
+ }
+
+ } else {
+ makeArray( checkSet, results );
+ }
+
+ if ( extra ) {
+ Sizzle( extra, origContext, results, seed );
+ Sizzle.uniqueSort( results );
+ }
+
+ return results;
+};
+
+Sizzle.uniqueSort = function( results ) {
+ if ( sortOrder ) {
+ hasDuplicate = baseHasDuplicate;
+ results.sort( sortOrder );
+
+ if ( hasDuplicate ) {
+ for ( var i = 1; i < results.length; i++ ) {
+ if ( results[i] === results[ i - 1 ] ) {
+ results.splice( i--, 1 );
+ }
+ }
+ }
+ }
+
+ return results;
+};
+
+Sizzle.matches = function( expr, set ) {
+ return Sizzle( expr, null, null, set );
+};
+
+Sizzle.matchesSelector = function( node, expr ) {
+ return Sizzle( expr, null, null, [node] ).length > 0;
+};
+
+Sizzle.find = function( expr, context, isXML ) {
+ var set;
+
+ if ( !expr ) {
+ return [];
+ }
+
+ for ( var i = 0, l = Expr.order.length; i < l; i++ ) {
+ var match,
+ type = Expr.order[i];
+
+ if ( (match = Expr.leftMatch[ type ].exec( expr )) ) {
+ var left = match[1];
+ match.splice( 1, 1 );
+
+ if ( left.substr( left.length - 1 ) !== "\\" ) {
+ match[1] = (match[1] || "").replace(/\\/g, "");
+ set = Expr.find[ type ]( match, context, isXML );
+
+ if ( set != null ) {
+ expr = expr.replace( Expr.match[ type ], "" );
+ break;
+ }
+ }
+ }
+ }
+
+ if ( !set ) {
+ set = context.getElementsByTagName( "*" );
+ }
+
+ return { set: set, expr: expr };
+};
+
+Sizzle.filter = function( expr, set, inplace, not ) {
+ var match, anyFound,
+ old = expr,
+ result = [],
+ curLoop = set,
+ isXMLFilter = set && set[0] && Sizzle.isXML( set[0] );
+
+ while ( expr && set.length ) {
+ for ( var type in Expr.filter ) {
+ if ( (match = Expr.leftMatch[ type ].exec( expr )) != null && match[2] ) {
+ var found, item,
+ filter = Expr.filter[ type ],
+ left = match[1];
+
+ anyFound = false;
+
+ match.splice(1,1);
+
+ if ( left.substr( left.length - 1 ) === "\\" ) {
+ continue;
+ }
+
+ if ( curLoop === result ) {
+ result = [];
+ }
+
+ if ( Expr.preFilter[ type ] ) {
+ match = Expr.preFilter[ type ]( match, curLoop, inplace, result, not, isXMLFilter );
+
+ if ( !match ) {
+ anyFound = found = true;
+
+ } else if ( match === true ) {
+ continue;
+ }
+ }
+
+ if ( match ) {
+ for ( var i = 0; (item = curLoop[i]) != null; i++ ) {
+ if ( item ) {
+ found = filter( item, match, i, curLoop );
+ var pass = not ^ !!found;
+
+ if ( inplace && found != null ) {
+ if ( pass ) {
+ anyFound = true;
+
+ } else {
+ curLoop[i] = false;
+ }
+
+ } else if ( pass ) {
+ result.push( item );
+ anyFound = true;
+ }
+ }
+ }
+ }
+
+ if ( found !== undefined ) {
+ if ( !inplace ) {
+ curLoop = result;
+ }
+
+ expr = expr.replace( Expr.match[ type ], "" );
+
+ if ( !anyFound ) {
+ return [];
+ }
+
+ break;
+ }
+ }
+ }
+
+ // Improper expression
+ if ( expr === old ) {
+ if ( anyFound == null ) {
+ Sizzle.error( expr );
+
+ } else {
+ break;
+ }
+ }
+
+ old = expr;
+ }
+
+ return curLoop;
+};
+
+Sizzle.error = function( msg ) {
+ throw "Syntax error, unrecognized expression: " + msg;
+};
+
+var Expr = Sizzle.selectors = {
+ order: [ "ID", "NAME", "TAG" ],
+
+ match: {
+ ID: /#((?:[\w\u00c0-\uFFFF\-]|\\.)+)/,
+ CLASS: /\.((?:[\w\u00c0-\uFFFF\-]|\\.)+)/,
+ NAME: /\[name=['"]*((?:[\w\u00c0-\uFFFF\-]|\\.)+)['"]*\]/,
+ ATTR: /\[\s*((?:[\w\u00c0-\uFFFF\-]|\\.)+)\s*(?:(\S?=)\s*(['"]*)(.*?)\3|)\s*\]/,
+ TAG: /^((?:[\w\u00c0-\uFFFF\*\-]|\\.)+)/,
+ CHILD: /:(only|nth|last|first)-child(?:\((even|odd|[\dn+\-]*)\))?/,
+ POS: /:(nth|eq|gt|lt|first|last|even|odd)(?:\((\d*)\))?(?=[^\-]|$)/,
+ PSEUDO: /:((?:[\w\u00c0-\uFFFF\-]|\\.)+)(?:\((['"]?)((?:\([^\)]+\)|[^\(\)]*)+)\2\))?/
+ },
+
+ leftMatch: {},
+
+ attrMap: {
+ "class": "className",
+ "for": "htmlFor"
+ },
+
+ attrHandle: {
+ href: function( elem ) {
+ return elem.getAttribute( "href" );
+ }
+ },
+
+ relative: {
+ "+": function(checkSet, part){
+ var isPartStr = typeof part === "string",
+ isTag = isPartStr && !/\W/.test( part ),
+ isPartStrNotTag = isPartStr && !isTag;
+
+ if ( isTag ) {
+ part = part.toLowerCase();
+ }
+
+ for ( var i = 0, l = checkSet.length, elem; i < l; i++ ) {
+ if ( (elem = checkSet[i]) ) {
+ while ( (elem = elem.previousSibling) && elem.nodeType !== 1 ) {}
+
+ checkSet[i] = isPartStrNotTag || elem && elem.nodeName.toLowerCase() === part ?
+ elem || false :
+ elem === part;
+ }
+ }
+
+ if ( isPartStrNotTag ) {
+ Sizzle.filter( part, checkSet, true );
+ }
+ },
+
+ ">": function( checkSet, part ) {
+ var elem,
+ isPartStr = typeof part === "string",
+ i = 0,
+ l = checkSet.length;
+
+ if ( isPartStr && !/\W/.test( part ) ) {
+ part = part.toLowerCase();
+
+ for ( ; i < l; i++ ) {
+ elem = checkSet[i];
+
+ if ( elem ) {
+ var parent = elem.parentNode;
+ checkSet[i] = parent.nodeName.toLowerCase() === part ? parent : false;
+ }
+ }
+
+ } else {
+ for ( ; i < l; i++ ) {
+ elem = checkSet[i];
+
+ if ( elem ) {
+ checkSet[i] = isPartStr ?
+ elem.parentNode :
+ elem.parentNode === part;
+ }
+ }
+
+ if ( isPartStr ) {
+ Sizzle.filter( part, checkSet, true );
+ }
+ }
+ },
+
+ "": function(checkSet, part, isXML){
+ var nodeCheck,
+ doneName = done++,
+ checkFn = dirCheck;
+
+ if ( typeof part === "string" && !/\W/.test(part) ) {
+ part = part.toLowerCase();
+ nodeCheck = part;
+ checkFn = dirNodeCheck;
+ }
+
+ checkFn( "parentNode", part, doneName, checkSet, nodeCheck, isXML );
+ },
+
+ "~": function( checkSet, part, isXML ) {
+ var nodeCheck,
+ doneName = done++,
+ checkFn = dirCheck;
+
+ if ( typeof part === "string" && !/\W/.test( part ) ) {
+ part = part.toLowerCase();
+ nodeCheck = part;
+ checkFn = dirNodeCheck;
+ }
+
+ checkFn( "previousSibling", part, doneName, checkSet, nodeCheck, isXML );
+ }
+ },
+
+ find: {
+ ID: function( match, context, isXML ) {
+ if ( typeof context.getElementById !== "undefined" && !isXML ) {
+ var m = context.getElementById(match[1]);
+ // Check parentNode to catch when Blackberry 4.6 returns
+ // nodes that are no longer in the document #6963
+ return m && m.parentNode ? [m] : [];
+ }
+ },
+
+ NAME: function( match, context ) {
+ if ( typeof context.getElementsByName !== "undefined" ) {
+ var ret = [],
+ results = context.getElementsByName( match[1] );
+
+ for ( var i = 0, l = results.length; i < l; i++ ) {
+ if ( results[i].getAttribute("name") === match[1] ) {
+ ret.push( results[i] );
+ }
+ }
+
+ return ret.length === 0 ? null : ret;
+ }
+ },
+
+ TAG: function( match, context ) {
+ return context.getElementsByTagName( match[1] );
+ }
+ },
+ preFilter: {
+ CLASS: function( match, curLoop, inplace, result, not, isXML ) {
+ match = " " + match[1].replace(/\\/g, "") + " ";
+
+ if ( isXML ) {
+ return match;
+ }
+
+ for ( var i = 0, elem; (elem = curLoop[i]) != null; i++ ) {
+ if ( elem ) {
+ if ( not ^ (elem.className && (" " + elem.className + " ").replace(/[\t\n]/g, " ").indexOf(match) >= 0) ) {
+ if ( !inplace ) {
+ result.push( elem );
+ }
+
+ } else if ( inplace ) {
+ curLoop[i] = false;
+ }
+ }
+ }
+
+ return false;
+ },
+
+ ID: function( match ) {
+ return match[1].replace(/\\/g, "");
+ },
+
+ TAG: function( match, curLoop ) {
+ return match[1].toLowerCase();
+ },
+
+ CHILD: function( match ) {
+ if ( match[1] === "nth" ) {
+ // parse equations like 'even', 'odd', '5', '2n', '3n+2', '4n-1', '-n+6'
+ var test = /(-?)(\d*)n((?:\+|-)?\d*)/.exec(
+ match[2] === "even" && "2n" || match[2] === "odd" && "2n+1" ||
+ !/\D/.test( match[2] ) && "0n+" + match[2] || match[2]);
+
+ // calculate the numbers (first)n+(last) including if they are negative
+ match[2] = (test[1] + (test[2] || 1)) - 0;
+ match[3] = test[3] - 0;
+ }
+
+ // TODO: Move to normal caching system
+ match[0] = done++;
+
+ return match;
+ },
+
+ ATTR: function( match, curLoop, inplace, result, not, isXML ) {
+ var name = match[1].replace(/\\/g, "");
+
+ if ( !isXML && Expr.attrMap[name] ) {
+ match[1] = Expr.attrMap[name];
+ }
+
+ if ( match[2] === "~=" ) {
+ match[4] = " " + match[4] + " ";
+ }
+
+ return match;
+ },
+
+ PSEUDO: function( match, curLoop, inplace, result, not ) {
+ if ( match[1] === "not" ) {
+ // If we're dealing with a complex expression, or a simple one
+ if ( ( chunker.exec(match[3]) || "" ).length > 1 || /^\w/.test(match[3]) ) {
+ match[3] = Sizzle(match[3], null, null, curLoop);
+
+ } else {
+ var ret = Sizzle.filter(match[3], curLoop, inplace, true ^ not);
+
+ if ( !inplace ) {
+ result.push.apply( result, ret );
+ }
+
+ return false;
+ }
+
+ } else if ( Expr.match.POS.test( match[0] ) || Expr.match.CHILD.test( match[0] ) ) {
+ return true;
+ }
+
+ return match;
+ },
+
+ POS: function( match ) {
+ match.unshift( true );
+
+ return match;
+ }
+ },
+
+ filters: {
+ enabled: function( elem ) {
+ return elem.disabled === false && elem.type !== "hidden";
+ },
+
+ disabled: function( elem ) {
+ return elem.disabled === true;
+ },
+
+ checked: function( elem ) {
+ return elem.checked === true;
+ },
+
+ selected: function( elem ) {
+ // Accessing this property makes selected-by-default
+ // options in Safari work properly
+ elem.parentNode.selectedIndex;
+
+ return elem.selected === true;
+ },
+
+ parent: function( elem ) {
+ return !!elem.firstChild;
+ },
+
+ empty: function( elem ) {
+ return !elem.firstChild;
+ },
+
+ has: function( elem, i, match ) {
+ return !!Sizzle( match[3], elem ).length;
+ },
+
+ header: function( elem ) {
+ return (/h\d/i).test( elem.nodeName );
+ },
+
+ text: function( elem ) {
+ return "text" === elem.type;
+ },
+ radio: function( elem ) {
+ return "radio" === elem.type;
+ },
+
+ checkbox: function( elem ) {
+ return "checkbox" === elem.type;
+ },
+
+ file: function( elem ) {
+ return "file" === elem.type;
+ },
+ password: function( elem ) {
+ return "password" === elem.type;
+ },
+
+ submit: function( elem ) {
+ return "submit" === elem.type;
+ },
+
+ image: function( elem ) {
+ return "image" === elem.type;
+ },
+
+ reset: function( elem ) {
+ return "reset" === elem.type;
+ },
+
+ button: function( elem ) {
+ return "button" === elem.type || elem.nodeName.toLowerCase() === "button";
+ },
+
+ input: function( elem ) {
+ return (/input|select|textarea|button/i).test( elem.nodeName );
+ }
+ },
+ setFilters: {
+ first: function( elem, i ) {
+ return i === 0;
+ },
+
+ last: function( elem, i, match, array ) {
+ return i === array.length - 1;
+ },
+
+ even: function( elem, i ) {
+ return i % 2 === 0;
+ },
+
+ odd: function( elem, i ) {
+ return i % 2 === 1;
+ },
+
+ lt: function( elem, i, match ) {
+ return i < match[3] - 0;
+ },
+
+ gt: function( elem, i, match ) {
+ return i > match[3] - 0;
+ },
+
+ nth: function( elem, i, match ) {
+ return match[3] - 0 === i;
+ },
+
+ eq: function( elem, i, match ) {
+ return match[3] - 0 === i;
+ }
+ },
+ filter: {
+ PSEUDO: function( elem, match, i, array ) {
+ var name = match[1],
+ filter = Expr.filters[ name ];
+
+ if ( filter ) {
+ return filter( elem, i, match, array );
+
+ } else if ( name === "contains" ) {
+ return (elem.textContent || elem.innerText || Sizzle.getText([ elem ]) || "").indexOf(match[3]) >= 0;
+
+ } else if ( name === "not" ) {
+ var not = match[3];
+
+ for ( var j = 0, l = not.length; j < l; j++ ) {
+ if ( not[j] === elem ) {
+ return false;
+ }
+ }
+
+ return true;
+
+ } else {
+ Sizzle.error( "Syntax error, unrecognized expression: " + name );
+ }
+ },
+
+ CHILD: function( elem, match ) {
+ var type = match[1],
+ node = elem;
+
+ switch ( type ) {
+ case "only":
+ case "first":
+ while ( (node = node.previousSibling) ) {
+ if ( node.nodeType === 1 ) {
+ return false;
+ }
+ }
+
+ if ( type === "first" ) {
+ return true;
+ }
+
+ node = elem;
+
+ case "last":
+ while ( (node = node.nextSibling) ) {
+ if ( node.nodeType === 1 ) {
+ return false;
+ }
+ }
+
+ return true;
+
+ case "nth":
+ var first = match[2],
+ last = match[3];
+
+ if ( first === 1 && last === 0 ) {
+ return true;
+ }
+
+ var doneName = match[0],
+ parent = elem.parentNode;
+
+ if ( parent && (parent.sizcache !== doneName || !elem.nodeIndex) ) {
+ var count = 0;
+
+ for ( node = parent.firstChild; node; node = node.nextSibling ) {
+ if ( node.nodeType === 1 ) {
+ node.nodeIndex = ++count;
+ }
+ }
+
+ parent.sizcache = doneName;
+ }
+
+ var diff = elem.nodeIndex - last;
+
+ if ( first === 0 ) {
+ return diff === 0;
+
+ } else {
+ return ( diff % first === 0 && diff / first >= 0 );
+ }
+ }
+ },
+
+ ID: function( elem, match ) {
+ return elem.nodeType === 1 && elem.getAttribute("id") === match;
+ },
+
+ TAG: function( elem, match ) {
+ return (match === "*" && elem.nodeType === 1) || elem.nodeName.toLowerCase() === match;
+ },
+
+ CLASS: function( elem, match ) {
+ return (" " + (elem.className || elem.getAttribute("class")) + " ")
+ .indexOf( match ) > -1;
+ },
+
+ ATTR: function( elem, match ) {
+ var name = match[1],
+ result = Expr.attrHandle[ name ] ?
+ Expr.attrHandle[ name ]( elem ) :
+ elem[ name ] != null ?
+ elem[ name ] :
+ elem.getAttribute( name ),
+ value = result + "",
+ type = match[2],
+ check = match[4];
+
+ return result == null ?
+ type === "!=" :
+ type === "=" ?
+ value === check :
+ type === "*=" ?
+ value.indexOf(check) >= 0 :
+ type === "~=" ?
+ (" " + value + " ").indexOf(check) >= 0 :
+ !check ?
+ value && result !== false :
+ type === "!=" ?
+ value !== check :
+ type === "^=" ?
+ value.indexOf(check) === 0 :
+ type === "$=" ?
+ value.substr(value.length - check.length) === check :
+ type === "|=" ?
+ value === check || value.substr(0, check.length + 1) === check + "-" :
+ false;
+ },
+
+ POS: function( elem, match, i, array ) {
+ var name = match[2],
+ filter = Expr.setFilters[ name ];
+
+ if ( filter ) {
+ return filter( elem, i, match, array );
+ }
+ }
+ }
+};
+
+var origPOS = Expr.match.POS,
+ fescape = function(all, num){
+ return "\\" + (num - 0 + 1);
+ };
+
+for ( var type in Expr.match ) {
+ Expr.match[ type ] = new RegExp( Expr.match[ type ].source + (/(?![^\[]*\])(?![^\(]*\))/.source) );
+ Expr.leftMatch[ type ] = new RegExp( /(^(?:.|\r|\n)*?)/.source + Expr.match[ type ].source.replace(/\\(\d+)/g, fescape) );
+}
+
+var makeArray = function( array, results ) {
+ array = Array.prototype.slice.call( array, 0 );
+
+ if ( results ) {
+ results.push.apply( results, array );
+ return results;
+ }
+
+ return array;
+};
+
+// Perform a simple check to determine if the browser is capable of
+// converting a NodeList to an array using builtin methods.
+// Also verifies that the returned array holds DOM nodes
+// (which is not the case in the Blackberry browser)
+try {
+ Array.prototype.slice.call( document.documentElement.childNodes, 0 )[0].nodeType;
+
+// Provide a fallback method if it does not work
+} catch( e ) {
+ makeArray = function( array, results ) {
+ var i = 0,
+ ret = results || [];
+
+ if ( toString.call(array) === "[object Array]" ) {
+ Array.prototype.push.apply( ret, array );
+
+ } else {
+ if ( typeof array.length === "number" ) {
+ for ( var l = array.length; i < l; i++ ) {
+ ret.push( array[i] );
+ }
+
+ } else {
+ for ( ; array[i]; i++ ) {
+ ret.push( array[i] );
+ }
+ }
+ }
+
+ return ret;
+ };
+}
+
+var sortOrder, siblingCheck;
+
+if ( document.documentElement.compareDocumentPosition ) {
+ sortOrder = function( a, b ) {
+ if ( a === b ) {
+ hasDuplicate = true;
+ return 0;
+ }
+
+ if ( !a.compareDocumentPosition || !b.compareDocumentPosition ) {
+ return a.compareDocumentPosition ? -1 : 1;
+ }
+
+ return a.compareDocumentPosition(b) & 4 ? -1 : 1;
+ };
+
+} else {
+ sortOrder = function( a, b ) {
+ var al, bl,
+ ap = [],
+ bp = [],
+ aup = a.parentNode,
+ bup = b.parentNode,
+ cur = aup;
+
+ // The nodes are identical, we can exit early
+ if ( a === b ) {
+ hasDuplicate = true;
+ return 0;
+
+ // If the nodes are siblings (or identical) we can do a quick check
+ } else if ( aup === bup ) {
+ return siblingCheck( a, b );
+
+ // If no parents were found then the nodes are disconnected
+ } else if ( !aup ) {
+ return -1;
+
+ } else if ( !bup ) {
+ return 1;
+ }
+
+ // Otherwise they're somewhere else in the tree so we need
+ // to build up a full list of the parentNodes for comparison
+ while ( cur ) {
+ ap.unshift( cur );
+ cur = cur.parentNode;
+ }
+
+ cur = bup;
+
+ while ( cur ) {
+ bp.unshift( cur );
+ cur = cur.parentNode;
+ }
+
+ al = ap.length;
+ bl = bp.length;
+
+ // Start walking down the tree looking for a discrepancy
+ for ( var i = 0; i < al && i < bl; i++ ) {
+ if ( ap[i] !== bp[i] ) {
+ return siblingCheck( ap[i], bp[i] );
+ }
+ }
+
+ // We ended someplace up the tree so do a sibling check
+ return i === al ?
+ siblingCheck( a, bp[i], -1 ) :
+ siblingCheck( ap[i], b, 1 );
+ };
+
+ siblingCheck = function( a, b, ret ) {
+ if ( a === b ) {
+ return ret;
+ }
+
+ var cur = a.nextSibling;
+
+ while ( cur ) {
+ if ( cur === b ) {
+ return -1;
+ }
+
+ cur = cur.nextSibling;
+ }
+
+ return 1;
+ };
+}
+
+// Utility function for retreiving the text value of an array of DOM nodes
+Sizzle.getText = function( elems ) {
+ var ret = "", elem;
+
+ for ( var i = 0; elems[i]; i++ ) {
+ elem = elems[i];
+
+ // Get the text from text nodes and CDATA nodes
+ if ( elem.nodeType === 3 || elem.nodeType === 4 ) {
+ ret += elem.nodeValue;
+
+ // Traverse everything else, except comment nodes
+ } else if ( elem.nodeType !== 8 ) {
+ ret += Sizzle.getText( elem.childNodes );
+ }
+ }
+
+ return ret;
+};
+
+// Check to see if the browser returns elements by name when
+// querying by getElementById (and provide a workaround)
+(function(){
+ // We're going to inject a fake input element with a specified name
+ var form = document.createElement("div"),
+ id = "script" + (new Date()).getTime(),
+ root = document.documentElement;
+
+ form.innerHTML = "<a name='" + id + "'/>";
+
+ // Inject it into the root element, check its status, and remove it quickly
+ root.insertBefore( form, root.firstChild );
+
+ // The workaround has to do additional checks after a getElementById
+ // Which slows things down for other browsers (hence the branching)
+ if ( document.getElementById( id ) ) {
+ Expr.find.ID = function( match, context, isXML ) {
+ if ( typeof context.getElementById !== "undefined" && !isXML ) {
+ var m = context.getElementById(match[1]);
+
+ return m ?
+ m.id === match[1] || typeof m.getAttributeNode !== "undefined" && m.getAttributeNode("id").nodeValue === match[1] ?
+ [m] :
+ undefined :
+ [];
+ }
+ };
+
+ Expr.filter.ID = function( elem, match ) {
+ var node = typeof elem.getAttributeNode !== "undefined" && elem.getAttributeNode("id");
+
+ return elem.nodeType === 1 && node && node.nodeValue === match;
+ };
+ }
+
+ root.removeChild( form );
+
+ // release memory in IE
+ root = form = null;
+})();
+
+(function(){
+ // Check to see if the browser returns only elements
+ // when doing getElementsByTagName("*")
+
+ // Create a fake element
+ var div = document.createElement("div");
+ div.appendChild( document.createComment("") );
+
+ // Make sure no comments are found
+ if ( div.getElementsByTagName("*").length > 0 ) {
+ Expr.find.TAG = function( match, context ) {
+ var results = context.getElementsByTagName( match[1] );
+
+ // Filter out possible comments
+ if ( match[1] === "*" ) {
+ var tmp = [];
+
+ for ( var i = 0; results[i]; i++ ) {
+ if ( results[i].nodeType === 1 ) {
+ tmp.push( results[i] );
+ }
+ }
+
+ results = tmp;
+ }
+
+ return results;
+ };
+ }
+
+ // Check to see if an attribute returns normalized href attributes
+ div.innerHTML = "<a href='#'></a>";
+
+ if ( div.firstChild && typeof div.firstChild.getAttribute !== "undefined" &&
+ div.firstChild.getAttribute("href") !== "#" ) {
+
+ Expr.attrHandle.href = function( elem ) {
+ return elem.getAttribute( "href", 2 );
+ };
+ }
+
+ // release memory in IE
+ div = null;
+})();
+
+if ( document.querySelectorAll ) {
+ (function(){
+ var oldSizzle = Sizzle,
+ div = document.createElement("div"),
+ id = "__sizzle__";
+
+ div.innerHTML = "<p class='TEST'></p>";
+
+ // Safari can't handle uppercase or unicode characters when
+ // in quirks mode.
+ if ( div.querySelectorAll && div.querySelectorAll(".TEST").length === 0 ) {
+ return;
+ }
+
+ Sizzle = function( query, context, extra, seed ) {
+ context = context || document;
+
+ // Make sure that attribute selectors are quoted
+ query = query.replace(/\=\s*([^'"\]]*)\s*\]/g, "='$1']");
+
+ // Only use querySelectorAll on non-XML documents
+ // (ID selectors don't work in non-HTML documents)
+ if ( !seed && !Sizzle.isXML(context) ) {
+ if ( context.nodeType === 9 ) {
+ try {
+ return makeArray( context.querySelectorAll(query), extra );
+ } catch(qsaError) {}
+
+ // qSA works strangely on Element-rooted queries
+ // We can work around this by specifying an extra ID on the root
+ // and working up from there (Thanks to Andrew Dupont for the technique)
+ // IE 8 doesn't work on object elements
+ } else if ( context.nodeType === 1 && context.nodeName.toLowerCase() !== "object" ) {
+ var old = context.getAttribute( "id" ),
+ nid = old || id;
+
+ if ( !old ) {
+ context.setAttribute( "id", nid );
+ }
+
+ try {
+ return makeArray( context.querySelectorAll( "#" + nid + " " + query ), extra );
+
+ } catch(pseudoError) {
+ } finally {
+ if ( !old ) {
+ context.removeAttribute( "id" );
+ }
+ }
+ }
+ }
+
+ return oldSizzle(query, context, extra, seed);
+ };
+
+ for ( var prop in oldSizzle ) {
+ Sizzle[ prop ] = oldSizzle[ prop ];
+ }
+
+ // release memory in IE
+ div = null;
+ })();
+}
+
+(function(){
+ var html = document.documentElement,
+ matches = html.matchesSelector || html.mozMatchesSelector || html.webkitMatchesSelector || html.msMatchesSelector,
+ pseudoWorks = false;
+
+ try {
+ // This should fail with an exception
+ // Gecko does not error, returns false instead
+ matches.call( document.documentElement, "[test!='']:sizzle" );
+
+ } catch( pseudoError ) {
+ pseudoWorks = true;
+ }
+
+ if ( matches ) {
+ Sizzle.matchesSelector = function( node, expr ) {
+ // Make sure that attribute selectors are quoted
+ expr = expr.replace(/\=\s*([^'"\]]*)\s*\]/g, "='$1']");
+
+ if ( !Sizzle.isXML( node ) ) {
+ try {
+ if ( pseudoWorks || !Expr.match.PSEUDO.test( expr ) && !/!=/.test( expr ) ) {
+ return matches.call( node, expr );
+ }
+ } catch(e) {}
+ }
+
+ return Sizzle(expr, null, null, [node]).length > 0;
+ };
+ }
+})();
+
+(function(){
+ var div = document.createElement("div");
+
+ div.innerHTML = "<div class='test e'></div><div class='test'></div>";
+
+ // Opera can't find a second classname (in 9.6)
+ // Also, make sure that getElementsByClassName actually exists
+ if ( !div.getElementsByClassName || div.getElementsByClassName("e").length === 0 ) {
+ return;
+ }
+
+ // Safari caches class attributes, doesn't catch changes (in 3.2)
+ div.lastChild.className = "e";
+
+ if ( div.getElementsByClassName("e").length === 1 ) {
+ return;
+ }
+
+ Expr.order.splice(1, 0, "CLASS");
+ Expr.find.CLASS = function( match, context, isXML ) {
+ if ( typeof context.getElementsByClassName !== "undefined" && !isXML ) {
+ return context.getElementsByClassName(match[1]);
+ }
+ };
+
+ // release memory in IE
+ div = null;
+})();
+
+function dirNodeCheck( dir, cur, doneName, checkSet, nodeCheck, isXML ) {
+ for ( var i = 0, l = checkSet.length; i < l; i++ ) {
+ var elem = checkSet[i];
+
+ if ( elem ) {
+ var match = false;
+
+ elem = elem[dir];
+
+ while ( elem ) {
+ if ( elem.sizcache === doneName ) {
+ match = checkSet[elem.sizset];
+ break;
+ }
+
+ if ( elem.nodeType === 1 && !isXML ){
+ elem.sizcache = doneName;
+ elem.sizset = i;
+ }
+
+ if ( elem.nodeName.toLowerCase() === cur ) {
+ match = elem;
+ break;
+ }
+
+ elem = elem[dir];
+ }
+
+ checkSet[i] = match;
+ }
+ }
+}
+
+function dirCheck( dir, cur, doneName, checkSet, nodeCheck, isXML ) {
+ for ( var i = 0, l = checkSet.length; i < l; i++ ) {
+ var elem = checkSet[i];
+
+ if ( elem ) {
+ var match = false;
+
+ elem = elem[dir];
+
+ while ( elem ) {
+ if ( elem.sizcache === doneName ) {
+ match = checkSet[elem.sizset];
+ break;
+ }
+
+ if ( elem.nodeType === 1 ) {
+ if ( !isXML ) {
+ elem.sizcache = doneName;
+ elem.sizset = i;
+ }
+
+ if ( typeof cur !== "string" ) {
+ if ( elem === cur ) {
+ match = true;
+ break;
+ }
+
+ } else if ( Sizzle.filter( cur, [elem] ).length > 0 ) {
+ match = elem;
+ break;
+ }
+ }
+
+ elem = elem[dir];
+ }
+
+ checkSet[i] = match;
+ }
+ }
+}
+
+if ( document.documentElement.contains ) {
+ Sizzle.contains = function( a, b ) {
+ return a !== b && (a.contains ? a.contains(b) : true);
+ };
+
+} else if ( document.documentElement.compareDocumentPosition ) {
+ Sizzle.contains = function( a, b ) {
+ return !!(a.compareDocumentPosition(b) & 16);
+ };
+
+} else {
+ Sizzle.contains = function() {
+ return false;
+ };
+}
+
+Sizzle.isXML = function( elem ) {
+ // documentElement is verified for cases where it doesn't yet exist
+ // (such as loading iframes in IE - #4833)
+ var documentElement = (elem ? elem.ownerDocument || elem : 0).documentElement;
+
+ return documentElement ? documentElement.nodeName !== "HTML" : false;
+};
+
+var posProcess = function( selector, context ) {
+ var match,
+ tmpSet = [],
+ later = "",
+ root = context.nodeType ? [context] : context;
+
+ // Position selectors must be done after the filter
+ // And so must :not(positional) so we move all PSEUDOs to the end
+ while ( (match = Expr.match.PSEUDO.exec( selector )) ) {
+ later += match[0];
+ selector = selector.replace( Expr.match.PSEUDO, "" );
+ }
+
+ selector = Expr.relative[selector] ? selector + "*" : selector;
+
+ for ( var i = 0, l = root.length; i < l; i++ ) {
+ Sizzle( selector, root[i], tmpSet );
+ }
+
+ return Sizzle.filter( later, tmpSet );
+};
+
+// EXPOSE
+jQuery.find = Sizzle;
+jQuery.expr = Sizzle.selectors;
+jQuery.expr[":"] = jQuery.expr.filters;
+jQuery.unique = Sizzle.uniqueSort;
+jQuery.text = Sizzle.getText;
+jQuery.isXMLDoc = Sizzle.isXML;
+jQuery.contains = Sizzle.contains;
+
+
+})();
+
+
+var runtil = /Until$/,
+ rparentsprev = /^(?:parents|prevUntil|prevAll)/,
+ // Note: This RegExp should be improved, or likely pulled from Sizzle
+ rmultiselector = /,/,
+ isSimple = /^.[^:#\[\.,]*$/,
+ slice = Array.prototype.slice,
+ POS = jQuery.expr.match.POS;
+
+jQuery.fn.extend({
+ find: function( selector ) {
+ var ret = this.pushStack( "", "find", selector ),
+ length = 0;
+
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ length = ret.length;
+ jQuery.find( selector, this[i], ret );
+
+ if ( i > 0 ) {
+ // Make sure that the results are unique
+ for ( var n = length; n < ret.length; n++ ) {
+ for ( var r = 0; r < length; r++ ) {
+ if ( ret[r] === ret[n] ) {
+ ret.splice(n--, 1);
+ break;
+ }
+ }
+ }
+ }
+ }
+
+ return ret;
+ },
+
+ has: function( target ) {
+ var targets = jQuery( target );
+ return this.filter(function() {
+ for ( var i = 0, l = targets.length; i < l; i++ ) {
+ if ( jQuery.contains( this, targets[i] ) ) {
+ return true;
+ }
+ }
+ });
+ },
+
+ not: function( selector ) {
+ return this.pushStack( winnow(this, selector, false), "not", selector);
+ },
+
+ filter: function( selector ) {
+ return this.pushStack( winnow(this, selector, true), "filter", selector );
+ },
+
+ is: function( selector ) {
+ return !!selector && jQuery.filter( selector, this ).length > 0;
+ },
+
+ closest: function( selectors, context ) {
+ var ret = [], i, l, cur = this[0];
+
+ if ( jQuery.isArray( selectors ) ) {
+ var match, selector,
+ matches = {},
+ level = 1;
+
+ if ( cur && selectors.length ) {
+ for ( i = 0, l = selectors.length; i < l; i++ ) {
+ selector = selectors[i];
+
+ if ( !matches[selector] ) {
+ matches[selector] = jQuery.expr.match.POS.test( selector ) ?
+ jQuery( selector, context || this.context ) :
+ selector;
+ }
+ }
+
+ while ( cur && cur.ownerDocument && cur !== context ) {
+ for ( selector in matches ) {
+ match = matches[selector];
+
+ if ( match.jquery ? match.index(cur) > -1 : jQuery(cur).is(match) ) {
+ ret.push({ selector: selector, elem: cur, level: level });
+ }
+ }
+
+ cur = cur.parentNode;
+ level++;
+ }
+ }
+
+ return ret;
+ }
+
+ var pos = POS.test( selectors ) ?
+ jQuery( selectors, context || this.context ) : null;
+
+ for ( i = 0, l = this.length; i < l; i++ ) {
+ cur = this[i];
+
+ while ( cur ) {
+ if ( pos ? pos.index(cur) > -1 : jQuery.find.matchesSelector(cur, selectors) ) {
+ ret.push( cur );
+ break;
+
+ } else {
+ cur = cur.parentNode;
+ if ( !cur || !cur.ownerDocument || cur === context ) {
+ break;
+ }
+ }
+ }
+ }
+
+ ret = ret.length > 1 ? jQuery.unique(ret) : ret;
+
+ return this.pushStack( ret, "closest", selectors );
+ },
+
+ // Determine the position of an element within
+ // the matched set of elements
+ index: function( elem ) {
+ if ( !elem || typeof elem === "string" ) {
+ return jQuery.inArray( this[0],
+ // If it receives a string, the selector is used
+ // If it receives nothing, the siblings are used
+ elem ? jQuery( elem ) : this.parent().children() );
+ }
+ // Locate the position of the desired element
+ return jQuery.inArray(
+ // If it receives a jQuery object, the first element is used
+ elem.jquery ? elem[0] : elem, this );
+ },
+
+ add: function( selector, context ) {
+ var set = typeof selector === "string" ?
+ jQuery( selector, context || this.context ) :
+ jQuery.makeArray( selector ),
+ all = jQuery.merge( this.get(), set );
+
+ return this.pushStack( isDisconnected( set[0] ) || isDisconnected( all[0] ) ?
+ all :
+ jQuery.unique( all ) );
+ },
+
+ andSelf: function() {
+ return this.add( this.prevObject );
+ }
+});
+
+// A painfully simple check to see if an element is disconnected
+// from a document (should be improved, where feasible).
+function isDisconnected( node ) {
+ return !node || !node.parentNode || node.parentNode.nodeType === 11;
+}
+
+jQuery.each({
+ parent: function( elem ) {
+ var parent = elem.parentNode;
+ return parent && parent.nodeType !== 11 ? parent : null;
+ },
+ parents: function( elem ) {
+ return jQuery.dir( elem, "parentNode" );
+ },
+ parentsUntil: function( elem, i, until ) {
+ return jQuery.dir( elem, "parentNode", until );
+ },
+ next: function( elem ) {
+ return jQuery.nth( elem, 2, "nextSibling" );
+ },
+ prev: function( elem ) {
+ return jQuery.nth( elem, 2, "previousSibling" );
+ },
+ nextAll: function( elem ) {
+ return jQuery.dir( elem, "nextSibling" );
+ },
+ prevAll: function( elem ) {
+ return jQuery.dir( elem, "previousSibling" );
+ },
+ nextUntil: function( elem, i, until ) {
+ return jQuery.dir( elem, "nextSibling", until );
+ },
+ prevUntil: function( elem, i, until ) {
+ return jQuery.dir( elem, "previousSibling", until );
+ },
+ siblings: function( elem ) {
+ return jQuery.sibling( elem.parentNode.firstChild, elem );
+ },
+ children: function( elem ) {
+ return jQuery.sibling( elem.firstChild );
+ },
+ contents: function( elem ) {
+ return jQuery.nodeName( elem, "iframe" ) ?
+ elem.contentDocument || elem.contentWindow.document :
+ jQuery.makeArray( elem.childNodes );
+ }
+}, function( name, fn ) {
+ jQuery.fn[ name ] = function( until, selector ) {
+ var ret = jQuery.map( this, fn, until );
+
+ if ( !runtil.test( name ) ) {
+ selector = until;
+ }
+
+ if ( selector && typeof selector === "string" ) {
+ ret = jQuery.filter( selector, ret );
+ }
+
+ ret = this.length > 1 ? jQuery.unique( ret ) : ret;
+
+ if ( (this.length > 1 || rmultiselector.test( selector )) && rparentsprev.test( name ) ) {
+ ret = ret.reverse();
+ }
+
+ return this.pushStack( ret, name, slice.call(arguments).join(",") );
+ };
+});
+
+jQuery.extend({
+ filter: function( expr, elems, not ) {
+ if ( not ) {
+ expr = ":not(" + expr + ")";
+ }
+
+ return elems.length === 1 ?
+ jQuery.find.matchesSelector(elems[0], expr) ? [ elems[0] ] : [] :
+ jQuery.find.matches(expr, elems);
+ },
+
+ dir: function( elem, dir, until ) {
+ var matched = [],
+ cur = elem[ dir ];
+
+ while ( cur && cur.nodeType !== 9 && (until === undefined || cur.nodeType !== 1 || !jQuery( cur ).is( until )) ) {
+ if ( cur.nodeType === 1 ) {
+ matched.push( cur );
+ }
+ cur = cur[dir];
+ }
+ return matched;
+ },
+
+ nth: function( cur, result, dir, elem ) {
+ result = result || 1;
+ var num = 0;
+
+ for ( ; cur; cur = cur[dir] ) {
+ if ( cur.nodeType === 1 && ++num === result ) {
+ break;
+ }
+ }
+
+ return cur;
+ },
+
+ sibling: function( n, elem ) {
+ var r = [];
+
+ for ( ; n; n = n.nextSibling ) {
+ if ( n.nodeType === 1 && n !== elem ) {
+ r.push( n );
+ }
+ }
+
+ return r;
+ }
+});
+
+// Implement the identical functionality for filter and not
+function winnow( elements, qualifier, keep ) {
+ if ( jQuery.isFunction( qualifier ) ) {
+ return jQuery.grep(elements, function( elem, i ) {
+ var retVal = !!qualifier.call( elem, i, elem );
+ return retVal === keep;
+ });
+
+ } else if ( qualifier.nodeType ) {
+ return jQuery.grep(elements, function( elem, i ) {
+ return (elem === qualifier) === keep;
+ });
+
+ } else if ( typeof qualifier === "string" ) {
+ var filtered = jQuery.grep(elements, function( elem ) {
+ return elem.nodeType === 1;
+ });
+
+ if ( isSimple.test( qualifier ) ) {
+ return jQuery.filter(qualifier, filtered, !keep);
+ } else {
+ qualifier = jQuery.filter( qualifier, filtered );
+ }
+ }
+
+ return jQuery.grep(elements, function( elem, i ) {
+ return (jQuery.inArray( elem, qualifier ) >= 0) === keep;
+ });
+}
+
+
+
+
+var rinlinejQuery = / jQuery\d+="(?:\d+|null)"/g,
+ rleadingWhitespace = /^\s+/,
+ rxhtmlTag = /<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/ig,
+ rtagName = /<([\w:]+)/,
+ rtbody = /<tbody/i,
+ rhtml = /<|&#?\w+;/,
+ rnocache = /<(?:script|object|embed|option|style)/i,
+ // checked="checked" or checked (html5)
+ rchecked = /checked\s*(?:[^=]|=\s*.checked.)/i,
+ raction = /\=([^="'>\s]+\/)>/g,
+ wrapMap = {
+ option: [ 1, "<select multiple='multiple'>", "</select>" ],
+ legend: [ 1, "<fieldset>", "</fieldset>" ],
+ thead: [ 1, "<table>", "</table>" ],
+ tr: [ 2, "<table><tbody>", "</tbody></table>" ],
+ td: [ 3, "<table><tbody><tr>", "</tr></tbody></table>" ],
+ col: [ 2, "<table><tbody></tbody><colgroup>", "</colgroup></table>" ],
+ area: [ 1, "<map>", "</map>" ],
+ _default: [ 0, "", "" ]
+ };
+
+wrapMap.optgroup = wrapMap.option;
+wrapMap.tbody = wrapMap.tfoot = wrapMap.colgroup = wrapMap.caption = wrapMap.thead;
+wrapMap.th = wrapMap.td;
+
+// IE can't serialize <link> and <script> tags normally
+if ( !jQuery.support.htmlSerialize ) {
+ wrapMap._default = [ 1, "div<div>", "</div>" ];
+}
+
+jQuery.fn.extend({
+ text: function( text ) {
+ if ( jQuery.isFunction(text) ) {
+ return this.each(function(i) {
+ var self = jQuery( this );
+
+ self.text( text.call(this, i, self.text()) );
+ });
+ }
+
+ if ( typeof text !== "object" && text !== undefined ) {
+ return this.empty().append( (this[0] && this[0].ownerDocument || document).createTextNode( text ) );
+ }
+
+ return jQuery.text( this );
+ },
+
+ wrapAll: function( html ) {
+ if ( jQuery.isFunction( html ) ) {
+ return this.each(function(i) {
+ jQuery(this).wrapAll( html.call(this, i) );
+ });
+ }
+
+ if ( this[0] ) {
+ // The elements to wrap the target around
+ var wrap = jQuery( html, this[0].ownerDocument ).eq(0).clone(true);
+
+ if ( this[0].parentNode ) {
+ wrap.insertBefore( this[0] );
+ }
+
+ wrap.map(function() {
+ var elem = this;
+
+ while ( elem.firstChild && elem.firstChild.nodeType === 1 ) {
+ elem = elem.firstChild;
+ }
+
+ return elem;
+ }).append(this);
+ }
+
+ return this;
+ },
+
+ wrapInner: function( html ) {
+ if ( jQuery.isFunction( html ) ) {
+ return this.each(function(i) {
+ jQuery(this).wrapInner( html.call(this, i) );
+ });
+ }
+
+ return this.each(function() {
+ var self = jQuery( this ),
+ contents = self.contents();
+
+ if ( contents.length ) {
+ contents.wrapAll( html );
+
+ } else {
+ self.append( html );
+ }
+ });
+ },
+
+ wrap: function( html ) {
+ return this.each(function() {
+ jQuery( this ).wrapAll( html );
+ });
+ },
+
+ unwrap: function() {
+ return this.parent().each(function() {
+ if ( !jQuery.nodeName( this, "body" ) ) {
+ jQuery( this ).replaceWith( this.childNodes );
+ }
+ }).end();
+ },
+
+ append: function() {
+ return this.domManip(arguments, true, function( elem ) {
+ if ( this.nodeType === 1 ) {
+ this.appendChild( elem );
+ }
+ });
+ },
+
+ prepend: function() {
+ return this.domManip(arguments, true, function( elem ) {
+ if ( this.nodeType === 1 ) {
+ this.insertBefore( elem, this.firstChild );
+ }
+ });
+ },
+
+ before: function() {
+ if ( this[0] && this[0].parentNode ) {
+ return this.domManip(arguments, false, function( elem ) {
+ this.parentNode.insertBefore( elem, this );
+ });
+ } else if ( arguments.length ) {
+ var set = jQuery(arguments[0]);
+ set.push.apply( set, this.toArray() );
+ return this.pushStack( set, "before", arguments );
+ }
+ },
+
+ after: function() {
+ if ( this[0] && this[0].parentNode ) {
+ return this.domManip(arguments, false, function( elem ) {
+ this.parentNode.insertBefore( elem, this.nextSibling );
+ });
+ } else if ( arguments.length ) {
+ var set = this.pushStack( this, "after", arguments );
+ set.push.apply( set, jQuery(arguments[0]).toArray() );
+ return set;
+ }
+ },
+
+ // keepData is for internal use only--do not document
+ remove: function( selector, keepData ) {
+ for ( var i = 0, elem; (elem = this[i]) != null; i++ ) {
+ if ( !selector || jQuery.filter( selector, [ elem ] ).length ) {
+ if ( !keepData && elem.nodeType === 1 ) {
+ jQuery.cleanData( elem.getElementsByTagName("*") );
+ jQuery.cleanData( [ elem ] );
+ }
+
+ if ( elem.parentNode ) {
+ elem.parentNode.removeChild( elem );
+ }
+ }
+ }
+
+ return this;
+ },
+
+ empty: function() {
+ for ( var i = 0, elem; (elem = this[i]) != null; i++ ) {
+ // Remove element nodes and prevent memory leaks
+ if ( elem.nodeType === 1 ) {
+ jQuery.cleanData( elem.getElementsByTagName("*") );
+ }
+
+ // Remove any remaining nodes
+ while ( elem.firstChild ) {
+ elem.removeChild( elem.firstChild );
+ }
+ }
+
+ return this;
+ },
+
+ clone: function( events ) {
+ // Do the clone
+ var ret = this.map(function() {
+ if ( !jQuery.support.noCloneEvent && !jQuery.isXMLDoc(this) ) {
+ // IE copies events bound via attachEvent when
+ // using cloneNode. Calling detachEvent on the
+ // clone will also remove the events from the orignal
+ // In order to get around this, we use innerHTML.
+ // Unfortunately, this means some modifications to
+ // attributes in IE that are actually only stored
+ // as properties will not be copied (such as the
+ // the name attribute on an input).
+ var html = this.outerHTML,
+ ownerDocument = this.ownerDocument;
+
+ if ( !html ) {
+ var div = ownerDocument.createElement("div");
+ div.appendChild( this.cloneNode(true) );
+ html = div.innerHTML;
+ }
+
+ return jQuery.clean([html.replace(rinlinejQuery, "")
+ // Handle the case in IE 8 where action=/test/> self-closes a tag
+ .replace(raction, '="$1">')
+ .replace(rleadingWhitespace, "")], ownerDocument)[0];
+ } else {
+ return this.cloneNode(true);
+ }
+ });
+
+ // Copy the events from the original to the clone
+ if ( events === true ) {
+ cloneCopyEvent( this, ret );
+ cloneCopyEvent( this.find("*"), ret.find("*") );
+ }
+
+ // Return the cloned set
+ return ret;
+ },
+
+ html: function( value ) {
+ if ( value === undefined ) {
+ return this[0] && this[0].nodeType === 1 ?
+ this[0].innerHTML.replace(rinlinejQuery, "") :
+ null;
+
+ // See if we can take a shortcut and just use innerHTML
+ } else if ( typeof value === "string" && !rnocache.test( value ) &&
+ (jQuery.support.leadingWhitespace || !rleadingWhitespace.test( value )) &&
+ !wrapMap[ (rtagName.exec( value ) || ["", ""])[1].toLowerCase() ] ) {
+
+ value = value.replace(rxhtmlTag, "<$1></$2>");
+
+ try {
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ // Remove element nodes and prevent memory leaks
+ if ( this[i].nodeType === 1 ) {
+ jQuery.cleanData( this[i].getElementsByTagName("*") );
+ this[i].innerHTML = value;
+ }
+ }
+
+ // If using innerHTML throws an exception, use the fallback method
+ } catch(e) {
+ this.empty().append( value );
+ }
+
+ } else if ( jQuery.isFunction( value ) ) {
+ this.each(function(i){
+ var self = jQuery( this );
+
+ self.html( value.call(this, i, self.html()) );
+ });
+
+ } else {
+ this.empty().append( value );
+ }
+
+ return this;
+ },
+
+ replaceWith: function( value ) {
+ if ( this[0] && this[0].parentNode ) {
+ // Make sure that the elements are removed from the DOM before they are inserted
+ // this can help fix replacing a parent with child elements
+ if ( jQuery.isFunction( value ) ) {
+ return this.each(function(i) {
+ var self = jQuery(this), old = self.html();
+ self.replaceWith( value.call( this, i, old ) );
+ });
+ }
+
+ if ( typeof value !== "string" ) {
+ value = jQuery( value ).detach();
+ }
+
+ return this.each(function() {
+ var next = this.nextSibling,
+ parent = this.parentNode;
+
+ jQuery( this ).remove();
+
+ if ( next ) {
+ jQuery(next).before( value );
+ } else {
+ jQuery(parent).append( value );
+ }
+ });
+ } else {
+ return this.pushStack( jQuery(jQuery.isFunction(value) ? value() : value), "replaceWith", value );
+ }
+ },
+
+ detach: function( selector ) {
+ return this.remove( selector, true );
+ },
+
+ domManip: function( args, table, callback ) {
+ var results, first, fragment, parent,
+ value = args[0],
+ scripts = [];
+
+ // We can't cloneNode fragments that contain checked, in WebKit
+ if ( !jQuery.support.checkClone && arguments.length === 3 && typeof value === "string" && rchecked.test( value ) ) {
+ return this.each(function() {
+ jQuery(this).domManip( args, table, callback, true );
+ });
+ }
+
+ if ( jQuery.isFunction(value) ) {
+ return this.each(function(i) {
+ var self = jQuery(this);
+ args[0] = value.call(this, i, table ? self.html() : undefined);
+ self.domManip( args, table, callback );
+ });
+ }
+
+ if ( this[0] ) {
+ parent = value && value.parentNode;
+
+ // If we're in a fragment, just use that instead of building a new one
+ if ( jQuery.support.parentNode && parent && parent.nodeType === 11 && parent.childNodes.length === this.length ) {
+ results = { fragment: parent };
+
+ } else {
+ results = jQuery.buildFragment( args, this, scripts );
+ }
+
+ fragment = results.fragment;
+
+ if ( fragment.childNodes.length === 1 ) {
+ first = fragment = fragment.firstChild;
+ } else {
+ first = fragment.firstChild;
+ }
+
+ if ( first ) {
+ table = table && jQuery.nodeName( first, "tr" );
+
+ for ( var i = 0, l = this.length; i < l; i++ ) {
+ callback.call(
+ table ?
+ root(this[i], first) :
+ this[i],
+ i > 0 || results.cacheable || this.length > 1 ?
+ fragment.cloneNode(true) :
+ fragment
+ );
+ }
+ }
+
+ if ( scripts.length ) {
+ jQuery.each( scripts, evalScript );
+ }
+ }
+
+ return this;
+ }
+});
+
+function root( elem, cur ) {
+ return jQuery.nodeName(elem, "table") ?
+ (elem.getElementsByTagName("tbody")[0] ||
+ elem.appendChild(elem.ownerDocument.createElement("tbody"))) :
+ elem;
+}
+
+function cloneCopyEvent(orig, ret) {
+ var i = 0;
+
+ ret.each(function() {
+ if ( this.nodeName !== (orig[i] && orig[i].nodeName) ) {
+ return;
+ }
+
+ var oldData = jQuery.data( orig[i++] ),
+ curData = jQuery.data( this, oldData ),
+ events = oldData && oldData.events;
+
+ if ( events ) {
+ delete curData.handle;
+ curData.events = {};
+
+ for ( var type in events ) {
+ for ( var handler in events[ type ] ) {
+ jQuery.event.add( this, type, events[ type ][ handler ], events[ type ][ handler ].data );
+ }
+ }
+ }
+ });
+}
+
+jQuery.buildFragment = function( args, nodes, scripts ) {
+ var fragment, cacheable, cacheresults,
+ doc = (nodes && nodes[0] ? nodes[0].ownerDocument || nodes[0] : document);
+
+ // Only cache "small" (1/2 KB) strings that are associated with the main document
+ // Cloning options loses the selected state, so don't cache them
+ // IE 6 doesn't like it when you put <object> or <embed> elements in a fragment
+ // Also, WebKit does not clone 'checked' attributes on cloneNode, so don't cache
+ if ( args.length === 1 && typeof args[0] === "string" && args[0].length < 512 && doc === document &&
+ !rnocache.test( args[0] ) && (jQuery.support.checkClone || !rchecked.test( args[0] )) ) {
+
+ cacheable = true;
+ cacheresults = jQuery.fragments[ args[0] ];
+ if ( cacheresults ) {
+ if ( cacheresults !== 1 ) {
+ fragment = cacheresults;
+ }
+ }
+ }
+
+ if ( !fragment ) {
+ fragment = doc.createDocumentFragment();
+ jQuery.clean( args, doc, fragment, scripts );
+ }
+
+ if ( cacheable ) {
+ jQuery.fragments[ args[0] ] = cacheresults ? fragment : 1;
+ }
+
+ return { fragment: fragment, cacheable: cacheable };
+};
+
+jQuery.fragments = {};
+
+jQuery.each({
+ appendTo: "append",
+ prependTo: "prepend",
+ insertBefore: "before",
+ insertAfter: "after",
+ replaceAll: "replaceWith"
+}, function( name, original ) {
+ jQuery.fn[ name ] = function( selector ) {
+ var ret = [],
+ insert = jQuery( selector ),
+ parent = this.length === 1 && this[0].parentNode;
+
+ if ( parent && parent.nodeType === 11 && parent.childNodes.length === 1 && insert.length === 1 ) {
+ insert[ original ]( this[0] );
+ return this;
+
+ } else {
+ for ( var i = 0, l = insert.length; i < l; i++ ) {
+ var elems = (i > 0 ? this.clone(true) : this).get();
+ jQuery( insert[i] )[ original ]( elems );
+ ret = ret.concat( elems );
+ }
+
+ return this.pushStack( ret, name, insert.selector );
+ }
+ };
+});
+
+jQuery.extend({
+ clean: function( elems, context, fragment, scripts ) {
+ context = context || document;
+
+ // !context.createElement fails in IE with an error but returns typeof 'object'
+ if ( typeof context.createElement === "undefined" ) {
+ context = context.ownerDocument || context[0] && context[0].ownerDocument || document;
+ }
+
+ var ret = [];
+
+ for ( var i = 0, elem; (elem = elems[i]) != null; i++ ) {
+ if ( typeof elem === "number" ) {
+ elem += "";
+ }
+
+ if ( !elem ) {
+ continue;
+ }
+
+ // Convert html string into DOM nodes
+ if ( typeof elem === "string" && !rhtml.test( elem ) ) {
+ elem = context.createTextNode( elem );
+
+ } else if ( typeof elem === "string" ) {
+ // Fix "XHTML"-style tags in all browsers
+ elem = elem.replace(rxhtmlTag, "<$1></$2>");
+
+ // Trim whitespace, otherwise indexOf won't work as expected
+ var tag = (rtagName.exec( elem ) || ["", ""])[1].toLowerCase(),
+ wrap = wrapMap[ tag ] || wrapMap._default,
+ depth = wrap[0],
+ div = context.createElement("div");
+
+ // Go to html and back, then peel off extra wrappers
+ div.innerHTML = wrap[1] + elem + wrap[2];
+
+ // Move to the right depth
+ while ( depth-- ) {
+ div = div.lastChild;
+ }
+
+ // Remove IE's autoinserted <tbody> from table fragments
+ if ( !jQuery.support.tbody ) {
+
+ // String was a <table>, *may* have spurious <tbody>
+ var hasBody = rtbody.test(elem),
+ tbody = tag === "table" && !hasBody ?
+ div.firstChild && div.firstChild.childNodes :
+
+ // String was a bare <thead> or <tfoot>
+ wrap[1] === "<table>" && !hasBody ?
+ div.childNodes :
+ [];
+
+ for ( var j = tbody.length - 1; j >= 0 ; --j ) {
+ if ( jQuery.nodeName( tbody[ j ], "tbody" ) && !tbody[ j ].childNodes.length ) {
+ tbody[ j ].parentNode.removeChild( tbody[ j ] );
+ }
+ }
+
+ }
+
+ // IE completely kills leading whitespace when innerHTML is used
+ if ( !jQuery.support.leadingWhitespace && rleadingWhitespace.test( elem ) ) {
+ div.insertBefore( context.createTextNode( rleadingWhitespace.exec(elem)[0] ), div.firstChild );
+ }
+
+ elem = div.childNodes;
+ }
+
+ if ( elem.nodeType ) {
+ ret.push( elem );
+ } else {
+ ret = jQuery.merge( ret, elem );
+ }
+ }
+
+ if ( fragment ) {
+ for ( i = 0; ret[i]; i++ ) {
+ if ( scripts && jQuery.nodeName( ret[i], "script" ) && (!ret[i].type || ret[i].type.toLowerCase() === "text/javascript") ) {
+ scripts.push( ret[i].parentNode ? ret[i].parentNode.removeChild( ret[i] ) : ret[i] );
+
+ } else {
+ if ( ret[i].nodeType === 1 ) {
+ ret.splice.apply( ret, [i + 1, 0].concat(jQuery.makeArray(ret[i].getElementsByTagName("script"))) );
+ }
+ fragment.appendChild( ret[i] );
+ }
+ }
+ }
+
+ return ret;
+ },
+
+ cleanData: function( elems ) {
+ var data, id, cache = jQuery.cache,
+ special = jQuery.event.special,
+ deleteExpando = jQuery.support.deleteExpando;
+
+ for ( var i = 0, elem; (elem = elems[i]) != null; i++ ) {
+ if ( elem.nodeName && jQuery.noData[elem.nodeName.toLowerCase()] ) {
+ continue;
+ }
+
+ id = elem[ jQuery.expando ];
+
+ if ( id ) {
+ data = cache[ id ];
+
+ if ( data && data.events ) {
+ for ( var type in data.events ) {
+ if ( special[ type ] ) {
+ jQuery.event.remove( elem, type );
+
+ } else {
+ jQuery.removeEvent( elem, type, data.handle );
+ }
+ }
+ }
+
+ if ( deleteExpando ) {
+ delete elem[ jQuery.expando ];
+
+ } else if ( elem.removeAttribute ) {
+ elem.removeAttribute( jQuery.expando );
+ }
+
+ delete cache[ id ];
+ }
+ }
+ }
+});
+
+function evalScript( i, elem ) {
+ if ( elem.src ) {
+ jQuery.ajax({
+ url: elem.src,
+ async: false,
+ dataType: "script"
+ });
+ } else {
+ jQuery.globalEval( elem.text || elem.textContent || elem.innerHTML || "" );
+ }
+
+ if ( elem.parentNode ) {
+ elem.parentNode.removeChild( elem );
+ }
+}
+
+
+
+
+var ralpha = /alpha\([^)]*\)/i,
+ ropacity = /opacity=([^)]*)/,
+ rdashAlpha = /-([a-z])/ig,
+ rupper = /([A-Z])/g,
+ rnumpx = /^-?\d+(?:px)?$/i,
+ rnum = /^-?\d/,
+
+ cssShow = { position: "absolute", visibility: "hidden", display: "block" },
+ cssWidth = [ "Left", "Right" ],
+ cssHeight = [ "Top", "Bottom" ],
+ curCSS,
+
+ getComputedStyle,
+ currentStyle,
+
+ fcamelCase = function( all, letter ) {
+ return letter.toUpperCase();
+ };
+
+jQuery.fn.css = function( name, value ) {
+ // Setting 'undefined' is a no-op
+ if ( arguments.length === 2 && value === undefined ) {
+ return this;
+ }
+
+ return jQuery.access( this, name, value, true, function( elem, name, value ) {
+ return value !== undefined ?
+ jQuery.style( elem, name, value ) :
+ jQuery.css( elem, name );
+ });
+};
+
+jQuery.extend({
+ // Add in style property hooks for overriding the default
+ // behavior of getting and setting a style property
+ cssHooks: {
+ opacity: {
+ get: function( elem, computed ) {
+ if ( computed ) {
+ // We should always get a number back from opacity
+ var ret = curCSS( elem, "opacity", "opacity" );
+ return ret === "" ? "1" : ret;
+
+ } else {
+ return elem.style.opacity;
+ }
+ }
+ }
+ },
+
+ // Exclude the following css properties to add px
+ cssNumber: {
+ "zIndex": true,
+ "fontWeight": true,
+ "opacity": true,
+ "zoom": true,
+ "lineHeight": true
+ },
+
+ // Add in properties whose names you wish to fix before
+ // setting or getting the value
+ cssProps: {
+ // normalize float css property
+ "float": jQuery.support.cssFloat ? "cssFloat" : "styleFloat"
+ },
+
+ // Get and set the style property on a DOM Node
+ style: function( elem, name, value, extra ) {
+ // Don't set styles on text and comment nodes
+ if ( !elem || elem.nodeType === 3 || elem.nodeType === 8 || !elem.style ) {
+ return;
+ }
+
+ // Make sure that we're working with the right name
+ var ret, origName = jQuery.camelCase( name ),
+ style = elem.style, hooks = jQuery.cssHooks[ origName ];
+
+ name = jQuery.cssProps[ origName ] || origName;
+
+ // Check if we're setting a value
+ if ( value !== undefined ) {
+ // Make sure that NaN and null values aren't set. See: #7116
+ if ( typeof value === "number" && isNaN( value ) || value == null ) {
+ return;
+ }
+
+ // If a number was passed in, add 'px' to the (except for certain CSS properties)
+ if ( typeof value === "number" && !jQuery.cssNumber[ origName ] ) {
+ value += "px";
+ }
+
+ // If a hook was provided, use that value, otherwise just set the specified value
+ if ( !hooks || !("set" in hooks) || (value = hooks.set( elem, value )) !== undefined ) {
+ // Wrapped to prevent IE from throwing errors when 'invalid' values are provided
+ // Fixes bug #5509
+ try {
+ style[ name ] = value;
+ } catch(e) {}
+ }
+
+ } else {
+ // If a hook was provided get the non-computed value from there
+ if ( hooks && "get" in hooks && (ret = hooks.get( elem, false, extra )) !== undefined ) {
+ return ret;
+ }
+
+ // Otherwise just get the value from the style object
+ return style[ name ];
+ }
+ },
+
+ css: function( elem, name, extra ) {
+ // Make sure that we're working with the right name
+ var ret, origName = jQuery.camelCase( name ),
+ hooks = jQuery.cssHooks[ origName ];
+
+ name = jQuery.cssProps[ origName ] || origName;
+
+ // If a hook was provided get the computed value from there
+ if ( hooks && "get" in hooks && (ret = hooks.get( elem, true, extra )) !== undefined ) {
+ return ret;
+
+ // Otherwise, if a way to get the computed value exists, use that
+ } else if ( curCSS ) {
+ return curCSS( elem, name, origName );
+ }
+ },
+
+ // A method for quickly swapping in/out CSS properties to get correct calculations
+ swap: function( elem, options, callback ) {
+ var old = {};
+
+ // Remember the old values, and insert the new ones
+ for ( var name in options ) {
+ old[ name ] = elem.style[ name ];
+ elem.style[ name ] = options[ name ];
+ }
+
+ callback.call( elem );
+
+ // Revert the old values
+ for ( name in options ) {
+ elem.style[ name ] = old[ name ];
+ }
+ },
+
+ camelCase: function( string ) {
+ return string.replace( rdashAlpha, fcamelCase );
+ }
+});
+
+// DEPRECATED, Use jQuery.css() instead
+jQuery.curCSS = jQuery.css;
+
+jQuery.each(["height", "width"], function( i, name ) {
+ jQuery.cssHooks[ name ] = {
+ get: function( elem, computed, extra ) {
+ var val;
+
+ if ( computed ) {
+ if ( elem.offsetWidth !== 0 ) {
+ val = getWH( elem, name, extra );
+
+ } else {
+ jQuery.swap( elem, cssShow, function() {
+ val = getWH( elem, name, extra );
+ });
+ }
+
+ if ( val <= 0 ) {
+ val = curCSS( elem, name, name );
+
+ if ( val === "0px" && currentStyle ) {
+ val = currentStyle( elem, name, name );
+ }
+
+ if ( val != null ) {
+ // Should return "auto" instead of 0, use 0 for
+ // temporary backwards-compat
+ return val === "" || val === "auto" ? "0px" : val;
+ }
+ }
+
+ if ( val < 0 || val == null ) {
+ val = elem.style[ name ];
+
+ // Should return "auto" instead of 0, use 0 for
+ // temporary backwards-compat
+ return val === "" || val === "auto" ? "0px" : val;
+ }
+
+ return typeof val === "string" ? val : val + "px";
+ }
+ },
+
+ set: function( elem, value ) {
+ if ( rnumpx.test( value ) ) {
+ // ignore negative width and height values #1599
+ value = parseFloat(value);
+
+ if ( value >= 0 ) {
+ return value + "px";
+ }
+
+ } else {
+ return value;
+ }
+ }
+ };
+});
+
+if ( !jQuery.support.opacity ) {
+ jQuery.cssHooks.opacity = {
+ get: function( elem, computed ) {
+ // IE uses filters for opacity
+ return ropacity.test((computed && elem.currentStyle ? elem.currentStyle.filter : elem.style.filter) || "") ?
+ (parseFloat(RegExp.$1) / 100) + "" :
+ computed ? "1" : "";
+ },
+
+ set: function( elem, value ) {
+ var style = elem.style;
+
+ // IE has trouble with opacity if it does not have layout
+ // Force it by setting the zoom level
+ style.zoom = 1;
+
+ // Set the alpha filter to set the opacity
+ var opacity = jQuery.isNaN(value) ?
+ "" :
+ "alpha(opacity=" + value * 100 + ")",
+ filter = style.filter || "";
+
+ style.filter = ralpha.test(filter) ?
+ filter.replace(ralpha, opacity) :
+ style.filter + ' ' + opacity;
+ }
+ };
+}
+
+if ( document.defaultView && document.defaultView.getComputedStyle ) {
+ getComputedStyle = function( elem, newName, name ) {
+ var ret, defaultView, computedStyle;
+
+ name = name.replace( rupper, "-$1" ).toLowerCase();
+
+ if ( !(defaultView = elem.ownerDocument.defaultView) ) {
+ return undefined;
+ }
+
+ if ( (computedStyle = defaultView.getComputedStyle( elem, null )) ) {
+ ret = computedStyle.getPropertyValue( name );
+ if ( ret === "" && !jQuery.contains( elem.ownerDocument.documentElement, elem ) ) {
+ ret = jQuery.style( elem, name );
+ }
+ }
+
+ return ret;
+ };
+}
+
+if ( document.documentElement.currentStyle ) {
+ currentStyle = function( elem, name ) {
+ var left, rsLeft,
+ ret = elem.currentStyle && elem.currentStyle[ name ],
+ style = elem.style;
+
+ // From the awesome hack by Dean Edwards
+ // http://erik.eae.net/archives/2007/07/27/18.54.15/#comment-102291
+
+ // If we're not dealing with a regular pixel number
+ // but a number that has a weird ending, we need to convert it to pixels
+ if ( !rnumpx.test( ret ) && rnum.test( ret ) ) {
+ // Remember the original values
+ left = style.left;
+ rsLeft = elem.runtimeStyle.left;
+
+ // Put in the new values to get a computed value out
+ elem.runtimeStyle.left = elem.currentStyle.left;
+ style.left = name === "fontSize" ? "1em" : (ret || 0);
+ ret = style.pixelLeft + "px";
+
+ // Revert the changed values
+ style.left = left;
+ elem.runtimeStyle.left = rsLeft;
+ }
+
+ return ret === "" ? "auto" : ret;
+ };
+}
+
+curCSS = getComputedStyle || currentStyle;
+
+function getWH( elem, name, extra ) {
+ var which = name === "width" ? cssWidth : cssHeight,
+ val = name === "width" ? elem.offsetWidth : elem.offsetHeight;
+
+ if ( extra === "border" ) {
+ return val;
+ }
+
+ jQuery.each( which, function() {
+ if ( !extra ) {
+ val -= parseFloat(jQuery.css( elem, "padding" + this )) || 0;
+ }
+
+ if ( extra === "margin" ) {
+ val += parseFloat(jQuery.css( elem, "margin" + this )) || 0;
+
+ } else {
+ val -= parseFloat(jQuery.css( elem, "border" + this + "Width" )) || 0;
+ }
+ });
+
+ return val;
+}
+
+if ( jQuery.expr && jQuery.expr.filters ) {
+ jQuery.expr.filters.hidden = function( elem ) {
+ var width = elem.offsetWidth,
+ height = elem.offsetHeight;
+
+ return (width === 0 && height === 0) || (!jQuery.support.reliableHiddenOffsets && (elem.style.display || jQuery.css( elem, "display" )) === "none");
+ };
+
+ jQuery.expr.filters.visible = function( elem ) {
+ return !jQuery.expr.filters.hidden( elem );
+ };
+}
+
+
+
+
+var jsc = jQuery.now(),
+ rscript = /<script\b[^<]*(?:(?!<\/script>)<[^<]*)*<\/script>/gi,
+ rselectTextarea = /^(?:select|textarea)/i,
+ rinput = /^(?:color|date|datetime|email|hidden|month|number|password|range|search|tel|text|time|url|week)$/i,
+ rnoContent = /^(?:GET|HEAD)$/,
+ rbracket = /\[\]$/,
+ jsre = /\=\?(&|$)/,
+ rquery = /\?/,
+ rts = /([?&])_=[^&]*/,
+ rurl = /^(\w+:)?\/\/([^\/?#]+)/,
+ r20 = /%20/g,
+ rhash = /#.*$/,
+
+ // Keep a copy of the old load method
+ _load = jQuery.fn.load;
+
+jQuery.fn.extend({
+ load: function( url, params, callback ) {
+ if ( typeof url !== "string" && _load ) {
+ return _load.apply( this, arguments );
+
+ // Don't do a request if no elements are being requested
+ } else if ( !this.length ) {
+ return this;
+ }
+
+ var off = url.indexOf(" ");
+ if ( off >= 0 ) {
+ var selector = url.slice(off, url.length);
+ url = url.slice(0, off);
+ }
+
+ // Default to a GET request
+ var type = "GET";
+
+ // If the second parameter was provided
+ if ( params ) {
+ // If it's a function
+ if ( jQuery.isFunction( params ) ) {
+ // We assume that it's the callback
+ callback = params;
+ params = null;
+
+ // Otherwise, build a param string
+ } else if ( typeof params === "object" ) {
+ params = jQuery.param( params, jQuery.ajaxSettings.traditional );
+ type = "POST";
+ }
+ }
+
+ var self = this;
+
+ // Request the remote document
+ jQuery.ajax({
+ url: url,
+ type: type,
+ dataType: "html",
+ data: params,
+ complete: function( res, status ) {
+ // If successful, inject the HTML into all the matched elements
+ if ( status === "success" || status === "notmodified" ) {
+ // See if a selector was specified
+ self.html( selector ?
+ // Create a dummy div to hold the results
+ jQuery("<div>")
+ // inject the contents of the document in, removing the scripts
+ // to avoid any 'Permission Denied' errors in IE
+ .append(res.responseText.replace(rscript, ""))
+
+ // Locate the specified elements
+ .find(selector) :
+
+ // If not, just inject the full result
+ res.responseText );
+ }
+
+ if ( callback ) {
+ self.each( callback, [res.responseText, status, res] );
+ }
+ }
+ });
+
+ return this;
+ },
+
+ serialize: function() {
+ return jQuery.param(this.serializeArray());
+ },
+
+ serializeArray: function() {
+ return this.map(function() {
+ return this.elements ? jQuery.makeArray(this.elements) : this;
+ })
+ .filter(function() {
+ return this.name && !this.disabled &&
+ (this.checked || rselectTextarea.test(this.nodeName) ||
+ rinput.test(this.type));
+ })
+ .map(function( i, elem ) {
+ var val = jQuery(this).val();
+
+ return val == null ?
+ null :
+ jQuery.isArray(val) ?
+ jQuery.map( val, function( val, i ) {
+ return { name: elem.name, value: val };
+ }) :
+ { name: elem.name, value: val };
+ }).get();
+ }
+});
+
+// Attach a bunch of functions for handling common AJAX events
+jQuery.each( "ajaxStart ajaxStop ajaxComplete ajaxError ajaxSuccess ajaxSend".split(" "), function( i, o ) {
+ jQuery.fn[o] = function( f ) {
+ return this.bind(o, f);
+ };
+});
+
+jQuery.extend({
+ get: function( url, data, callback, type ) {
+ // shift arguments if data argument was omited
+ if ( jQuery.isFunction( data ) ) {
+ type = type || callback;
+ callback = data;
+ data = null;
+ }
+
+ return jQuery.ajax({
+ type: "GET",
+ url: url,
+ data: data,
+ success: callback,
+ dataType: type
+ });
+ },
+
+ getScript: function( url, callback ) {
+ return jQuery.get(url, null, callback, "script");
+ },
+
+ getJSON: function( url, data, callback ) {
+ return jQuery.get(url, data, callback, "json");
+ },
+
+ post: function( url, data, callback, type ) {
+ // shift arguments if data argument was omited
+ if ( jQuery.isFunction( data ) ) {
+ type = type || callback;
+ callback = data;
+ data = {};
+ }
+
+ return jQuery.ajax({
+ type: "POST",
+ url: url,
+ data: data,
+ success: callback,
+ dataType: type
+ });
+ },
+
+ ajaxSetup: function( settings ) {
+ jQuery.extend( jQuery.ajaxSettings, settings );
+ },
+
+ ajaxSettings: {
+ url: location.href,
+ global: true,
+ type: "GET",
+ contentType: "application/x-www-form-urlencoded",
+ processData: true,
+ async: true,
+ /*
+ timeout: 0,
+ data: null,
+ username: null,
+ password: null,
+ traditional: false,
+ */
+ // This function can be overriden by calling jQuery.ajaxSetup
+ xhr: function() {
+ return new window.XMLHttpRequest();
+ },
+ accepts: {
+ xml: "application/xml, text/xml",
+ html: "text/html",
+ script: "text/javascript, application/javascript",
+ json: "application/json, text/javascript",
+ text: "text/plain",
+ _default: "*/*"
+ }
+ },
+
+ ajax: function( origSettings ) {
+ var s = jQuery.extend(true, {}, jQuery.ajaxSettings, origSettings),
+ jsonp, status, data, type = s.type.toUpperCase(), noContent = rnoContent.test(type);
+
+ s.url = s.url.replace( rhash, "" );
+
+ // Use original (not extended) context object if it was provided
+ s.context = origSettings && origSettings.context != null ? origSettings.context : s;
+
+ // convert data if not already a string
+ if ( s.data && s.processData && typeof s.data !== "string" ) {
+ s.data = jQuery.param( s.data, s.traditional );
+ }
+
+ // Handle JSONP Parameter Callbacks
+ if ( s.dataType === "jsonp" ) {
+ if ( type === "GET" ) {
+ if ( !jsre.test( s.url ) ) {
+ s.url += (rquery.test( s.url ) ? "&" : "?") + (s.jsonp || "callback") + "=?";
+ }
+ } else if ( !s.data || !jsre.test(s.data) ) {
+ s.data = (s.data ? s.data + "&" : "") + (s.jsonp || "callback") + "=?";
+ }
+ s.dataType = "json";
+ }
+
+ // Build temporary JSONP function
+ if ( s.dataType === "json" && (s.data && jsre.test(s.data) || jsre.test(s.url)) ) {
+ jsonp = s.jsonpCallback || ("jsonp" + jsc++);
+
+ // Replace the =? sequence both in the query string and the data
+ if ( s.data ) {
+ s.data = (s.data + "").replace(jsre, "=" + jsonp + "$1");
+ }
+
+ s.url = s.url.replace(jsre, "=" + jsonp + "$1");
+
+ // We need to make sure
+ // that a JSONP style response is executed properly
+ s.dataType = "script";
+
+ // Handle JSONP-style loading
+ var customJsonp = window[ jsonp ];
+
+ window[ jsonp ] = function( tmp ) {
+ if ( jQuery.isFunction( customJsonp ) ) {
+ customJsonp( tmp );
+
+ } else {
+ // Garbage collect
+ window[ jsonp ] = undefined;
+
+ try {
+ delete window[ jsonp ];
+ } catch( jsonpError ) {}
+ }
+
+ data = tmp;
+ jQuery.handleSuccess( s, xhr, status, data );
+ jQuery.handleComplete( s, xhr, status, data );
+
+ if ( head ) {
+ head.removeChild( script );
+ }
+ };
+ }
+
+ if ( s.dataType === "script" && s.cache === null ) {
+ s.cache = false;
+ }
+
+ if ( s.cache === false && noContent ) {
+ var ts = jQuery.now();
+
+ // try replacing _= if it is there
+ var ret = s.url.replace(rts, "$1_=" + ts);
+
+ // if nothing was replaced, add timestamp to the end
+ s.url = ret + ((ret === s.url) ? (rquery.test(s.url) ? "&" : "?") + "_=" + ts : "");
+ }
+
+ // If data is available, append data to url for GET/HEAD requests
+ if ( s.data && noContent ) {
+ s.url += (rquery.test(s.url) ? "&" : "?") + s.data;
+ }
+
+ // Watch for a new set of requests
+ if ( s.global && jQuery.active++ === 0 ) {
+ jQuery.event.trigger( "ajaxStart" );
+ }
+
+ // Matches an absolute URL, and saves the domain
+ var parts = rurl.exec( s.url ),
+ remote = parts && (parts[1] && parts[1].toLowerCase() !== location.protocol || parts[2].toLowerCase() !== location.host);
+
+ // If we're requesting a remote document
+ // and trying to load JSON or Script with a GET
+ if ( s.dataType === "script" && type === "GET" && remote ) {
+ var head = document.getElementsByTagName("head")[0] || document.documentElement;
+ var script = document.createElement("script");
+ if ( s.scriptCharset ) {
+ script.charset = s.scriptCharset;
+ }
+ script.src = s.url;
+
+ // Handle Script loading
+ if ( !jsonp ) {
+ var done = false;
+
+ // Attach handlers for all browsers
+ script.onload = script.onreadystatechange = function() {
+ if ( !done && (!this.readyState ||
+ this.readyState === "loaded" || this.readyState === "complete") ) {
+ done = true;
+ jQuery.handleSuccess( s, xhr, status, data );
+ jQuery.handleComplete( s, xhr, status, data );
+
+ // Handle memory leak in IE
+ script.onload = script.onreadystatechange = null;
+ if ( head && script.parentNode ) {
+ head.removeChild( script );
+ }
+ }
+ };
+ }
+
+ // Use insertBefore instead of appendChild to circumvent an IE6 bug.
+ // This arises when a base node is used (#2709 and #4378).
+ head.insertBefore( script, head.firstChild );
+
+ // We handle everything using the script element injection
+ return undefined;
+ }
+
+ var requestDone = false;
+
+ // Create the request object
+ var xhr = s.xhr();
+
+ if ( !xhr ) {
+ return;
+ }
+
+ // Open the socket
+ // Passing null username, generates a login popup on Opera (#2865)
+ if ( s.username ) {
+ xhr.open(type, s.url, s.async, s.username, s.password);
+ } else {
+ xhr.open(type, s.url, s.async);
+ }
+
+ // Need an extra try/catch for cross domain requests in Firefox 3
+ try {
+ // Set content-type if data specified and content-body is valid for this type
+ if ( (s.data != null && !noContent) || (origSettings && origSettings.contentType) ) {
+ xhr.setRequestHeader("Content-Type", s.contentType);
+ }
+
+ // Set the If-Modified-Since and/or If-None-Match header, if in ifModified mode.
+ if ( s.ifModified ) {
+ if ( jQuery.lastModified[s.url] ) {
+ xhr.setRequestHeader("If-Modified-Since", jQuery.lastModified[s.url]);
+ }
+
+ if ( jQuery.etag[s.url] ) {
+ xhr.setRequestHeader("If-None-Match", jQuery.etag[s.url]);
+ }
+ }
+
+ // Set header so the called script knows that it's an XMLHttpRequest
+ // Only send the header if it's not a remote XHR
+ if ( !remote ) {
+ xhr.setRequestHeader("X-Requested-With", "XMLHttpRequest");
+ }
+
+ // Set the Accepts header for the server, depending on the dataType
+ xhr.setRequestHeader("Accept", s.dataType && s.accepts[ s.dataType ] ?
+ s.accepts[ s.dataType ] + ", */*; q=0.01" :
+ s.accepts._default );
+ } catch( headerError ) {}
+
+ // Allow custom headers/mimetypes and early abort
+ if ( s.beforeSend && s.beforeSend.call(s.context, xhr, s) === false ) {
+ // Handle the global AJAX counter
+ if ( s.global && jQuery.active-- === 1 ) {
+ jQuery.event.trigger( "ajaxStop" );
+ }
+
+ // close opended socket
+ xhr.abort();
+ return false;
+ }
+
+ if ( s.global ) {
+ jQuery.triggerGlobal( s, "ajaxSend", [xhr, s] );
+ }
+
+ // Wait for a response to come back
+ var onreadystatechange = xhr.onreadystatechange = function( isTimeout ) {
+ // The request was aborted
+ if ( !xhr || xhr.readyState === 0 || isTimeout === "abort" ) {
+ // Opera doesn't call onreadystatechange before this point
+ // so we simulate the call
+ if ( !requestDone ) {
+ jQuery.handleComplete( s, xhr, status, data );
+ }
+
+ requestDone = true;
+ if ( xhr ) {
+ xhr.onreadystatechange = jQuery.noop;
+ }
+
+ // The transfer is complete and the data is available, or the request timed out
+ } else if ( !requestDone && xhr && (xhr.readyState === 4 || isTimeout === "timeout") ) {
+ requestDone = true;
+ xhr.onreadystatechange = jQuery.noop;
+
+ status = isTimeout === "timeout" ?
+ "timeout" :
+ !jQuery.httpSuccess( xhr ) ?
+ "error" :
+ s.ifModified && jQuery.httpNotModified( xhr, s.url ) ?
+ "notmodified" :
+ "success";
+
+ var errMsg;
+
+ if ( status === "success" ) {
+ // Watch for, and catch, XML document parse errors
+ try {
+ // process the data (runs the xml through httpData regardless of callback)
+ data = jQuery.httpData( xhr, s.dataType, s );
+ } catch( parserError ) {
+ status = "parsererror";
+ errMsg = parserError;
+ }
+ }
+
+ // Make sure that the request was successful or notmodified
+ if ( status === "success" || status === "notmodified" ) {
+ // JSONP handles its own success callback
+ if ( !jsonp ) {
+ jQuery.handleSuccess( s, xhr, status, data );
+ }
+ } else {
+ jQuery.handleError( s, xhr, status, errMsg );
+ }
+
+ // Fire the complete handlers
+ if ( !jsonp ) {
+ jQuery.handleComplete( s, xhr, status, data );
+ }
+
+ if ( isTimeout === "timeout" ) {
+ xhr.abort();
+ }
+
+ // Stop memory leaks
+ if ( s.async ) {
+ xhr = null;
+ }
+ }
+ };
+
+ // Override the abort handler, if we can (IE 6 doesn't allow it, but that's OK)
+ // Opera doesn't fire onreadystatechange at all on abort
+ try {
+ var oldAbort = xhr.abort;
+ xhr.abort = function() {
+ if ( xhr ) {
+ // oldAbort has no call property in IE7 so
+ // just do it this way, which works in all
+ // browsers
+ Function.prototype.call.call( oldAbort, xhr );
+ }
+
+ onreadystatechange( "abort" );
+ };
+ } catch( abortError ) {}
+
+ // Timeout checker
+ if ( s.async && s.timeout > 0 ) {
+ setTimeout(function() {
+ // Check to see if the request is still happening
+ if ( xhr && !requestDone ) {
+ onreadystatechange( "timeout" );
+ }
+ }, s.timeout);
+ }
+
+ // Send the data
+ try {
+ xhr.send( noContent || s.data == null ? null : s.data );
+
+ } catch( sendError ) {
+ jQuery.handleError( s, xhr, null, sendError );
+
+ // Fire the complete handlers
+ jQuery.handleComplete( s, xhr, status, data );
+ }
+
+ // firefox 1.5 doesn't fire statechange for sync requests
+ if ( !s.async ) {
+ onreadystatechange();
+ }
+
+ // return XMLHttpRequest to allow aborting the request etc.
+ return xhr;
+ },
+
+ // Serialize an array of form elements or a set of
+ // key/values into a query string
+ param: function( a, traditional ) {
+ var s = [],
+ add = function( key, value ) {
+ // If value is a function, invoke it and return its value
+ value = jQuery.isFunction(value) ? value() : value;
+ s[ s.length ] = encodeURIComponent(key) + "=" + encodeURIComponent(value);
+ };
+
+ // Set traditional to true for jQuery <= 1.3.2 behavior.
+ if ( traditional === undefined ) {
+ traditional = jQuery.ajaxSettings.traditional;
+ }
+
+ // If an array was passed in, assume that it is an array of form elements.
+ if ( jQuery.isArray(a) || a.jquery ) {
+ // Serialize the form elements
+ jQuery.each( a, function() {
+ add( this.name, this.value );
+ });
+
+ } else {
+ // If traditional, encode the "old" way (the way 1.3.2 or older
+ // did it), otherwise encode params recursively.
+ for ( var prefix in a ) {
+ buildParams( prefix, a[prefix], traditional, add );
+ }
+ }
+
+ // Return the resulting serialization
+ return s.join("&").replace(r20, "+");
+ }
+});
+
+function buildParams( prefix, obj, traditional, add ) {
+ if ( jQuery.isArray(obj) && obj.length ) {
+ // Serialize array item.
+ jQuery.each( obj, function( i, v ) {
+ if ( traditional || rbracket.test( prefix ) ) {
+ // Treat each array item as a scalar.
+ add( prefix, v );
+
+ } else {
+ // If array item is non-scalar (array or object), encode its
+ // numeric index to resolve deserialization ambiguity issues.
+ // Note that rack (as of 1.0.0) can't currently deserialize
+ // nested arrays properly, and attempting to do so may cause
+ // a server error. Possible fixes are to modify rack's
+ // deserialization algorithm or to provide an option or flag
+ // to force array serialization to be shallow.
+ buildParams( prefix + "[" + ( typeof v === "object" || jQuery.isArray(v) ? i : "" ) + "]", v, traditional, add );
+ }
+ });
+
+ } else if ( !traditional && obj != null && typeof obj === "object" ) {
+ if ( jQuery.isEmptyObject( obj ) ) {
+ add( prefix, "" );
+
+ // Serialize object item.
+ } else {
+ jQuery.each( obj, function( k, v ) {
+ buildParams( prefix + "[" + k + "]", v, traditional, add );
+ });
+ }
+
+ } else {
+ // Serialize scalar item.
+ add( prefix, obj );
+ }
+}
+
+// This is still on the jQuery object... for now
+// Want to move this to jQuery.ajax some day
+jQuery.extend({
+
+ // Counter for holding the number of active queries
+ active: 0,
+
+ // Last-Modified header cache for next request
+ lastModified: {},
+ etag: {},
+
+ handleError: function( s, xhr, status, e ) {
+ // If a local callback was specified, fire it
+ if ( s.error ) {
+ s.error.call( s.context, xhr, status, e );
+ }
+
+ // Fire the global callback
+ if ( s.global ) {
+ jQuery.triggerGlobal( s, "ajaxError", [xhr, s, e] );
+ }
+ },
+
+ handleSuccess: function( s, xhr, status, data ) {
+ // If a local callback was specified, fire it and pass it the data
+ if ( s.success ) {
+ s.success.call( s.context, data, status, xhr );
+ }
+
+ // Fire the global callback
+ if ( s.global ) {
+ jQuery.triggerGlobal( s, "ajaxSuccess", [xhr, s] );
+ }
+ },
+
+ handleComplete: function( s, xhr, status ) {
+ // Process result
+ if ( s.complete ) {
+ s.complete.call( s.context, xhr, status );
+ }
+
+ // The request was completed
+ if ( s.global ) {
+ jQuery.triggerGlobal( s, "ajaxComplete", [xhr, s] );
+ }
+
+ // Handle the global AJAX counter
+ if ( s.global && jQuery.active-- === 1 ) {
+ jQuery.event.trigger( "ajaxStop" );
+ }
+ },
+
+ triggerGlobal: function( s, type, args ) {
+ (s.context && s.context.url == null ? jQuery(s.context) : jQuery.event).trigger(type, args);
+ },
+
+ // Determines if an XMLHttpRequest was successful or not
+ httpSuccess: function( xhr ) {
+ try {
+ // IE error sometimes returns 1223 when it should be 204 so treat it as success, see #1450
+ return !xhr.status && location.protocol === "file:" ||
+ xhr.status >= 200 && xhr.status < 300 ||
+ xhr.status === 304 || xhr.status === 1223;
+ } catch(e) {}
+
+ return false;
+ },
+
+ // Determines if an XMLHttpRequest returns NotModified
+ httpNotModified: function( xhr, url ) {
+ var lastModified = xhr.getResponseHeader("Last-Modified"),
+ etag = xhr.getResponseHeader("Etag");
+
+ if ( lastModified ) {
+ jQuery.lastModified[url] = lastModified;
+ }
+
+ if ( etag ) {
+ jQuery.etag[url] = etag;
+ }
+
+ return xhr.status === 304;
+ },
+
+ httpData: function( xhr, type, s ) {
+ var ct = xhr.getResponseHeader("content-type") || "",
+ xml = type === "xml" || !type && ct.indexOf("xml") >= 0,
+ data = xml ? xhr.responseXML : xhr.responseText;
+
+ if ( xml && data.documentElement.nodeName === "parsererror" ) {
+ jQuery.error( "parsererror" );
+ }
+
+ // Allow a pre-filtering function to sanitize the response
+ // s is checked to keep backwards compatibility
+ if ( s && s.dataFilter ) {
+ data = s.dataFilter( data, type );
+ }
+
+ // The filter can actually parse the response
+ if ( typeof data === "string" ) {
+ // Get the JavaScript object, if JSON is used.
+ if ( type === "json" || !type && ct.indexOf("json") >= 0 ) {
+ data = jQuery.parseJSON( data );
+
+ // If the type is "script", eval it in global context
+ } else if ( type === "script" || !type && ct.indexOf("javascript") >= 0 ) {
+ jQuery.globalEval( data );
+ }
+ }
+
+ return data;
+ }
+
+});
+
+/*
+ * Create the request object; Microsoft failed to properly
+ * implement the XMLHttpRequest in IE7 (can't request local files),
+ * so we use the ActiveXObject when it is available
+ * Additionally XMLHttpRequest can be disabled in IE7/IE8 so
+ * we need a fallback.
+ */
+if ( window.ActiveXObject ) {
+ jQuery.ajaxSettings.xhr = function() {
+ if ( window.location.protocol !== "file:" ) {
+ try {
+ return new window.XMLHttpRequest();
+ } catch(xhrError) {}
+ }
+
+ try {
+ return new window.ActiveXObject("Microsoft.XMLHTTP");
+ } catch(activeError) {}
+ };
+}
+
+// Does this browser support XHR requests?
+jQuery.support.ajax = !!jQuery.ajaxSettings.xhr();
+
+
+
+
+var elemdisplay = {},
+ rfxtypes = /^(?:toggle|show|hide)$/,
+ rfxnum = /^([+\-]=)?([\d+.\-]+)(.*)$/,
+ timerId,
+ fxAttrs = [
+ // height animations
+ [ "height", "marginTop", "marginBottom", "paddingTop", "paddingBottom" ],
+ // width animations
+ [ "width", "marginLeft", "marginRight", "paddingLeft", "paddingRight" ],
+ // opacity animations
+ [ "opacity" ]
+ ];
+
+jQuery.fn.extend({
+ show: function( speed, easing, callback ) {
+ var elem, display;
+
+ if ( speed || speed === 0 ) {
+ return this.animate( genFx("show", 3), speed, easing, callback);
+
+ } else {
+ for ( var i = 0, j = this.length; i < j; i++ ) {
+ elem = this[i];
+ display = elem.style.display;
+
+ // Reset the inline display of this element to learn if it is
+ // being hidden by cascaded rules or not
+ if ( !jQuery.data(elem, "olddisplay") && display === "none" ) {
+ display = elem.style.display = "";
+ }
+
+ // Set elements which have been overridden with display: none
+ // in a stylesheet to whatever the default browser style is
+ // for such an element
+ if ( display === "" && jQuery.css( elem, "display" ) === "none" ) {
+ jQuery.data(elem, "olddisplay", defaultDisplay(elem.nodeName));
+ }
+ }
+
+ // Set the display of most of the elements in a second loop
+ // to avoid the constant reflow
+ for ( i = 0; i < j; i++ ) {
+ elem = this[i];
+ display = elem.style.display;
+
+ if ( display === "" || display === "none" ) {
+ elem.style.display = jQuery.data(elem, "olddisplay") || "";
+ }
+ }
+
+ return this;
+ }
+ },
+
+ hide: function( speed, easing, callback ) {
+ if ( speed || speed === 0 ) {
+ return this.animate( genFx("hide", 3), speed, easing, callback);
+
+ } else {
+ for ( var i = 0, j = this.length; i < j; i++ ) {
+ var display = jQuery.css( this[i], "display" );
+
+ if ( display !== "none" ) {
+ jQuery.data( this[i], "olddisplay", display );
+ }
+ }
+
+ // Set the display of the elements in a second loop
+ // to avoid the constant reflow
+ for ( i = 0; i < j; i++ ) {
+ this[i].style.display = "none";
+ }
+
+ return this;
+ }
+ },
+
+ // Save the old toggle function
+ _toggle: jQuery.fn.toggle,
+
+ toggle: function( fn, fn2, callback ) {
+ var bool = typeof fn === "boolean";
+
+ if ( jQuery.isFunction(fn) && jQuery.isFunction(fn2) ) {
+ this._toggle.apply( this, arguments );
+
+ } else if ( fn == null || bool ) {
+ this.each(function() {
+ var state = bool ? fn : jQuery(this).is(":hidden");
+ jQuery(this)[ state ? "show" : "hide" ]();
+ });
+
+ } else {
+ this.animate(genFx("toggle", 3), fn, fn2, callback);
+ }
+
+ return this;
+ },
+
+ fadeTo: function( speed, to, easing, callback ) {
+ return this.filter(":hidden").css("opacity", 0).show().end()
+ .animate({opacity: to}, speed, easing, callback);
+ },
+
+ animate: function( prop, speed, easing, callback ) {
+ var optall = jQuery.speed(speed, easing, callback);
+
+ if ( jQuery.isEmptyObject( prop ) ) {
+ return this.each( optall.complete );
+ }
+
+ return this[ optall.queue === false ? "each" : "queue" ](function() {
+ // XXX 'this' does not always have a nodeName when running the
+ // test suite
+
+ var opt = jQuery.extend({}, optall), p,
+ isElement = this.nodeType === 1,
+ hidden = isElement && jQuery(this).is(":hidden"),
+ self = this;
+
+ for ( p in prop ) {
+ var name = jQuery.camelCase( p );
+
+ if ( p !== name ) {
+ prop[ name ] = prop[ p ];
+ delete prop[ p ];
+ p = name;
+ }
+
+ if ( prop[p] === "hide" && hidden || prop[p] === "show" && !hidden ) {
+ return opt.complete.call(this);
+ }
+
+ if ( isElement && ( p === "height" || p === "width" ) ) {
+ // Make sure that nothing sneaks out
+ // Record all 3 overflow attributes because IE does not
+ // change the overflow attribute when overflowX and
+ // overflowY are set to the same value
+ opt.overflow = [ this.style.overflow, this.style.overflowX, this.style.overflowY ];
+
+ // Set display property to inline-block for height/width
+ // animations on inline elements that are having width/height
+ // animated
+ if ( jQuery.css( this, "display" ) === "inline" &&
+ jQuery.css( this, "float" ) === "none" ) {
+ if ( !jQuery.support.inlineBlockNeedsLayout ) {
+ this.style.display = "inline-block";
+
+ } else {
+ var display = defaultDisplay(this.nodeName);
+
+ // inline-level elements accept inline-block;
+ // block-level elements need to be inline with layout
+ if ( display === "inline" ) {
+ this.style.display = "inline-block";
+
+ } else {
+ this.style.display = "inline";
+ this.style.zoom = 1;
+ }
+ }
+ }
+ }
+
+ if ( jQuery.isArray( prop[p] ) ) {
+ // Create (if needed) and add to specialEasing
+ (opt.specialEasing = opt.specialEasing || {})[p] = prop[p][1];
+ prop[p] = prop[p][0];
+ }
+ }
+
+ if ( opt.overflow != null ) {
+ this.style.overflow = "hidden";
+ }
+
+ opt.curAnim = jQuery.extend({}, prop);
+
+ jQuery.each( prop, function( name, val ) {
+ var e = new jQuery.fx( self, opt, name );
+
+ if ( rfxtypes.test(val) ) {
+ e[ val === "toggle" ? hidden ? "show" : "hide" : val ]( prop );
+
+ } else {
+ var parts = rfxnum.exec(val),
+ start = e.cur() || 0;
+
+ if ( parts ) {
+ var end = parseFloat( parts[2] ),
+ unit = parts[3] || "px";
+
+ // We need to compute starting value
+ if ( unit !== "px" ) {
+ jQuery.style( self, name, (end || 1) + unit);
+ start = ((end || 1) / e.cur()) * start;
+ jQuery.style( self, name, start + unit);
+ }
+
+ // If a +=/-= token was provided, we're doing a relative animation
+ if ( parts[1] ) {
+ end = ((parts[1] === "-=" ? -1 : 1) * end) + start;
+ }
+
+ e.custom( start, end, unit );
+
+ } else {
+ e.custom( start, val, "" );
+ }
+ }
+ });
+
+ // For JS strict compliance
+ return true;
+ });
+ },
+
+ stop: function( clearQueue, gotoEnd ) {
+ var timers = jQuery.timers;
+
+ if ( clearQueue ) {
+ this.queue([]);
+ }
+
+ this.each(function() {
+ // go in reverse order so anything added to the queue during the loop is ignored
+ for ( var i = timers.length - 1; i >= 0; i-- ) {
+ if ( timers[i].elem === this ) {
+ if (gotoEnd) {
+ // force the next step to be the last
+ timers[i](true);
+ }
+
+ timers.splice(i, 1);
+ }
+ }
+ });
+
+ // start the next in the queue if the last step wasn't forced
+ if ( !gotoEnd ) {
+ this.dequeue();
+ }
+
+ return this;
+ }
+
+});
+
+function genFx( type, num ) {
+ var obj = {};
+
+ jQuery.each( fxAttrs.concat.apply([], fxAttrs.slice(0,num)), function() {
+ obj[ this ] = type;
+ });
+
+ return obj;
+}
+
+// Generate shortcuts for custom animations
+jQuery.each({
+ slideDown: genFx("show", 1),
+ slideUp: genFx("hide", 1),
+ slideToggle: genFx("toggle", 1),
+ fadeIn: { opacity: "show" },
+ fadeOut: { opacity: "hide" },
+ fadeToggle: { opacity: "toggle" }
+}, function( name, props ) {
+ jQuery.fn[ name ] = function( speed, easing, callback ) {
+ return this.animate( props, speed, easing, callback );
+ };
+});
+
+jQuery.extend({
+ speed: function( speed, easing, fn ) {
+ var opt = speed && typeof speed === "object" ? jQuery.extend({}, speed) : {
+ complete: fn || !fn && easing ||
+ jQuery.isFunction( speed ) && speed,
+ duration: speed,
+ easing: fn && easing || easing && !jQuery.isFunction(easing) && easing
+ };
+
+ opt.duration = jQuery.fx.off ? 0 : typeof opt.duration === "number" ? opt.duration :
+ opt.duration in jQuery.fx.speeds ? jQuery.fx.speeds[opt.duration] : jQuery.fx.speeds._default;
+
+ // Queueing
+ opt.old = opt.complete;
+ opt.complete = function() {
+ if ( opt.queue !== false ) {
+ jQuery(this).dequeue();
+ }
+ if ( jQuery.isFunction( opt.old ) ) {
+ opt.old.call( this );
+ }
+ };
+
+ return opt;
+ },
+
+ easing: {
+ linear: function( p, n, firstNum, diff ) {
+ return firstNum + diff * p;
+ },
+ swing: function( p, n, firstNum, diff ) {
+ return ((-Math.cos(p*Math.PI)/2) + 0.5) * diff + firstNum;
+ }
+ },
+
+ timers: [],
+
+ fx: function( elem, options, prop ) {
+ this.options = options;
+ this.elem = elem;
+ this.prop = prop;
+
+ if ( !options.orig ) {
+ options.orig = {};
+ }
+ }
+
+});
+
+jQuery.fx.prototype = {
+ // Simple function for setting a style value
+ update: function() {
+ if ( this.options.step ) {
+ this.options.step.call( this.elem, this.now, this );
+ }
+
+ (jQuery.fx.step[this.prop] || jQuery.fx.step._default)( this );
+ },
+
+ // Get the current size
+ cur: function() {
+ if ( this.elem[this.prop] != null && (!this.elem.style || this.elem.style[this.prop] == null) ) {
+ return this.elem[ this.prop ];
+ }
+
+ var r = parseFloat( jQuery.css( this.elem, this.prop ) );
+ return r && r > -10000 ? r : 0;
+ },
+
+ // Start an animation from one number to another
+ custom: function( from, to, unit ) {
+ var self = this,
+ fx = jQuery.fx;
+
+ this.startTime = jQuery.now();
+ this.start = from;
+ this.end = to;
+ this.unit = unit || this.unit || "px";
+ this.now = this.start;
+ this.pos = this.state = 0;
+
+ function t( gotoEnd ) {
+ return self.step(gotoEnd);
+ }
+
+ t.elem = this.elem;
+
+ if ( t() && jQuery.timers.push(t) && !timerId ) {
+ timerId = setInterval(fx.tick, fx.interval);
+ }
+ },
+
+ // Simple 'show' function
+ show: function() {
+ // Remember where we started, so that we can go back to it later
+ this.options.orig[this.prop] = jQuery.style( this.elem, this.prop );
+ this.options.show = true;
+
+ // Begin the animation
+ // Make sure that we start at a small width/height to avoid any
+ // flash of content
+ this.custom(this.prop === "width" || this.prop === "height" ? 1 : 0, this.cur());
+
+ // Start by showing the element
+ jQuery( this.elem ).show();
+ },
+
+ // Simple 'hide' function
+ hide: function() {
+ // Remember where we started, so that we can go back to it later
+ this.options.orig[this.prop] = jQuery.style( this.elem, this.prop );
+ this.options.hide = true;
+
+ // Begin the animation
+ this.custom(this.cur(), 0);
+ },
+
+ // Each step of an animation
+ step: function( gotoEnd ) {
+ var t = jQuery.now(), done = true;
+
+ if ( gotoEnd || t >= this.options.duration + this.startTime ) {
+ this.now = this.end;
+ this.pos = this.state = 1;
+ this.update();
+
+ this.options.curAnim[ this.prop ] = true;
+
+ for ( var i in this.options.curAnim ) {
+ if ( this.options.curAnim[i] !== true ) {
+ done = false;
+ }
+ }
+
+ if ( done ) {
+ // Reset the overflow
+ if ( this.options.overflow != null && !jQuery.support.shrinkWrapBlocks ) {
+ var elem = this.elem,
+ options = this.options;
+
+ jQuery.each( [ "", "X", "Y" ], function (index, value) {
+ elem.style[ "overflow" + value ] = options.overflow[index];
+ } );
+ }
+
+ // Hide the element if the "hide" operation was done
+ if ( this.options.hide ) {
+ jQuery(this.elem).hide();
+ }
+
+ // Reset the properties, if the item has been hidden or shown
+ if ( this.options.hide || this.options.show ) {
+ for ( var p in this.options.curAnim ) {
+ jQuery.style( this.elem, p, this.options.orig[p] );
+ }
+ }
+
+ // Execute the complete function
+ this.options.complete.call( this.elem );
+ }
+
+ return false;
+
+ } else {
+ var n = t - this.startTime;
+ this.state = n / this.options.duration;
+
+ // Perform the easing function, defaults to swing
+ var specialEasing = this.options.specialEasing && this.options.specialEasing[this.prop];
+ var defaultEasing = this.options.easing || (jQuery.easing.swing ? "swing" : "linear");
+ this.pos = jQuery.easing[specialEasing || defaultEasing](this.state, n, 0, 1, this.options.duration);
+ this.now = this.start + ((this.end - this.start) * this.pos);
+
+ // Perform the next step of the animation
+ this.update();
+ }
+
+ return true;
+ }
+};
+
+jQuery.extend( jQuery.fx, {
+ tick: function() {
+ var timers = jQuery.timers;
+
+ for ( var i = 0; i < timers.length; i++ ) {
+ if ( !timers[i]() ) {
+ timers.splice(i--, 1);
+ }
+ }
+
+ if ( !timers.length ) {
+ jQuery.fx.stop();
+ }
+ },
+
+ interval: 13,
+
+ stop: function() {
+ clearInterval( timerId );
+ timerId = null;
+ },
+
+ speeds: {
+ slow: 600,
+ fast: 200,
+ // Default speed
+ _default: 400
+ },
+
+ step: {
+ opacity: function( fx ) {
+ jQuery.style( fx.elem, "opacity", fx.now );
+ },
+
+ _default: function( fx ) {
+ if ( fx.elem.style && fx.elem.style[ fx.prop ] != null ) {
+ fx.elem.style[ fx.prop ] = (fx.prop === "width" || fx.prop === "height" ? Math.max(0, fx.now) : fx.now) + fx.unit;
+ } else {
+ fx.elem[ fx.prop ] = fx.now;
+ }
+ }
+ }
+});
+
+if ( jQuery.expr && jQuery.expr.filters ) {
+ jQuery.expr.filters.animated = function( elem ) {
+ return jQuery.grep(jQuery.timers, function( fn ) {
+ return elem === fn.elem;
+ }).length;
+ };
+}
+
+function defaultDisplay( nodeName ) {
+ if ( !elemdisplay[ nodeName ] ) {
+ var elem = jQuery("<" + nodeName + ">").appendTo("body"),
+ display = elem.css("display");
+
+ elem.remove();
+
+ if ( display === "none" || display === "" ) {
+ display = "block";
+ }
+
+ elemdisplay[ nodeName ] = display;
+ }
+
+ return elemdisplay[ nodeName ];
+}
+
+
+
+
+var rtable = /^t(?:able|d|h)$/i,
+ rroot = /^(?:body|html)$/i;
+
+if ( "getBoundingClientRect" in document.documentElement ) {
+ jQuery.fn.offset = function( options ) {
+ var elem = this[0], box;
+
+ if ( options ) {
+ return this.each(function( i ) {
+ jQuery.offset.setOffset( this, options, i );
+ });
+ }
+
+ if ( !elem || !elem.ownerDocument ) {
+ return null;
+ }
+
+ if ( elem === elem.ownerDocument.body ) {
+ return jQuery.offset.bodyOffset( elem );
+ }
+
+ try {
+ box = elem.getBoundingClientRect();
+ } catch(e) {}
+
+ var doc = elem.ownerDocument,
+ docElem = doc.documentElement;
+
+ // Make sure we're not dealing with a disconnected DOM node
+ if ( !box || !jQuery.contains( docElem, elem ) ) {
+ return box || { top: 0, left: 0 };
+ }
+
+ var body = doc.body,
+ win = getWindow(doc),
+ clientTop = docElem.clientTop || body.clientTop || 0,
+ clientLeft = docElem.clientLeft || body.clientLeft || 0,
+ scrollTop = (win.pageYOffset || jQuery.support.boxModel && docElem.scrollTop || body.scrollTop ),
+ scrollLeft = (win.pageXOffset || jQuery.support.boxModel && docElem.scrollLeft || body.scrollLeft),
+ top = box.top + scrollTop - clientTop,
+ left = box.left + scrollLeft - clientLeft;
+
+ return { top: top, left: left };
+ };
+
+} else {
+ jQuery.fn.offset = function( options ) {
+ var elem = this[0];
+
+ if ( options ) {
+ return this.each(function( i ) {
+ jQuery.offset.setOffset( this, options, i );
+ });
+ }
+
+ if ( !elem || !elem.ownerDocument ) {
+ return null;
+ }
+
+ if ( elem === elem.ownerDocument.body ) {
+ return jQuery.offset.bodyOffset( elem );
+ }
+
+ jQuery.offset.initialize();
+
+ var computedStyle,
+ offsetParent = elem.offsetParent,
+ prevOffsetParent = elem,
+ doc = elem.ownerDocument,
+ docElem = doc.documentElement,
+ body = doc.body,
+ defaultView = doc.defaultView,
+ prevComputedStyle = defaultView ? defaultView.getComputedStyle( elem, null ) : elem.currentStyle,
+ top = elem.offsetTop,
+ left = elem.offsetLeft;
+
+ while ( (elem = elem.parentNode) && elem !== body && elem !== docElem ) {
+ if ( jQuery.offset.supportsFixedPosition && prevComputedStyle.position === "fixed" ) {
+ break;
+ }
+
+ computedStyle = defaultView ? defaultView.getComputedStyle(elem, null) : elem.currentStyle;
+ top -= elem.scrollTop;
+ left -= elem.scrollLeft;
+
+ if ( elem === offsetParent ) {
+ top += elem.offsetTop;
+ left += elem.offsetLeft;
+
+ if ( jQuery.offset.doesNotAddBorder && !(jQuery.offset.doesAddBorderForTableAndCells && rtable.test(elem.nodeName)) ) {
+ top += parseFloat( computedStyle.borderTopWidth ) || 0;
+ left += parseFloat( computedStyle.borderLeftWidth ) || 0;
+ }
+
+ prevOffsetParent = offsetParent;
+ offsetParent = elem.offsetParent;
+ }
+
+ if ( jQuery.offset.subtractsBorderForOverflowNotVisible && computedStyle.overflow !== "visible" ) {
+ top += parseFloat( computedStyle.borderTopWidth ) || 0;
+ left += parseFloat( computedStyle.borderLeftWidth ) || 0;
+ }
+
+ prevComputedStyle = computedStyle;
+ }
+
+ if ( prevComputedStyle.position === "relative" || prevComputedStyle.position === "static" ) {
+ top += body.offsetTop;
+ left += body.offsetLeft;
+ }
+
+ if ( jQuery.offset.supportsFixedPosition && prevComputedStyle.position === "fixed" ) {
+ top += Math.max( docElem.scrollTop, body.scrollTop );
+ left += Math.max( docElem.scrollLeft, body.scrollLeft );
+ }
+
+ return { top: top, left: left };
+ };
+}
+
+jQuery.offset = {
+ initialize: function() {
+ var body = document.body, container = document.createElement("div"), innerDiv, checkDiv, table, td, bodyMarginTop = parseFloat( jQuery.css(body, "marginTop") ) || 0,
+ html = "<div style='position:absolute;top:0;left:0;margin:0;border:5px solid #000;padding:0;width:1px;height:1px;'><div></div></div><table style='position:absolute;top:0;left:0;margin:0;border:5px solid #000;padding:0;width:1px;height:1px;' cellpadding='0' cellspacing='0'><tr><td></td></tr></table>";
+
+ jQuery.extend( container.style, { position: "absolute", top: 0, left: 0, margin: 0, border: 0, width: "1px", height: "1px", visibility: "hidden" } );
+
+ container.innerHTML = html;
+ body.insertBefore( container, body.firstChild );
+ innerDiv = container.firstChild;
+ checkDiv = innerDiv.firstChild;
+ td = innerDiv.nextSibling.firstChild.firstChild;
+
+ this.doesNotAddBorder = (checkDiv.offsetTop !== 5);
+ this.doesAddBorderForTableAndCells = (td.offsetTop === 5);
+
+ checkDiv.style.position = "fixed";
+ checkDiv.style.top = "20px";
+
+ // safari subtracts parent border width here which is 5px
+ this.supportsFixedPosition = (checkDiv.offsetTop === 20 || checkDiv.offsetTop === 15);
+ checkDiv.style.position = checkDiv.style.top = "";
+
+ innerDiv.style.overflow = "hidden";
+ innerDiv.style.position = "relative";
+
+ this.subtractsBorderForOverflowNotVisible = (checkDiv.offsetTop === -5);
+
+ this.doesNotIncludeMarginInBodyOffset = (body.offsetTop !== bodyMarginTop);
+
+ body.removeChild( container );
+ body = container = innerDiv = checkDiv = table = td = null;
+ jQuery.offset.initialize = jQuery.noop;
+ },
+
+ bodyOffset: function( body ) {
+ var top = body.offsetTop,
+ left = body.offsetLeft;
+
+ jQuery.offset.initialize();
+
+ if ( jQuery.offset.doesNotIncludeMarginInBodyOffset ) {
+ top += parseFloat( jQuery.css(body, "marginTop") ) || 0;
+ left += parseFloat( jQuery.css(body, "marginLeft") ) || 0;
+ }
+
+ return { top: top, left: left };
+ },
+
+ setOffset: function( elem, options, i ) {
+ var position = jQuery.css( elem, "position" );
+
+ // set position first, in-case top/left are set even on static elem
+ if ( position === "static" ) {
+ elem.style.position = "relative";
+ }
+
+ var curElem = jQuery( elem ),
+ curOffset = curElem.offset(),
+ curCSSTop = jQuery.css( elem, "top" ),
+ curCSSLeft = jQuery.css( elem, "left" ),
+ calculatePosition = (position === "absolute" && jQuery.inArray('auto', [curCSSTop, curCSSLeft]) > -1),
+ props = {}, curPosition = {}, curTop, curLeft;
+
+ // need to be able to calculate position if either top or left is auto and position is absolute
+ if ( calculatePosition ) {
+ curPosition = curElem.position();
+ }
+
+ curTop = calculatePosition ? curPosition.top : parseInt( curCSSTop, 10 ) || 0;
+ curLeft = calculatePosition ? curPosition.left : parseInt( curCSSLeft, 10 ) || 0;
+
+ if ( jQuery.isFunction( options ) ) {
+ options = options.call( elem, i, curOffset );
+ }
+
+ if (options.top != null) {
+ props.top = (options.top - curOffset.top) + curTop;
+ }
+ if (options.left != null) {
+ props.left = (options.left - curOffset.left) + curLeft;
+ }
+
+ if ( "using" in options ) {
+ options.using.call( elem, props );
+ } else {
+ curElem.css( props );
+ }
+ }
+};
+
+
+jQuery.fn.extend({
+ position: function() {
+ if ( !this[0] ) {
+ return null;
+ }
+
+ var elem = this[0],
+
+ // Get *real* offsetParent
+ offsetParent = this.offsetParent(),
+
+ // Get correct offsets
+ offset = this.offset(),
+ parentOffset = rroot.test(offsetParent[0].nodeName) ? { top: 0, left: 0 } : offsetParent.offset();
+
+ // Subtract element margins
+ // note: when an element has margin: auto the offsetLeft and marginLeft
+ // are the same in Safari causing offset.left to incorrectly be 0
+ offset.top -= parseFloat( jQuery.css(elem, "marginTop") ) || 0;
+ offset.left -= parseFloat( jQuery.css(elem, "marginLeft") ) || 0;
+
+ // Add offsetParent borders
+ parentOffset.top += parseFloat( jQuery.css(offsetParent[0], "borderTopWidth") ) || 0;
+ parentOffset.left += parseFloat( jQuery.css(offsetParent[0], "borderLeftWidth") ) || 0;
+
+ // Subtract the two offsets
+ return {
+ top: offset.top - parentOffset.top,
+ left: offset.left - parentOffset.left
+ };
+ },
+
+ offsetParent: function() {
+ return this.map(function() {
+ var offsetParent = this.offsetParent || document.body;
+ while ( offsetParent && (!rroot.test(offsetParent.nodeName) && jQuery.css(offsetParent, "position") === "static") ) {
+ offsetParent = offsetParent.offsetParent;
+ }
+ return offsetParent;
+ });
+ }
+});
+
+
+// Create scrollLeft and scrollTop methods
+jQuery.each( ["Left", "Top"], function( i, name ) {
+ var method = "scroll" + name;
+
+ jQuery.fn[ method ] = function(val) {
+ var elem = this[0], win;
+
+ if ( !elem ) {
+ return null;
+ }
+
+ if ( val !== undefined ) {
+ // Set the scroll offset
+ return this.each(function() {
+ win = getWindow( this );
+
+ if ( win ) {
+ win.scrollTo(
+ !i ? val : jQuery(win).scrollLeft(),
+ i ? val : jQuery(win).scrollTop()
+ );
+
+ } else {
+ this[ method ] = val;
+ }
+ });
+ } else {
+ win = getWindow( elem );
+
+ // Return the scroll offset
+ return win ? ("pageXOffset" in win) ? win[ i ? "pageYOffset" : "pageXOffset" ] :
+ jQuery.support.boxModel && win.document.documentElement[ method ] ||
+ win.document.body[ method ] :
+ elem[ method ];
+ }
+ };
+});
+
+function getWindow( elem ) {
+ return jQuery.isWindow( elem ) ?
+ elem :
+ elem.nodeType === 9 ?
+ elem.defaultView || elem.parentWindow :
+ false;
+}
+
+
+
+
+// Create innerHeight, innerWidth, outerHeight and outerWidth methods
+jQuery.each([ "Height", "Width" ], function( i, name ) {
+
+ var type = name.toLowerCase();
+
+ // innerHeight and innerWidth
+ jQuery.fn["inner" + name] = function() {
+ return this[0] ?
+ parseFloat( jQuery.css( this[0], type, "padding" ) ) :
+ null;
+ };
+
+ // outerHeight and outerWidth
+ jQuery.fn["outer" + name] = function( margin ) {
+ return this[0] ?
+ parseFloat( jQuery.css( this[0], type, margin ? "margin" : "border" ) ) :
+ null;
+ };
+
+ jQuery.fn[ type ] = function( size ) {
+ // Get window width or height
+ var elem = this[0];
+ if ( !elem ) {
+ return size == null ? null : this;
+ }
+
+ if ( jQuery.isFunction( size ) ) {
+ return this.each(function( i ) {
+ var self = jQuery( this );
+ self[ type ]( size.call( this, i, self[ type ]() ) );
+ });
+ }
+
+ if ( jQuery.isWindow( elem ) ) {
+ // Everyone else use document.documentElement or document.body depending on Quirks vs Standards mode
+ return elem.document.compatMode === "CSS1Compat" && elem.document.documentElement[ "client" + name ] ||
+ elem.document.body[ "client" + name ];
+
+ // Get document width or height
+ } else if ( elem.nodeType === 9 ) {
+ // Either scroll[Width/Height] or offset[Width/Height], whichever is greater
+ return Math.max(
+ elem.documentElement["client" + name],
+ elem.body["scroll" + name], elem.documentElement["scroll" + name],
+ elem.body["offset" + name], elem.documentElement["offset" + name]
+ );
+
+ // Get or set width or height on the element
+ } else if ( size === undefined ) {
+ var orig = jQuery.css( elem, type ),
+ ret = parseFloat( orig );
+
+ return jQuery.isNaN( ret ) ? orig : ret;
+
+ // Set the width or height on the element (default to pixels if value is unitless)
+ } else {
+ return this.css( type, typeof size === "string" ? size : size + "px" );
+ }
+ };
+
+});
+
+
+})(window);
--- /dev/null
+/*!
+ * jQuery JavaScript Library v1.4.4
+ * http://jquery.com/
+ *
+ * Copyright 2010, John Resig
+ * Dual licensed under the MIT or GPL Version 2 licenses.
+ * http://jquery.org/license
+ *
+ * Includes Sizzle.js
+ * http://sizzlejs.com/
+ * Copyright 2010, The Dojo Foundation
+ * Released under the MIT, BSD, and GPL Licenses.
+ *
+ * Date: Thu Nov 11 19:04:53 2010 -0500
+ */
+(function(E,B){function ka(a,b,d){if(d===B&&a.nodeType===1){d=a.getAttribute("data-"+b);if(typeof d==="string"){try{d=d==="true"?true:d==="false"?false:d==="null"?null:!c.isNaN(d)?parseFloat(d):Ja.test(d)?c.parseJSON(d):d}catch(e){}c.data(a,b,d)}else d=B}return d}function U(){return false}function ca(){return true}function la(a,b,d){d[0].type=a;return c.event.handle.apply(b,d)}function Ka(a){var b,d,e,f,h,l,k,o,x,r,A,C=[];f=[];h=c.data(this,this.nodeType?"events":"__events__");if(typeof h==="function")h=
+h.events;if(!(a.liveFired===this||!h||!h.live||a.button&&a.type==="click")){if(a.namespace)A=RegExp("(^|\\.)"+a.namespace.split(".").join("\\.(?:.*\\.)?")+"(\\.|$)");a.liveFired=this;var J=h.live.slice(0);for(k=0;k<J.length;k++){h=J[k];h.origType.replace(X,"")===a.type?f.push(h.selector):J.splice(k--,1)}f=c(a.target).closest(f,a.currentTarget);o=0;for(x=f.length;o<x;o++){r=f[o];for(k=0;k<J.length;k++){h=J[k];if(r.selector===h.selector&&(!A||A.test(h.namespace))){l=r.elem;e=null;if(h.preType==="mouseenter"||
+h.preType==="mouseleave"){a.type=h.preType;e=c(a.relatedTarget).closest(h.selector)[0]}if(!e||e!==l)C.push({elem:l,handleObj:h,level:r.level})}}}o=0;for(x=C.length;o<x;o++){f=C[o];if(d&&f.level>d)break;a.currentTarget=f.elem;a.data=f.handleObj.data;a.handleObj=f.handleObj;A=f.handleObj.origHandler.apply(f.elem,arguments);if(A===false||a.isPropagationStopped()){d=f.level;if(A===false)b=false;if(a.isImmediatePropagationStopped())break}}return b}}function Y(a,b){return(a&&a!=="*"?a+".":"")+b.replace(La,
+"`").replace(Ma,"&")}function ma(a,b,d){if(c.isFunction(b))return c.grep(a,function(f,h){return!!b.call(f,h,f)===d});else if(b.nodeType)return c.grep(a,function(f){return f===b===d});else if(typeof b==="string"){var e=c.grep(a,function(f){return f.nodeType===1});if(Na.test(b))return c.filter(b,e,!d);else b=c.filter(b,e)}return c.grep(a,function(f){return c.inArray(f,b)>=0===d})}function na(a,b){var d=0;b.each(function(){if(this.nodeName===(a[d]&&a[d].nodeName)){var e=c.data(a[d++]),f=c.data(this,
+e);if(e=e&&e.events){delete f.handle;f.events={};for(var h in e)for(var l in e[h])c.event.add(this,h,e[h][l],e[h][l].data)}}})}function Oa(a,b){b.src?c.ajax({url:b.src,async:false,dataType:"script"}):c.globalEval(b.text||b.textContent||b.innerHTML||"");b.parentNode&&b.parentNode.removeChild(b)}function oa(a,b,d){var e=b==="width"?a.offsetWidth:a.offsetHeight;if(d==="border")return e;c.each(b==="width"?Pa:Qa,function(){d||(e-=parseFloat(c.css(a,"padding"+this))||0);if(d==="margin")e+=parseFloat(c.css(a,
+"margin"+this))||0;else e-=parseFloat(c.css(a,"border"+this+"Width"))||0});return e}function da(a,b,d,e){if(c.isArray(b)&&b.length)c.each(b,function(f,h){d||Ra.test(a)?e(a,h):da(a+"["+(typeof h==="object"||c.isArray(h)?f:"")+"]",h,d,e)});else if(!d&&b!=null&&typeof b==="object")c.isEmptyObject(b)?e(a,""):c.each(b,function(f,h){da(a+"["+f+"]",h,d,e)});else e(a,b)}function S(a,b){var d={};c.each(pa.concat.apply([],pa.slice(0,b)),function(){d[this]=a});return d}function qa(a){if(!ea[a]){var b=c("<"+
+a+">").appendTo("body"),d=b.css("display");b.remove();if(d==="none"||d==="")d="block";ea[a]=d}return ea[a]}function fa(a){return c.isWindow(a)?a:a.nodeType===9?a.defaultView||a.parentWindow:false}var t=E.document,c=function(){function a(){if(!b.isReady){try{t.documentElement.doScroll("left")}catch(j){setTimeout(a,1);return}b.ready()}}var b=function(j,s){return new b.fn.init(j,s)},d=E.jQuery,e=E.$,f,h=/^(?:[^<]*(<[\w\W]+>)[^>]*$|#([\w\-]+)$)/,l=/\S/,k=/^\s+/,o=/\s+$/,x=/\W/,r=/\d/,A=/^<(\w+)\s*\/?>(?:<\/\1>)?$/,
+C=/^[\],:{}\s]*$/,J=/\\(?:["\\\/bfnrt]|u[0-9a-fA-F]{4})/g,w=/"[^"\\\n\r]*"|true|false|null|-?\d+(?:\.\d*)?(?:[eE][+\-]?\d+)?/g,I=/(?:^|:|,)(?:\s*\[)+/g,L=/(webkit)[ \/]([\w.]+)/,g=/(opera)(?:.*version)?[ \/]([\w.]+)/,i=/(msie) ([\w.]+)/,n=/(mozilla)(?:.*? rv:([\w.]+))?/,m=navigator.userAgent,p=false,q=[],u,y=Object.prototype.toString,F=Object.prototype.hasOwnProperty,M=Array.prototype.push,N=Array.prototype.slice,O=String.prototype.trim,D=Array.prototype.indexOf,R={};b.fn=b.prototype={init:function(j,
+s){var v,z,H;if(!j)return this;if(j.nodeType){this.context=this[0]=j;this.length=1;return this}if(j==="body"&&!s&&t.body){this.context=t;this[0]=t.body;this.selector="body";this.length=1;return this}if(typeof j==="string")if((v=h.exec(j))&&(v[1]||!s))if(v[1]){H=s?s.ownerDocument||s:t;if(z=A.exec(j))if(b.isPlainObject(s)){j=[t.createElement(z[1])];b.fn.attr.call(j,s,true)}else j=[H.createElement(z[1])];else{z=b.buildFragment([v[1]],[H]);j=(z.cacheable?z.fragment.cloneNode(true):z.fragment).childNodes}return b.merge(this,
+j)}else{if((z=t.getElementById(v[2]))&&z.parentNode){if(z.id!==v[2])return f.find(j);this.length=1;this[0]=z}this.context=t;this.selector=j;return this}else if(!s&&!x.test(j)){this.selector=j;this.context=t;j=t.getElementsByTagName(j);return b.merge(this,j)}else return!s||s.jquery?(s||f).find(j):b(s).find(j);else if(b.isFunction(j))return f.ready(j);if(j.selector!==B){this.selector=j.selector;this.context=j.context}return b.makeArray(j,this)},selector:"",jquery:"1.4.4",length:0,size:function(){return this.length},
+toArray:function(){return N.call(this,0)},get:function(j){return j==null?this.toArray():j<0?this.slice(j)[0]:this[j]},pushStack:function(j,s,v){var z=b();b.isArray(j)?M.apply(z,j):b.merge(z,j);z.prevObject=this;z.context=this.context;if(s==="find")z.selector=this.selector+(this.selector?" ":"")+v;else if(s)z.selector=this.selector+"."+s+"("+v+")";return z},each:function(j,s){return b.each(this,j,s)},ready:function(j){b.bindReady();if(b.isReady)j.call(t,b);else q&&q.push(j);return this},eq:function(j){return j===
+-1?this.slice(j):this.slice(j,+j+1)},first:function(){return this.eq(0)},last:function(){return this.eq(-1)},slice:function(){return this.pushStack(N.apply(this,arguments),"slice",N.call(arguments).join(","))},map:function(j){return this.pushStack(b.map(this,function(s,v){return j.call(s,v,s)}))},end:function(){return this.prevObject||b(null)},push:M,sort:[].sort,splice:[].splice};b.fn.init.prototype=b.fn;b.extend=b.fn.extend=function(){var j,s,v,z,H,G=arguments[0]||{},K=1,Q=arguments.length,ga=false;
+if(typeof G==="boolean"){ga=G;G=arguments[1]||{};K=2}if(typeof G!=="object"&&!b.isFunction(G))G={};if(Q===K){G=this;--K}for(;K<Q;K++)if((j=arguments[K])!=null)for(s in j){v=G[s];z=j[s];if(G!==z)if(ga&&z&&(b.isPlainObject(z)||(H=b.isArray(z)))){if(H){H=false;v=v&&b.isArray(v)?v:[]}else v=v&&b.isPlainObject(v)?v:{};G[s]=b.extend(ga,v,z)}else if(z!==B)G[s]=z}return G};b.extend({noConflict:function(j){E.$=e;if(j)E.jQuery=d;return b},isReady:false,readyWait:1,ready:function(j){j===true&&b.readyWait--;
+if(!b.readyWait||j!==true&&!b.isReady){if(!t.body)return setTimeout(b.ready,1);b.isReady=true;if(!(j!==true&&--b.readyWait>0))if(q){var s=0,v=q;for(q=null;j=v[s++];)j.call(t,b);b.fn.trigger&&b(t).trigger("ready").unbind("ready")}}},bindReady:function(){if(!p){p=true;if(t.readyState==="complete")return setTimeout(b.ready,1);if(t.addEventListener){t.addEventListener("DOMContentLoaded",u,false);E.addEventListener("load",b.ready,false)}else if(t.attachEvent){t.attachEvent("onreadystatechange",u);E.attachEvent("onload",
+b.ready);var j=false;try{j=E.frameElement==null}catch(s){}t.documentElement.doScroll&&j&&a()}}},isFunction:function(j){return b.type(j)==="function"},isArray:Array.isArray||function(j){return b.type(j)==="array"},isWindow:function(j){return j&&typeof j==="object"&&"setInterval"in j},isNaN:function(j){return j==null||!r.test(j)||isNaN(j)},type:function(j){return j==null?String(j):R[y.call(j)]||"object"},isPlainObject:function(j){if(!j||b.type(j)!=="object"||j.nodeType||b.isWindow(j))return false;if(j.constructor&&
+!F.call(j,"constructor")&&!F.call(j.constructor.prototype,"isPrototypeOf"))return false;for(var s in j);return s===B||F.call(j,s)},isEmptyObject:function(j){for(var s in j)return false;return true},error:function(j){throw j;},parseJSON:function(j){if(typeof j!=="string"||!j)return null;j=b.trim(j);if(C.test(j.replace(J,"@").replace(w,"]").replace(I,"")))return E.JSON&&E.JSON.parse?E.JSON.parse(j):(new Function("return "+j))();else b.error("Invalid JSON: "+j)},noop:function(){},globalEval:function(j){if(j&&
+l.test(j)){var s=t.getElementsByTagName("head")[0]||t.documentElement,v=t.createElement("script");v.type="text/javascript";if(b.support.scriptEval)v.appendChild(t.createTextNode(j));else v.text=j;s.insertBefore(v,s.firstChild);s.removeChild(v)}},nodeName:function(j,s){return j.nodeName&&j.nodeName.toUpperCase()===s.toUpperCase()},each:function(j,s,v){var z,H=0,G=j.length,K=G===B||b.isFunction(j);if(v)if(K)for(z in j){if(s.apply(j[z],v)===false)break}else for(;H<G;){if(s.apply(j[H++],v)===false)break}else if(K)for(z in j){if(s.call(j[z],
+z,j[z])===false)break}else for(v=j[0];H<G&&s.call(v,H,v)!==false;v=j[++H]);return j},trim:O?function(j){return j==null?"":O.call(j)}:function(j){return j==null?"":j.toString().replace(k,"").replace(o,"")},makeArray:function(j,s){var v=s||[];if(j!=null){var z=b.type(j);j.length==null||z==="string"||z==="function"||z==="regexp"||b.isWindow(j)?M.call(v,j):b.merge(v,j)}return v},inArray:function(j,s){if(s.indexOf)return s.indexOf(j);for(var v=0,z=s.length;v<z;v++)if(s[v]===j)return v;return-1},merge:function(j,
+s){var v=j.length,z=0;if(typeof s.length==="number")for(var H=s.length;z<H;z++)j[v++]=s[z];else for(;s[z]!==B;)j[v++]=s[z++];j.length=v;return j},grep:function(j,s,v){var z=[],H;v=!!v;for(var G=0,K=j.length;G<K;G++){H=!!s(j[G],G);v!==H&&z.push(j[G])}return z},map:function(j,s,v){for(var z=[],H,G=0,K=j.length;G<K;G++){H=s(j[G],G,v);if(H!=null)z[z.length]=H}return z.concat.apply([],z)},guid:1,proxy:function(j,s,v){if(arguments.length===2)if(typeof s==="string"){v=j;j=v[s];s=B}else if(s&&!b.isFunction(s)){v=
+s;s=B}if(!s&&j)s=function(){return j.apply(v||this,arguments)};if(j)s.guid=j.guid=j.guid||s.guid||b.guid++;return s},access:function(j,s,v,z,H,G){var K=j.length;if(typeof s==="object"){for(var Q in s)b.access(j,Q,s[Q],z,H,v);return j}if(v!==B){z=!G&&z&&b.isFunction(v);for(Q=0;Q<K;Q++)H(j[Q],s,z?v.call(j[Q],Q,H(j[Q],s)):v,G);return j}return K?H(j[0],s):B},now:function(){return(new Date).getTime()},uaMatch:function(j){j=j.toLowerCase();j=L.exec(j)||g.exec(j)||i.exec(j)||j.indexOf("compatible")<0&&n.exec(j)||
+[];return{browser:j[1]||"",version:j[2]||"0"}},browser:{}});b.each("Boolean Number String Function Array Date RegExp Object".split(" "),function(j,s){R["[object "+s+"]"]=s.toLowerCase()});m=b.uaMatch(m);if(m.browser){b.browser[m.browser]=true;b.browser.version=m.version}if(b.browser.webkit)b.browser.safari=true;if(D)b.inArray=function(j,s){return D.call(s,j)};if(!/\s/.test("\u00a0")){k=/^[\s\xA0]+/;o=/[\s\xA0]+$/}f=b(t);if(t.addEventListener)u=function(){t.removeEventListener("DOMContentLoaded",u,
+false);b.ready()};else if(t.attachEvent)u=function(){if(t.readyState==="complete"){t.detachEvent("onreadystatechange",u);b.ready()}};return E.jQuery=E.$=b}();(function(){c.support={};var a=t.documentElement,b=t.createElement("script"),d=t.createElement("div"),e="script"+c.now();d.style.display="none";d.innerHTML=" <link/><table></table><a href='/a' style='color:red;float:left;opacity:.55;'>a</a><input type='checkbox'/>";var f=d.getElementsByTagName("*"),h=d.getElementsByTagName("a")[0],l=t.createElement("select"),
+k=l.appendChild(t.createElement("option"));if(!(!f||!f.length||!h)){c.support={leadingWhitespace:d.firstChild.nodeType===3,tbody:!d.getElementsByTagName("tbody").length,htmlSerialize:!!d.getElementsByTagName("link").length,style:/red/.test(h.getAttribute("style")),hrefNormalized:h.getAttribute("href")==="/a",opacity:/^0.55$/.test(h.style.opacity),cssFloat:!!h.style.cssFloat,checkOn:d.getElementsByTagName("input")[0].value==="on",optSelected:k.selected,deleteExpando:true,optDisabled:false,checkClone:false,
+scriptEval:false,noCloneEvent:true,boxModel:null,inlineBlockNeedsLayout:false,shrinkWrapBlocks:false,reliableHiddenOffsets:true};l.disabled=true;c.support.optDisabled=!k.disabled;b.type="text/javascript";try{b.appendChild(t.createTextNode("window."+e+"=1;"))}catch(o){}a.insertBefore(b,a.firstChild);if(E[e]){c.support.scriptEval=true;delete E[e]}try{delete b.test}catch(x){c.support.deleteExpando=false}a.removeChild(b);if(d.attachEvent&&d.fireEvent){d.attachEvent("onclick",function r(){c.support.noCloneEvent=
+false;d.detachEvent("onclick",r)});d.cloneNode(true).fireEvent("onclick")}d=t.createElement("div");d.innerHTML="<input type='radio' name='radiotest' checked='checked'/>";a=t.createDocumentFragment();a.appendChild(d.firstChild);c.support.checkClone=a.cloneNode(true).cloneNode(true).lastChild.checked;c(function(){var r=t.createElement("div");r.style.width=r.style.paddingLeft="1px";t.body.appendChild(r);c.boxModel=c.support.boxModel=r.offsetWidth===2;if("zoom"in r.style){r.style.display="inline";r.style.zoom=
+1;c.support.inlineBlockNeedsLayout=r.offsetWidth===2;r.style.display="";r.innerHTML="<div style='width:4px;'></div>";c.support.shrinkWrapBlocks=r.offsetWidth!==2}r.innerHTML="<table><tr><td style='padding:0;display:none'></td><td>t</td></tr></table>";var A=r.getElementsByTagName("td");c.support.reliableHiddenOffsets=A[0].offsetHeight===0;A[0].style.display="";A[1].style.display="none";c.support.reliableHiddenOffsets=c.support.reliableHiddenOffsets&&A[0].offsetHeight===0;r.innerHTML="";t.body.removeChild(r).style.display=
+"none"});a=function(r){var A=t.createElement("div");r="on"+r;var C=r in A;if(!C){A.setAttribute(r,"return;");C=typeof A[r]==="function"}return C};c.support.submitBubbles=a("submit");c.support.changeBubbles=a("change");a=b=d=f=h=null}})();var ra={},Ja=/^(?:\{.*\}|\[.*\])$/;c.extend({cache:{},uuid:0,expando:"jQuery"+c.now(),noData:{embed:true,object:"clsid:D27CDB6E-AE6D-11cf-96B8-444553540000",applet:true},data:function(a,b,d){if(c.acceptData(a)){a=a==E?ra:a;var e=a.nodeType,f=e?a[c.expando]:null,h=
+c.cache;if(!(e&&!f&&typeof b==="string"&&d===B)){if(e)f||(a[c.expando]=f=++c.uuid);else h=a;if(typeof b==="object")if(e)h[f]=c.extend(h[f],b);else c.extend(h,b);else if(e&&!h[f])h[f]={};a=e?h[f]:h;if(d!==B)a[b]=d;return typeof b==="string"?a[b]:a}}},removeData:function(a,b){if(c.acceptData(a)){a=a==E?ra:a;var d=a.nodeType,e=d?a[c.expando]:a,f=c.cache,h=d?f[e]:e;if(b){if(h){delete h[b];d&&c.isEmptyObject(h)&&c.removeData(a)}}else if(d&&c.support.deleteExpando)delete a[c.expando];else if(a.removeAttribute)a.removeAttribute(c.expando);
+else if(d)delete f[e];else for(var l in a)delete a[l]}},acceptData:function(a){if(a.nodeName){var b=c.noData[a.nodeName.toLowerCase()];if(b)return!(b===true||a.getAttribute("classid")!==b)}return true}});c.fn.extend({data:function(a,b){var d=null;if(typeof a==="undefined"){if(this.length){var e=this[0].attributes,f;d=c.data(this[0]);for(var h=0,l=e.length;h<l;h++){f=e[h].name;if(f.indexOf("data-")===0){f=f.substr(5);ka(this[0],f,d[f])}}}return d}else if(typeof a==="object")return this.each(function(){c.data(this,
+a)});var k=a.split(".");k[1]=k[1]?"."+k[1]:"";if(b===B){d=this.triggerHandler("getData"+k[1]+"!",[k[0]]);if(d===B&&this.length){d=c.data(this[0],a);d=ka(this[0],a,d)}return d===B&&k[1]?this.data(k[0]):d}else return this.each(function(){var o=c(this),x=[k[0],b];o.triggerHandler("setData"+k[1]+"!",x);c.data(this,a,b);o.triggerHandler("changeData"+k[1]+"!",x)})},removeData:function(a){return this.each(function(){c.removeData(this,a)})}});c.extend({queue:function(a,b,d){if(a){b=(b||"fx")+"queue";var e=
+c.data(a,b);if(!d)return e||[];if(!e||c.isArray(d))e=c.data(a,b,c.makeArray(d));else e.push(d);return e}},dequeue:function(a,b){b=b||"fx";var d=c.queue(a,b),e=d.shift();if(e==="inprogress")e=d.shift();if(e){b==="fx"&&d.unshift("inprogress");e.call(a,function(){c.dequeue(a,b)})}}});c.fn.extend({queue:function(a,b){if(typeof a!=="string"){b=a;a="fx"}if(b===B)return c.queue(this[0],a);return this.each(function(){var d=c.queue(this,a,b);a==="fx"&&d[0]!=="inprogress"&&c.dequeue(this,a)})},dequeue:function(a){return this.each(function(){c.dequeue(this,
+a)})},delay:function(a,b){a=c.fx?c.fx.speeds[a]||a:a;b=b||"fx";return this.queue(b,function(){var d=this;setTimeout(function(){c.dequeue(d,b)},a)})},clearQueue:function(a){return this.queue(a||"fx",[])}});var sa=/[\n\t]/g,ha=/\s+/,Sa=/\r/g,Ta=/^(?:href|src|style)$/,Ua=/^(?:button|input)$/i,Va=/^(?:button|input|object|select|textarea)$/i,Wa=/^a(?:rea)?$/i,ta=/^(?:radio|checkbox)$/i;c.props={"for":"htmlFor","class":"className",readonly:"readOnly",maxlength:"maxLength",cellspacing:"cellSpacing",rowspan:"rowSpan",
+colspan:"colSpan",tabindex:"tabIndex",usemap:"useMap",frameborder:"frameBorder"};c.fn.extend({attr:function(a,b){return c.access(this,a,b,true,c.attr)},removeAttr:function(a){return this.each(function(){c.attr(this,a,"");this.nodeType===1&&this.removeAttribute(a)})},addClass:function(a){if(c.isFunction(a))return this.each(function(x){var r=c(this);r.addClass(a.call(this,x,r.attr("class")))});if(a&&typeof a==="string")for(var b=(a||"").split(ha),d=0,e=this.length;d<e;d++){var f=this[d];if(f.nodeType===
+1)if(f.className){for(var h=" "+f.className+" ",l=f.className,k=0,o=b.length;k<o;k++)if(h.indexOf(" "+b[k]+" ")<0)l+=" "+b[k];f.className=c.trim(l)}else f.className=a}return this},removeClass:function(a){if(c.isFunction(a))return this.each(function(o){var x=c(this);x.removeClass(a.call(this,o,x.attr("class")))});if(a&&typeof a==="string"||a===B)for(var b=(a||"").split(ha),d=0,e=this.length;d<e;d++){var f=this[d];if(f.nodeType===1&&f.className)if(a){for(var h=(" "+f.className+" ").replace(sa," "),
+l=0,k=b.length;l<k;l++)h=h.replace(" "+b[l]+" "," ");f.className=c.trim(h)}else f.className=""}return this},toggleClass:function(a,b){var d=typeof a,e=typeof b==="boolean";if(c.isFunction(a))return this.each(function(f){var h=c(this);h.toggleClass(a.call(this,f,h.attr("class"),b),b)});return this.each(function(){if(d==="string")for(var f,h=0,l=c(this),k=b,o=a.split(ha);f=o[h++];){k=e?k:!l.hasClass(f);l[k?"addClass":"removeClass"](f)}else if(d==="undefined"||d==="boolean"){this.className&&c.data(this,
+"__className__",this.className);this.className=this.className||a===false?"":c.data(this,"__className__")||""}})},hasClass:function(a){a=" "+a+" ";for(var b=0,d=this.length;b<d;b++)if((" "+this[b].className+" ").replace(sa," ").indexOf(a)>-1)return true;return false},val:function(a){if(!arguments.length){var b=this[0];if(b){if(c.nodeName(b,"option")){var d=b.attributes.value;return!d||d.specified?b.value:b.text}if(c.nodeName(b,"select")){var e=b.selectedIndex;d=[];var f=b.options;b=b.type==="select-one";
+if(e<0)return null;var h=b?e:0;for(e=b?e+1:f.length;h<e;h++){var l=f[h];if(l.selected&&(c.support.optDisabled?!l.disabled:l.getAttribute("disabled")===null)&&(!l.parentNode.disabled||!c.nodeName(l.parentNode,"optgroup"))){a=c(l).val();if(b)return a;d.push(a)}}return d}if(ta.test(b.type)&&!c.support.checkOn)return b.getAttribute("value")===null?"on":b.value;return(b.value||"").replace(Sa,"")}return B}var k=c.isFunction(a);return this.each(function(o){var x=c(this),r=a;if(this.nodeType===1){if(k)r=
+a.call(this,o,x.val());if(r==null)r="";else if(typeof r==="number")r+="";else if(c.isArray(r))r=c.map(r,function(C){return C==null?"":C+""});if(c.isArray(r)&&ta.test(this.type))this.checked=c.inArray(x.val(),r)>=0;else if(c.nodeName(this,"select")){var A=c.makeArray(r);c("option",this).each(function(){this.selected=c.inArray(c(this).val(),A)>=0});if(!A.length)this.selectedIndex=-1}else this.value=r}})}});c.extend({attrFn:{val:true,css:true,html:true,text:true,data:true,width:true,height:true,offset:true},
+attr:function(a,b,d,e){if(!a||a.nodeType===3||a.nodeType===8)return B;if(e&&b in c.attrFn)return c(a)[b](d);e=a.nodeType!==1||!c.isXMLDoc(a);var f=d!==B;b=e&&c.props[b]||b;var h=Ta.test(b);if((b in a||a[b]!==B)&&e&&!h){if(f){b==="type"&&Ua.test(a.nodeName)&&a.parentNode&&c.error("type property can't be changed");if(d===null)a.nodeType===1&&a.removeAttribute(b);else a[b]=d}if(c.nodeName(a,"form")&&a.getAttributeNode(b))return a.getAttributeNode(b).nodeValue;if(b==="tabIndex")return(b=a.getAttributeNode("tabIndex"))&&
+b.specified?b.value:Va.test(a.nodeName)||Wa.test(a.nodeName)&&a.href?0:B;return a[b]}if(!c.support.style&&e&&b==="style"){if(f)a.style.cssText=""+d;return a.style.cssText}f&&a.setAttribute(b,""+d);if(!a.attributes[b]&&a.hasAttribute&&!a.hasAttribute(b))return B;a=!c.support.hrefNormalized&&e&&h?a.getAttribute(b,2):a.getAttribute(b);return a===null?B:a}});var X=/\.(.*)$/,ia=/^(?:textarea|input|select)$/i,La=/\./g,Ma=/ /g,Xa=/[^\w\s.|`]/g,Ya=function(a){return a.replace(Xa,"\\$&")},ua={focusin:0,focusout:0};
+c.event={add:function(a,b,d,e){if(!(a.nodeType===3||a.nodeType===8)){if(c.isWindow(a)&&a!==E&&!a.frameElement)a=E;if(d===false)d=U;else if(!d)return;var f,h;if(d.handler){f=d;d=f.handler}if(!d.guid)d.guid=c.guid++;if(h=c.data(a)){var l=a.nodeType?"events":"__events__",k=h[l],o=h.handle;if(typeof k==="function"){o=k.handle;k=k.events}else if(!k){a.nodeType||(h[l]=h=function(){});h.events=k={}}if(!o)h.handle=o=function(){return typeof c!=="undefined"&&!c.event.triggered?c.event.handle.apply(o.elem,
+arguments):B};o.elem=a;b=b.split(" ");for(var x=0,r;l=b[x++];){h=f?c.extend({},f):{handler:d,data:e};if(l.indexOf(".")>-1){r=l.split(".");l=r.shift();h.namespace=r.slice(0).sort().join(".")}else{r=[];h.namespace=""}h.type=l;if(!h.guid)h.guid=d.guid;var A=k[l],C=c.event.special[l]||{};if(!A){A=k[l]=[];if(!C.setup||C.setup.call(a,e,r,o)===false)if(a.addEventListener)a.addEventListener(l,o,false);else a.attachEvent&&a.attachEvent("on"+l,o)}if(C.add){C.add.call(a,h);if(!h.handler.guid)h.handler.guid=
+d.guid}A.push(h);c.event.global[l]=true}a=null}}},global:{},remove:function(a,b,d,e){if(!(a.nodeType===3||a.nodeType===8)){if(d===false)d=U;var f,h,l=0,k,o,x,r,A,C,J=a.nodeType?"events":"__events__",w=c.data(a),I=w&&w[J];if(w&&I){if(typeof I==="function"){w=I;I=I.events}if(b&&b.type){d=b.handler;b=b.type}if(!b||typeof b==="string"&&b.charAt(0)==="."){b=b||"";for(f in I)c.event.remove(a,f+b)}else{for(b=b.split(" ");f=b[l++];){r=f;k=f.indexOf(".")<0;o=[];if(!k){o=f.split(".");f=o.shift();x=RegExp("(^|\\.)"+
+c.map(o.slice(0).sort(),Ya).join("\\.(?:.*\\.)?")+"(\\.|$)")}if(A=I[f])if(d){r=c.event.special[f]||{};for(h=e||0;h<A.length;h++){C=A[h];if(d.guid===C.guid){if(k||x.test(C.namespace)){e==null&&A.splice(h--,1);r.remove&&r.remove.call(a,C)}if(e!=null)break}}if(A.length===0||e!=null&&A.length===1){if(!r.teardown||r.teardown.call(a,o)===false)c.removeEvent(a,f,w.handle);delete I[f]}}else for(h=0;h<A.length;h++){C=A[h];if(k||x.test(C.namespace)){c.event.remove(a,r,C.handler,h);A.splice(h--,1)}}}if(c.isEmptyObject(I)){if(b=
+w.handle)b.elem=null;delete w.events;delete w.handle;if(typeof w==="function")c.removeData(a,J);else c.isEmptyObject(w)&&c.removeData(a)}}}}},trigger:function(a,b,d,e){var f=a.type||a;if(!e){a=typeof a==="object"?a[c.expando]?a:c.extend(c.Event(f),a):c.Event(f);if(f.indexOf("!")>=0){a.type=f=f.slice(0,-1);a.exclusive=true}if(!d){a.stopPropagation();c.event.global[f]&&c.each(c.cache,function(){this.events&&this.events[f]&&c.event.trigger(a,b,this.handle.elem)})}if(!d||d.nodeType===3||d.nodeType===
+8)return B;a.result=B;a.target=d;b=c.makeArray(b);b.unshift(a)}a.currentTarget=d;(e=d.nodeType?c.data(d,"handle"):(c.data(d,"__events__")||{}).handle)&&e.apply(d,b);e=d.parentNode||d.ownerDocument;try{if(!(d&&d.nodeName&&c.noData[d.nodeName.toLowerCase()]))if(d["on"+f]&&d["on"+f].apply(d,b)===false){a.result=false;a.preventDefault()}}catch(h){}if(!a.isPropagationStopped()&&e)c.event.trigger(a,b,e,true);else if(!a.isDefaultPrevented()){var l;e=a.target;var k=f.replace(X,""),o=c.nodeName(e,"a")&&k===
+"click",x=c.event.special[k]||{};if((!x._default||x._default.call(d,a)===false)&&!o&&!(e&&e.nodeName&&c.noData[e.nodeName.toLowerCase()])){try{if(e[k]){if(l=e["on"+k])e["on"+k]=null;c.event.triggered=true;e[k]()}}catch(r){}if(l)e["on"+k]=l;c.event.triggered=false}}},handle:function(a){var b,d,e,f;d=[];var h=c.makeArray(arguments);a=h[0]=c.event.fix(a||E.event);a.currentTarget=this;b=a.type.indexOf(".")<0&&!a.exclusive;if(!b){e=a.type.split(".");a.type=e.shift();d=e.slice(0).sort();e=RegExp("(^|\\.)"+
+d.join("\\.(?:.*\\.)?")+"(\\.|$)")}a.namespace=a.namespace||d.join(".");f=c.data(this,this.nodeType?"events":"__events__");if(typeof f==="function")f=f.events;d=(f||{})[a.type];if(f&&d){d=d.slice(0);f=0;for(var l=d.length;f<l;f++){var k=d[f];if(b||e.test(k.namespace)){a.handler=k.handler;a.data=k.data;a.handleObj=k;k=k.handler.apply(this,h);if(k!==B){a.result=k;if(k===false){a.preventDefault();a.stopPropagation()}}if(a.isImmediatePropagationStopped())break}}}return a.result},props:"altKey attrChange attrName bubbles button cancelable charCode clientX clientY ctrlKey currentTarget data detail eventPhase fromElement handler keyCode layerX layerY metaKey newValue offsetX offsetY pageX pageY prevValue relatedNode relatedTarget screenX screenY shiftKey srcElement target toElement view wheelDelta which".split(" "),
+fix:function(a){if(a[c.expando])return a;var b=a;a=c.Event(b);for(var d=this.props.length,e;d;){e=this.props[--d];a[e]=b[e]}if(!a.target)a.target=a.srcElement||t;if(a.target.nodeType===3)a.target=a.target.parentNode;if(!a.relatedTarget&&a.fromElement)a.relatedTarget=a.fromElement===a.target?a.toElement:a.fromElement;if(a.pageX==null&&a.clientX!=null){b=t.documentElement;d=t.body;a.pageX=a.clientX+(b&&b.scrollLeft||d&&d.scrollLeft||0)-(b&&b.clientLeft||d&&d.clientLeft||0);a.pageY=a.clientY+(b&&b.scrollTop||
+d&&d.scrollTop||0)-(b&&b.clientTop||d&&d.clientTop||0)}if(a.which==null&&(a.charCode!=null||a.keyCode!=null))a.which=a.charCode!=null?a.charCode:a.keyCode;if(!a.metaKey&&a.ctrlKey)a.metaKey=a.ctrlKey;if(!a.which&&a.button!==B)a.which=a.button&1?1:a.button&2?3:a.button&4?2:0;return a},guid:1E8,proxy:c.proxy,special:{ready:{setup:c.bindReady,teardown:c.noop},live:{add:function(a){c.event.add(this,Y(a.origType,a.selector),c.extend({},a,{handler:Ka,guid:a.handler.guid}))},remove:function(a){c.event.remove(this,
+Y(a.origType,a.selector),a)}},beforeunload:{setup:function(a,b,d){if(c.isWindow(this))this.onbeforeunload=d},teardown:function(a,b){if(this.onbeforeunload===b)this.onbeforeunload=null}}}};c.removeEvent=t.removeEventListener?function(a,b,d){a.removeEventListener&&a.removeEventListener(b,d,false)}:function(a,b,d){a.detachEvent&&a.detachEvent("on"+b,d)};c.Event=function(a){if(!this.preventDefault)return new c.Event(a);if(a&&a.type){this.originalEvent=a;this.type=a.type}else this.type=a;this.timeStamp=
+c.now();this[c.expando]=true};c.Event.prototype={preventDefault:function(){this.isDefaultPrevented=ca;var a=this.originalEvent;if(a)if(a.preventDefault)a.preventDefault();else a.returnValue=false},stopPropagation:function(){this.isPropagationStopped=ca;var a=this.originalEvent;if(a){a.stopPropagation&&a.stopPropagation();a.cancelBubble=true}},stopImmediatePropagation:function(){this.isImmediatePropagationStopped=ca;this.stopPropagation()},isDefaultPrevented:U,isPropagationStopped:U,isImmediatePropagationStopped:U};
+var va=function(a){var b=a.relatedTarget;try{for(;b&&b!==this;)b=b.parentNode;if(b!==this){a.type=a.data;c.event.handle.apply(this,arguments)}}catch(d){}},wa=function(a){a.type=a.data;c.event.handle.apply(this,arguments)};c.each({mouseenter:"mouseover",mouseleave:"mouseout"},function(a,b){c.event.special[a]={setup:function(d){c.event.add(this,b,d&&d.selector?wa:va,a)},teardown:function(d){c.event.remove(this,b,d&&d.selector?wa:va)}}});if(!c.support.submitBubbles)c.event.special.submit={setup:function(){if(this.nodeName.toLowerCase()!==
+"form"){c.event.add(this,"click.specialSubmit",function(a){var b=a.target,d=b.type;if((d==="submit"||d==="image")&&c(b).closest("form").length){a.liveFired=B;return la("submit",this,arguments)}});c.event.add(this,"keypress.specialSubmit",function(a){var b=a.target,d=b.type;if((d==="text"||d==="password")&&c(b).closest("form").length&&a.keyCode===13){a.liveFired=B;return la("submit",this,arguments)}})}else return false},teardown:function(){c.event.remove(this,".specialSubmit")}};if(!c.support.changeBubbles){var V,
+xa=function(a){var b=a.type,d=a.value;if(b==="radio"||b==="checkbox")d=a.checked;else if(b==="select-multiple")d=a.selectedIndex>-1?c.map(a.options,function(e){return e.selected}).join("-"):"";else if(a.nodeName.toLowerCase()==="select")d=a.selectedIndex;return d},Z=function(a,b){var d=a.target,e,f;if(!(!ia.test(d.nodeName)||d.readOnly)){e=c.data(d,"_change_data");f=xa(d);if(a.type!=="focusout"||d.type!=="radio")c.data(d,"_change_data",f);if(!(e===B||f===e))if(e!=null||f){a.type="change";a.liveFired=
+B;return c.event.trigger(a,b,d)}}};c.event.special.change={filters:{focusout:Z,beforedeactivate:Z,click:function(a){var b=a.target,d=b.type;if(d==="radio"||d==="checkbox"||b.nodeName.toLowerCase()==="select")return Z.call(this,a)},keydown:function(a){var b=a.target,d=b.type;if(a.keyCode===13&&b.nodeName.toLowerCase()!=="textarea"||a.keyCode===32&&(d==="checkbox"||d==="radio")||d==="select-multiple")return Z.call(this,a)},beforeactivate:function(a){a=a.target;c.data(a,"_change_data",xa(a))}},setup:function(){if(this.type===
+"file")return false;for(var a in V)c.event.add(this,a+".specialChange",V[a]);return ia.test(this.nodeName)},teardown:function(){c.event.remove(this,".specialChange");return ia.test(this.nodeName)}};V=c.event.special.change.filters;V.focus=V.beforeactivate}t.addEventListener&&c.each({focus:"focusin",blur:"focusout"},function(a,b){function d(e){e=c.event.fix(e);e.type=b;return c.event.trigger(e,null,e.target)}c.event.special[b]={setup:function(){ua[b]++===0&&t.addEventListener(a,d,true)},teardown:function(){--ua[b]===
+0&&t.removeEventListener(a,d,true)}}});c.each(["bind","one"],function(a,b){c.fn[b]=function(d,e,f){if(typeof d==="object"){for(var h in d)this[b](h,e,d[h],f);return this}if(c.isFunction(e)||e===false){f=e;e=B}var l=b==="one"?c.proxy(f,function(o){c(this).unbind(o,l);return f.apply(this,arguments)}):f;if(d==="unload"&&b!=="one")this.one(d,e,f);else{h=0;for(var k=this.length;h<k;h++)c.event.add(this[h],d,l,e)}return this}});c.fn.extend({unbind:function(a,b){if(typeof a==="object"&&!a.preventDefault)for(var d in a)this.unbind(d,
+a[d]);else{d=0;for(var e=this.length;d<e;d++)c.event.remove(this[d],a,b)}return this},delegate:function(a,b,d,e){return this.live(b,d,e,a)},undelegate:function(a,b,d){return arguments.length===0?this.unbind("live"):this.die(b,null,d,a)},trigger:function(a,b){return this.each(function(){c.event.trigger(a,b,this)})},triggerHandler:function(a,b){if(this[0]){var d=c.Event(a);d.preventDefault();d.stopPropagation();c.event.trigger(d,b,this[0]);return d.result}},toggle:function(a){for(var b=arguments,d=
+1;d<b.length;)c.proxy(a,b[d++]);return this.click(c.proxy(a,function(e){var f=(c.data(this,"lastToggle"+a.guid)||0)%d;c.data(this,"lastToggle"+a.guid,f+1);e.preventDefault();return b[f].apply(this,arguments)||false}))},hover:function(a,b){return this.mouseenter(a).mouseleave(b||a)}});var ya={focus:"focusin",blur:"focusout",mouseenter:"mouseover",mouseleave:"mouseout"};c.each(["live","die"],function(a,b){c.fn[b]=function(d,e,f,h){var l,k=0,o,x,r=h||this.selector;h=h?this:c(this.context);if(typeof d===
+"object"&&!d.preventDefault){for(l in d)h[b](l,e,d[l],r);return this}if(c.isFunction(e)){f=e;e=B}for(d=(d||"").split(" ");(l=d[k++])!=null;){o=X.exec(l);x="";if(o){x=o[0];l=l.replace(X,"")}if(l==="hover")d.push("mouseenter"+x,"mouseleave"+x);else{o=l;if(l==="focus"||l==="blur"){d.push(ya[l]+x);l+=x}else l=(ya[l]||l)+x;if(b==="live"){x=0;for(var A=h.length;x<A;x++)c.event.add(h[x],"live."+Y(l,r),{data:e,selector:r,handler:f,origType:l,origHandler:f,preType:o})}else h.unbind("live."+Y(l,r),f)}}return this}});
+c.each("blur focus focusin focusout load resize scroll unload click dblclick mousedown mouseup mousemove mouseover mouseout mouseenter mouseleave change select submit keydown keypress keyup error".split(" "),function(a,b){c.fn[b]=function(d,e){if(e==null){e=d;d=null}return arguments.length>0?this.bind(b,d,e):this.trigger(b)};if(c.attrFn)c.attrFn[b]=true});E.attachEvent&&!E.addEventListener&&c(E).bind("unload",function(){for(var a in c.cache)if(c.cache[a].handle)try{c.event.remove(c.cache[a].handle.elem)}catch(b){}});
+(function(){function a(g,i,n,m,p,q){p=0;for(var u=m.length;p<u;p++){var y=m[p];if(y){var F=false;for(y=y[g];y;){if(y.sizcache===n){F=m[y.sizset];break}if(y.nodeType===1&&!q){y.sizcache=n;y.sizset=p}if(y.nodeName.toLowerCase()===i){F=y;break}y=y[g]}m[p]=F}}}function b(g,i,n,m,p,q){p=0;for(var u=m.length;p<u;p++){var y=m[p];if(y){var F=false;for(y=y[g];y;){if(y.sizcache===n){F=m[y.sizset];break}if(y.nodeType===1){if(!q){y.sizcache=n;y.sizset=p}if(typeof i!=="string"){if(y===i){F=true;break}}else if(k.filter(i,
+[y]).length>0){F=y;break}}y=y[g]}m[p]=F}}}var d=/((?:\((?:\([^()]+\)|[^()]+)+\)|\[(?:\[[^\[\]]*\]|['"][^'"]*['"]|[^\[\]'"]+)+\]|\\.|[^ >+~,(\[\\]+)+|[>+~])(\s*,\s*)?((?:.|\r|\n)*)/g,e=0,f=Object.prototype.toString,h=false,l=true;[0,0].sort(function(){l=false;return 0});var k=function(g,i,n,m){n=n||[];var p=i=i||t;if(i.nodeType!==1&&i.nodeType!==9)return[];if(!g||typeof g!=="string")return n;var q,u,y,F,M,N=true,O=k.isXML(i),D=[],R=g;do{d.exec("");if(q=d.exec(R)){R=q[3];D.push(q[1]);if(q[2]){F=q[3];
+break}}}while(q);if(D.length>1&&x.exec(g))if(D.length===2&&o.relative[D[0]])u=L(D[0]+D[1],i);else for(u=o.relative[D[0]]?[i]:k(D.shift(),i);D.length;){g=D.shift();if(o.relative[g])g+=D.shift();u=L(g,u)}else{if(!m&&D.length>1&&i.nodeType===9&&!O&&o.match.ID.test(D[0])&&!o.match.ID.test(D[D.length-1])){q=k.find(D.shift(),i,O);i=q.expr?k.filter(q.expr,q.set)[0]:q.set[0]}if(i){q=m?{expr:D.pop(),set:C(m)}:k.find(D.pop(),D.length===1&&(D[0]==="~"||D[0]==="+")&&i.parentNode?i.parentNode:i,O);u=q.expr?k.filter(q.expr,
+q.set):q.set;if(D.length>0)y=C(u);else N=false;for(;D.length;){q=M=D.pop();if(o.relative[M])q=D.pop();else M="";if(q==null)q=i;o.relative[M](y,q,O)}}else y=[]}y||(y=u);y||k.error(M||g);if(f.call(y)==="[object Array]")if(N)if(i&&i.nodeType===1)for(g=0;y[g]!=null;g++){if(y[g]&&(y[g]===true||y[g].nodeType===1&&k.contains(i,y[g])))n.push(u[g])}else for(g=0;y[g]!=null;g++)y[g]&&y[g].nodeType===1&&n.push(u[g]);else n.push.apply(n,y);else C(y,n);if(F){k(F,p,n,m);k.uniqueSort(n)}return n};k.uniqueSort=function(g){if(w){h=
+l;g.sort(w);if(h)for(var i=1;i<g.length;i++)g[i]===g[i-1]&&g.splice(i--,1)}return g};k.matches=function(g,i){return k(g,null,null,i)};k.matchesSelector=function(g,i){return k(i,null,null,[g]).length>0};k.find=function(g,i,n){var m;if(!g)return[];for(var p=0,q=o.order.length;p<q;p++){var u,y=o.order[p];if(u=o.leftMatch[y].exec(g)){var F=u[1];u.splice(1,1);if(F.substr(F.length-1)!=="\\"){u[1]=(u[1]||"").replace(/\\/g,"");m=o.find[y](u,i,n);if(m!=null){g=g.replace(o.match[y],"");break}}}}m||(m=i.getElementsByTagName("*"));
+return{set:m,expr:g}};k.filter=function(g,i,n,m){for(var p,q,u=g,y=[],F=i,M=i&&i[0]&&k.isXML(i[0]);g&&i.length;){for(var N in o.filter)if((p=o.leftMatch[N].exec(g))!=null&&p[2]){var O,D,R=o.filter[N];D=p[1];q=false;p.splice(1,1);if(D.substr(D.length-1)!=="\\"){if(F===y)y=[];if(o.preFilter[N])if(p=o.preFilter[N](p,F,n,y,m,M)){if(p===true)continue}else q=O=true;if(p)for(var j=0;(D=F[j])!=null;j++)if(D){O=R(D,p,j,F);var s=m^!!O;if(n&&O!=null)if(s)q=true;else F[j]=false;else if(s){y.push(D);q=true}}if(O!==
+B){n||(F=y);g=g.replace(o.match[N],"");if(!q)return[];break}}}if(g===u)if(q==null)k.error(g);else break;u=g}return F};k.error=function(g){throw"Syntax error, unrecognized expression: "+g;};var o=k.selectors={order:["ID","NAME","TAG"],match:{ID:/#((?:[\w\u00c0-\uFFFF\-]|\\.)+)/,CLASS:/\.((?:[\w\u00c0-\uFFFF\-]|\\.)+)/,NAME:/\[name=['"]*((?:[\w\u00c0-\uFFFF\-]|\\.)+)['"]*\]/,ATTR:/\[\s*((?:[\w\u00c0-\uFFFF\-]|\\.)+)\s*(?:(\S?=)\s*(['"]*)(.*?)\3|)\s*\]/,TAG:/^((?:[\w\u00c0-\uFFFF\*\-]|\\.)+)/,CHILD:/:(only|nth|last|first)-child(?:\((even|odd|[\dn+\-]*)\))?/,
+POS:/:(nth|eq|gt|lt|first|last|even|odd)(?:\((\d*)\))?(?=[^\-]|$)/,PSEUDO:/:((?:[\w\u00c0-\uFFFF\-]|\\.)+)(?:\((['"]?)((?:\([^\)]+\)|[^\(\)]*)+)\2\))?/},leftMatch:{},attrMap:{"class":"className","for":"htmlFor"},attrHandle:{href:function(g){return g.getAttribute("href")}},relative:{"+":function(g,i){var n=typeof i==="string",m=n&&!/\W/.test(i);n=n&&!m;if(m)i=i.toLowerCase();m=0;for(var p=g.length,q;m<p;m++)if(q=g[m]){for(;(q=q.previousSibling)&&q.nodeType!==1;);g[m]=n||q&&q.nodeName.toLowerCase()===
+i?q||false:q===i}n&&k.filter(i,g,true)},">":function(g,i){var n,m=typeof i==="string",p=0,q=g.length;if(m&&!/\W/.test(i))for(i=i.toLowerCase();p<q;p++){if(n=g[p]){n=n.parentNode;g[p]=n.nodeName.toLowerCase()===i?n:false}}else{for(;p<q;p++)if(n=g[p])g[p]=m?n.parentNode:n.parentNode===i;m&&k.filter(i,g,true)}},"":function(g,i,n){var m,p=e++,q=b;if(typeof i==="string"&&!/\W/.test(i)){m=i=i.toLowerCase();q=a}q("parentNode",i,p,g,m,n)},"~":function(g,i,n){var m,p=e++,q=b;if(typeof i==="string"&&!/\W/.test(i)){m=
+i=i.toLowerCase();q=a}q("previousSibling",i,p,g,m,n)}},find:{ID:function(g,i,n){if(typeof i.getElementById!=="undefined"&&!n)return(g=i.getElementById(g[1]))&&g.parentNode?[g]:[]},NAME:function(g,i){if(typeof i.getElementsByName!=="undefined"){for(var n=[],m=i.getElementsByName(g[1]),p=0,q=m.length;p<q;p++)m[p].getAttribute("name")===g[1]&&n.push(m[p]);return n.length===0?null:n}},TAG:function(g,i){return i.getElementsByTagName(g[1])}},preFilter:{CLASS:function(g,i,n,m,p,q){g=" "+g[1].replace(/\\/g,
+"")+" ";if(q)return g;q=0;for(var u;(u=i[q])!=null;q++)if(u)if(p^(u.className&&(" "+u.className+" ").replace(/[\t\n]/g," ").indexOf(g)>=0))n||m.push(u);else if(n)i[q]=false;return false},ID:function(g){return g[1].replace(/\\/g,"")},TAG:function(g){return g[1].toLowerCase()},CHILD:function(g){if(g[1]==="nth"){var i=/(-?)(\d*)n((?:\+|-)?\d*)/.exec(g[2]==="even"&&"2n"||g[2]==="odd"&&"2n+1"||!/\D/.test(g[2])&&"0n+"+g[2]||g[2]);g[2]=i[1]+(i[2]||1)-0;g[3]=i[3]-0}g[0]=e++;return g},ATTR:function(g,i,n,
+m,p,q){i=g[1].replace(/\\/g,"");if(!q&&o.attrMap[i])g[1]=o.attrMap[i];if(g[2]==="~=")g[4]=" "+g[4]+" ";return g},PSEUDO:function(g,i,n,m,p){if(g[1]==="not")if((d.exec(g[3])||"").length>1||/^\w/.test(g[3]))g[3]=k(g[3],null,null,i);else{g=k.filter(g[3],i,n,true^p);n||m.push.apply(m,g);return false}else if(o.match.POS.test(g[0])||o.match.CHILD.test(g[0]))return true;return g},POS:function(g){g.unshift(true);return g}},filters:{enabled:function(g){return g.disabled===false&&g.type!=="hidden"},disabled:function(g){return g.disabled===
+true},checked:function(g){return g.checked===true},selected:function(g){return g.selected===true},parent:function(g){return!!g.firstChild},empty:function(g){return!g.firstChild},has:function(g,i,n){return!!k(n[3],g).length},header:function(g){return/h\d/i.test(g.nodeName)},text:function(g){return"text"===g.type},radio:function(g){return"radio"===g.type},checkbox:function(g){return"checkbox"===g.type},file:function(g){return"file"===g.type},password:function(g){return"password"===g.type},submit:function(g){return"submit"===
+g.type},image:function(g){return"image"===g.type},reset:function(g){return"reset"===g.type},button:function(g){return"button"===g.type||g.nodeName.toLowerCase()==="button"},input:function(g){return/input|select|textarea|button/i.test(g.nodeName)}},setFilters:{first:function(g,i){return i===0},last:function(g,i,n,m){return i===m.length-1},even:function(g,i){return i%2===0},odd:function(g,i){return i%2===1},lt:function(g,i,n){return i<n[3]-0},gt:function(g,i,n){return i>n[3]-0},nth:function(g,i,n){return n[3]-
+0===i},eq:function(g,i,n){return n[3]-0===i}},filter:{PSEUDO:function(g,i,n,m){var p=i[1],q=o.filters[p];if(q)return q(g,n,i,m);else if(p==="contains")return(g.textContent||g.innerText||k.getText([g])||"").indexOf(i[3])>=0;else if(p==="not"){i=i[3];n=0;for(m=i.length;n<m;n++)if(i[n]===g)return false;return true}else k.error("Syntax error, unrecognized expression: "+p)},CHILD:function(g,i){var n=i[1],m=g;switch(n){case "only":case "first":for(;m=m.previousSibling;)if(m.nodeType===1)return false;if(n===
+"first")return true;m=g;case "last":for(;m=m.nextSibling;)if(m.nodeType===1)return false;return true;case "nth":n=i[2];var p=i[3];if(n===1&&p===0)return true;var q=i[0],u=g.parentNode;if(u&&(u.sizcache!==q||!g.nodeIndex)){var y=0;for(m=u.firstChild;m;m=m.nextSibling)if(m.nodeType===1)m.nodeIndex=++y;u.sizcache=q}m=g.nodeIndex-p;return n===0?m===0:m%n===0&&m/n>=0}},ID:function(g,i){return g.nodeType===1&&g.getAttribute("id")===i},TAG:function(g,i){return i==="*"&&g.nodeType===1||g.nodeName.toLowerCase()===
+i},CLASS:function(g,i){return(" "+(g.className||g.getAttribute("class"))+" ").indexOf(i)>-1},ATTR:function(g,i){var n=i[1];n=o.attrHandle[n]?o.attrHandle[n](g):g[n]!=null?g[n]:g.getAttribute(n);var m=n+"",p=i[2],q=i[4];return n==null?p==="!=":p==="="?m===q:p==="*="?m.indexOf(q)>=0:p==="~="?(" "+m+" ").indexOf(q)>=0:!q?m&&n!==false:p==="!="?m!==q:p==="^="?m.indexOf(q)===0:p==="$="?m.substr(m.length-q.length)===q:p==="|="?m===q||m.substr(0,q.length+1)===q+"-":false},POS:function(g,i,n,m){var p=o.setFilters[i[2]];
+if(p)return p(g,n,i,m)}}},x=o.match.POS,r=function(g,i){return"\\"+(i-0+1)},A;for(A in o.match){o.match[A]=RegExp(o.match[A].source+/(?![^\[]*\])(?![^\(]*\))/.source);o.leftMatch[A]=RegExp(/(^(?:.|\r|\n)*?)/.source+o.match[A].source.replace(/\\(\d+)/g,r))}var C=function(g,i){g=Array.prototype.slice.call(g,0);if(i){i.push.apply(i,g);return i}return g};try{Array.prototype.slice.call(t.documentElement.childNodes,0)}catch(J){C=function(g,i){var n=0,m=i||[];if(f.call(g)==="[object Array]")Array.prototype.push.apply(m,
+g);else if(typeof g.length==="number")for(var p=g.length;n<p;n++)m.push(g[n]);else for(;g[n];n++)m.push(g[n]);return m}}var w,I;if(t.documentElement.compareDocumentPosition)w=function(g,i){if(g===i){h=true;return 0}if(!g.compareDocumentPosition||!i.compareDocumentPosition)return g.compareDocumentPosition?-1:1;return g.compareDocumentPosition(i)&4?-1:1};else{w=function(g,i){var n,m,p=[],q=[];n=g.parentNode;m=i.parentNode;var u=n;if(g===i){h=true;return 0}else if(n===m)return I(g,i);else if(n){if(!m)return 1}else return-1;
+for(;u;){p.unshift(u);u=u.parentNode}for(u=m;u;){q.unshift(u);u=u.parentNode}n=p.length;m=q.length;for(u=0;u<n&&u<m;u++)if(p[u]!==q[u])return I(p[u],q[u]);return u===n?I(g,q[u],-1):I(p[u],i,1)};I=function(g,i,n){if(g===i)return n;for(g=g.nextSibling;g;){if(g===i)return-1;g=g.nextSibling}return 1}}k.getText=function(g){for(var i="",n,m=0;g[m];m++){n=g[m];if(n.nodeType===3||n.nodeType===4)i+=n.nodeValue;else if(n.nodeType!==8)i+=k.getText(n.childNodes)}return i};(function(){var g=t.createElement("div"),
+i="script"+(new Date).getTime(),n=t.documentElement;g.innerHTML="<a name='"+i+"'/>";n.insertBefore(g,n.firstChild);if(t.getElementById(i)){o.find.ID=function(m,p,q){if(typeof p.getElementById!=="undefined"&&!q)return(p=p.getElementById(m[1]))?p.id===m[1]||typeof p.getAttributeNode!=="undefined"&&p.getAttributeNode("id").nodeValue===m[1]?[p]:B:[]};o.filter.ID=function(m,p){var q=typeof m.getAttributeNode!=="undefined"&&m.getAttributeNode("id");return m.nodeType===1&&q&&q.nodeValue===p}}n.removeChild(g);
+n=g=null})();(function(){var g=t.createElement("div");g.appendChild(t.createComment(""));if(g.getElementsByTagName("*").length>0)o.find.TAG=function(i,n){var m=n.getElementsByTagName(i[1]);if(i[1]==="*"){for(var p=[],q=0;m[q];q++)m[q].nodeType===1&&p.push(m[q]);m=p}return m};g.innerHTML="<a href='#'></a>";if(g.firstChild&&typeof g.firstChild.getAttribute!=="undefined"&&g.firstChild.getAttribute("href")!=="#")o.attrHandle.href=function(i){return i.getAttribute("href",2)};g=null})();t.querySelectorAll&&
+function(){var g=k,i=t.createElement("div");i.innerHTML="<p class='TEST'></p>";if(!(i.querySelectorAll&&i.querySelectorAll(".TEST").length===0)){k=function(m,p,q,u){p=p||t;m=m.replace(/\=\s*([^'"\]]*)\s*\]/g,"='$1']");if(!u&&!k.isXML(p))if(p.nodeType===9)try{return C(p.querySelectorAll(m),q)}catch(y){}else if(p.nodeType===1&&p.nodeName.toLowerCase()!=="object"){var F=p.getAttribute("id"),M=F||"__sizzle__";F||p.setAttribute("id",M);try{return C(p.querySelectorAll("#"+M+" "+m),q)}catch(N){}finally{F||
+p.removeAttribute("id")}}return g(m,p,q,u)};for(var n in g)k[n]=g[n];i=null}}();(function(){var g=t.documentElement,i=g.matchesSelector||g.mozMatchesSelector||g.webkitMatchesSelector||g.msMatchesSelector,n=false;try{i.call(t.documentElement,"[test!='']:sizzle")}catch(m){n=true}if(i)k.matchesSelector=function(p,q){q=q.replace(/\=\s*([^'"\]]*)\s*\]/g,"='$1']");if(!k.isXML(p))try{if(n||!o.match.PSEUDO.test(q)&&!/!=/.test(q))return i.call(p,q)}catch(u){}return k(q,null,null,[p]).length>0}})();(function(){var g=
+t.createElement("div");g.innerHTML="<div class='test e'></div><div class='test'></div>";if(!(!g.getElementsByClassName||g.getElementsByClassName("e").length===0)){g.lastChild.className="e";if(g.getElementsByClassName("e").length!==1){o.order.splice(1,0,"CLASS");o.find.CLASS=function(i,n,m){if(typeof n.getElementsByClassName!=="undefined"&&!m)return n.getElementsByClassName(i[1])};g=null}}})();k.contains=t.documentElement.contains?function(g,i){return g!==i&&(g.contains?g.contains(i):true)}:t.documentElement.compareDocumentPosition?
+function(g,i){return!!(g.compareDocumentPosition(i)&16)}:function(){return false};k.isXML=function(g){return(g=(g?g.ownerDocument||g:0).documentElement)?g.nodeName!=="HTML":false};var L=function(g,i){for(var n,m=[],p="",q=i.nodeType?[i]:i;n=o.match.PSEUDO.exec(g);){p+=n[0];g=g.replace(o.match.PSEUDO,"")}g=o.relative[g]?g+"*":g;n=0;for(var u=q.length;n<u;n++)k(g,q[n],m);return k.filter(p,m)};c.find=k;c.expr=k.selectors;c.expr[":"]=c.expr.filters;c.unique=k.uniqueSort;c.text=k.getText;c.isXMLDoc=k.isXML;
+c.contains=k.contains})();var Za=/Until$/,$a=/^(?:parents|prevUntil|prevAll)/,ab=/,/,Na=/^.[^:#\[\.,]*$/,bb=Array.prototype.slice,cb=c.expr.match.POS;c.fn.extend({find:function(a){for(var b=this.pushStack("","find",a),d=0,e=0,f=this.length;e<f;e++){d=b.length;c.find(a,this[e],b);if(e>0)for(var h=d;h<b.length;h++)for(var l=0;l<d;l++)if(b[l]===b[h]){b.splice(h--,1);break}}return b},has:function(a){var b=c(a);return this.filter(function(){for(var d=0,e=b.length;d<e;d++)if(c.contains(this,b[d]))return true})},
+not:function(a){return this.pushStack(ma(this,a,false),"not",a)},filter:function(a){return this.pushStack(ma(this,a,true),"filter",a)},is:function(a){return!!a&&c.filter(a,this).length>0},closest:function(a,b){var d=[],e,f,h=this[0];if(c.isArray(a)){var l,k={},o=1;if(h&&a.length){e=0;for(f=a.length;e<f;e++){l=a[e];k[l]||(k[l]=c.expr.match.POS.test(l)?c(l,b||this.context):l)}for(;h&&h.ownerDocument&&h!==b;){for(l in k){e=k[l];if(e.jquery?e.index(h)>-1:c(h).is(e))d.push({selector:l,elem:h,level:o})}h=
+h.parentNode;o++}}return d}l=cb.test(a)?c(a,b||this.context):null;e=0;for(f=this.length;e<f;e++)for(h=this[e];h;)if(l?l.index(h)>-1:c.find.matchesSelector(h,a)){d.push(h);break}else{h=h.parentNode;if(!h||!h.ownerDocument||h===b)break}d=d.length>1?c.unique(d):d;return this.pushStack(d,"closest",a)},index:function(a){if(!a||typeof a==="string")return c.inArray(this[0],a?c(a):this.parent().children());return c.inArray(a.jquery?a[0]:a,this)},add:function(a,b){var d=typeof a==="string"?c(a,b||this.context):
+c.makeArray(a),e=c.merge(this.get(),d);return this.pushStack(!d[0]||!d[0].parentNode||d[0].parentNode.nodeType===11||!e[0]||!e[0].parentNode||e[0].parentNode.nodeType===11?e:c.unique(e))},andSelf:function(){return this.add(this.prevObject)}});c.each({parent:function(a){return(a=a.parentNode)&&a.nodeType!==11?a:null},parents:function(a){return c.dir(a,"parentNode")},parentsUntil:function(a,b,d){return c.dir(a,"parentNode",d)},next:function(a){return c.nth(a,2,"nextSibling")},prev:function(a){return c.nth(a,
+2,"previousSibling")},nextAll:function(a){return c.dir(a,"nextSibling")},prevAll:function(a){return c.dir(a,"previousSibling")},nextUntil:function(a,b,d){return c.dir(a,"nextSibling",d)},prevUntil:function(a,b,d){return c.dir(a,"previousSibling",d)},siblings:function(a){return c.sibling(a.parentNode.firstChild,a)},children:function(a){return c.sibling(a.firstChild)},contents:function(a){return c.nodeName(a,"iframe")?a.contentDocument||a.contentWindow.document:c.makeArray(a.childNodes)}},function(a,
+b){c.fn[a]=function(d,e){var f=c.map(this,b,d);Za.test(a)||(e=d);if(e&&typeof e==="string")f=c.filter(e,f);f=this.length>1?c.unique(f):f;if((this.length>1||ab.test(e))&&$a.test(a))f=f.reverse();return this.pushStack(f,a,bb.call(arguments).join(","))}});c.extend({filter:function(a,b,d){if(d)a=":not("+a+")";return b.length===1?c.find.matchesSelector(b[0],a)?[b[0]]:[]:c.find.matches(a,b)},dir:function(a,b,d){var e=[];for(a=a[b];a&&a.nodeType!==9&&(d===B||a.nodeType!==1||!c(a).is(d));){a.nodeType===1&&
+e.push(a);a=a[b]}return e},nth:function(a,b,d){b=b||1;for(var e=0;a;a=a[d])if(a.nodeType===1&&++e===b)break;return a},sibling:function(a,b){for(var d=[];a;a=a.nextSibling)a.nodeType===1&&a!==b&&d.push(a);return d}});var za=/ jQuery\d+="(?:\d+|null)"/g,$=/^\s+/,Aa=/<(?!area|br|col|embed|hr|img|input|link|meta|param)(([\w:]+)[^>]*)\/>/ig,Ba=/<([\w:]+)/,db=/<tbody/i,eb=/<|&#?\w+;/,Ca=/<(?:script|object|embed|option|style)/i,Da=/checked\s*(?:[^=]|=\s*.checked.)/i,fb=/\=([^="'>\s]+\/)>/g,P={option:[1,
+"<select multiple='multiple'>","</select>"],legend:[1,"<fieldset>","</fieldset>"],thead:[1,"<table>","</table>"],tr:[2,"<table><tbody>","</tbody></table>"],td:[3,"<table><tbody><tr>","</tr></tbody></table>"],col:[2,"<table><tbody></tbody><colgroup>","</colgroup></table>"],area:[1,"<map>","</map>"],_default:[0,"",""]};P.optgroup=P.option;P.tbody=P.tfoot=P.colgroup=P.caption=P.thead;P.th=P.td;if(!c.support.htmlSerialize)P._default=[1,"div<div>","</div>"];c.fn.extend({text:function(a){if(c.isFunction(a))return this.each(function(b){var d=
+c(this);d.text(a.call(this,b,d.text()))});if(typeof a!=="object"&&a!==B)return this.empty().append((this[0]&&this[0].ownerDocument||t).createTextNode(a));return c.text(this)},wrapAll:function(a){if(c.isFunction(a))return this.each(function(d){c(this).wrapAll(a.call(this,d))});if(this[0]){var b=c(a,this[0].ownerDocument).eq(0).clone(true);this[0].parentNode&&b.insertBefore(this[0]);b.map(function(){for(var d=this;d.firstChild&&d.firstChild.nodeType===1;)d=d.firstChild;return d}).append(this)}return this},
+wrapInner:function(a){if(c.isFunction(a))return this.each(function(b){c(this).wrapInner(a.call(this,b))});return this.each(function(){var b=c(this),d=b.contents();d.length?d.wrapAll(a):b.append(a)})},wrap:function(a){return this.each(function(){c(this).wrapAll(a)})},unwrap:function(){return this.parent().each(function(){c.nodeName(this,"body")||c(this).replaceWith(this.childNodes)}).end()},append:function(){return this.domManip(arguments,true,function(a){this.nodeType===1&&this.appendChild(a)})},
+prepend:function(){return this.domManip(arguments,true,function(a){this.nodeType===1&&this.insertBefore(a,this.firstChild)})},before:function(){if(this[0]&&this[0].parentNode)return this.domManip(arguments,false,function(b){this.parentNode.insertBefore(b,this)});else if(arguments.length){var a=c(arguments[0]);a.push.apply(a,this.toArray());return this.pushStack(a,"before",arguments)}},after:function(){if(this[0]&&this[0].parentNode)return this.domManip(arguments,false,function(b){this.parentNode.insertBefore(b,
+this.nextSibling)});else if(arguments.length){var a=this.pushStack(this,"after",arguments);a.push.apply(a,c(arguments[0]).toArray());return a}},remove:function(a,b){for(var d=0,e;(e=this[d])!=null;d++)if(!a||c.filter(a,[e]).length){if(!b&&e.nodeType===1){c.cleanData(e.getElementsByTagName("*"));c.cleanData([e])}e.parentNode&&e.parentNode.removeChild(e)}return this},empty:function(){for(var a=0,b;(b=this[a])!=null;a++)for(b.nodeType===1&&c.cleanData(b.getElementsByTagName("*"));b.firstChild;)b.removeChild(b.firstChild);
+return this},clone:function(a){var b=this.map(function(){if(!c.support.noCloneEvent&&!c.isXMLDoc(this)){var d=this.outerHTML,e=this.ownerDocument;if(!d){d=e.createElement("div");d.appendChild(this.cloneNode(true));d=d.innerHTML}return c.clean([d.replace(za,"").replace(fb,'="$1">').replace($,"")],e)[0]}else return this.cloneNode(true)});if(a===true){na(this,b);na(this.find("*"),b.find("*"))}return b},html:function(a){if(a===B)return this[0]&&this[0].nodeType===1?this[0].innerHTML.replace(za,""):null;
+else if(typeof a==="string"&&!Ca.test(a)&&(c.support.leadingWhitespace||!$.test(a))&&!P[(Ba.exec(a)||["",""])[1].toLowerCase()]){a=a.replace(Aa,"<$1></$2>");try{for(var b=0,d=this.length;b<d;b++)if(this[b].nodeType===1){c.cleanData(this[b].getElementsByTagName("*"));this[b].innerHTML=a}}catch(e){this.empty().append(a)}}else c.isFunction(a)?this.each(function(f){var h=c(this);h.html(a.call(this,f,h.html()))}):this.empty().append(a);return this},replaceWith:function(a){if(this[0]&&this[0].parentNode){if(c.isFunction(a))return this.each(function(b){var d=
+c(this),e=d.html();d.replaceWith(a.call(this,b,e))});if(typeof a!=="string")a=c(a).detach();return this.each(function(){var b=this.nextSibling,d=this.parentNode;c(this).remove();b?c(b).before(a):c(d).append(a)})}else return this.pushStack(c(c.isFunction(a)?a():a),"replaceWith",a)},detach:function(a){return this.remove(a,true)},domManip:function(a,b,d){var e,f,h,l=a[0],k=[];if(!c.support.checkClone&&arguments.length===3&&typeof l==="string"&&Da.test(l))return this.each(function(){c(this).domManip(a,
+b,d,true)});if(c.isFunction(l))return this.each(function(x){var r=c(this);a[0]=l.call(this,x,b?r.html():B);r.domManip(a,b,d)});if(this[0]){e=l&&l.parentNode;e=c.support.parentNode&&e&&e.nodeType===11&&e.childNodes.length===this.length?{fragment:e}:c.buildFragment(a,this,k);h=e.fragment;if(f=h.childNodes.length===1?h=h.firstChild:h.firstChild){b=b&&c.nodeName(f,"tr");f=0;for(var o=this.length;f<o;f++)d.call(b?c.nodeName(this[f],"table")?this[f].getElementsByTagName("tbody")[0]||this[f].appendChild(this[f].ownerDocument.createElement("tbody")):
+this[f]:this[f],f>0||e.cacheable||this.length>1?h.cloneNode(true):h)}k.length&&c.each(k,Oa)}return this}});c.buildFragment=function(a,b,d){var e,f,h;b=b&&b[0]?b[0].ownerDocument||b[0]:t;if(a.length===1&&typeof a[0]==="string"&&a[0].length<512&&b===t&&!Ca.test(a[0])&&(c.support.checkClone||!Da.test(a[0]))){f=true;if(h=c.fragments[a[0]])if(h!==1)e=h}if(!e){e=b.createDocumentFragment();c.clean(a,b,e,d)}if(f)c.fragments[a[0]]=h?e:1;return{fragment:e,cacheable:f}};c.fragments={};c.each({appendTo:"append",
+prependTo:"prepend",insertBefore:"before",insertAfter:"after",replaceAll:"replaceWith"},function(a,b){c.fn[a]=function(d){var e=[];d=c(d);var f=this.length===1&&this[0].parentNode;if(f&&f.nodeType===11&&f.childNodes.length===1&&d.length===1){d[b](this[0]);return this}else{f=0;for(var h=d.length;f<h;f++){var l=(f>0?this.clone(true):this).get();c(d[f])[b](l);e=e.concat(l)}return this.pushStack(e,a,d.selector)}}});c.extend({clean:function(a,b,d,e){b=b||t;if(typeof b.createElement==="undefined")b=b.ownerDocument||
+b[0]&&b[0].ownerDocument||t;for(var f=[],h=0,l;(l=a[h])!=null;h++){if(typeof l==="number")l+="";if(l){if(typeof l==="string"&&!eb.test(l))l=b.createTextNode(l);else if(typeof l==="string"){l=l.replace(Aa,"<$1></$2>");var k=(Ba.exec(l)||["",""])[1].toLowerCase(),o=P[k]||P._default,x=o[0],r=b.createElement("div");for(r.innerHTML=o[1]+l+o[2];x--;)r=r.lastChild;if(!c.support.tbody){x=db.test(l);k=k==="table"&&!x?r.firstChild&&r.firstChild.childNodes:o[1]==="<table>"&&!x?r.childNodes:[];for(o=k.length-
+1;o>=0;--o)c.nodeName(k[o],"tbody")&&!k[o].childNodes.length&&k[o].parentNode.removeChild(k[o])}!c.support.leadingWhitespace&&$.test(l)&&r.insertBefore(b.createTextNode($.exec(l)[0]),r.firstChild);l=r.childNodes}if(l.nodeType)f.push(l);else f=c.merge(f,l)}}if(d)for(h=0;f[h];h++)if(e&&c.nodeName(f[h],"script")&&(!f[h].type||f[h].type.toLowerCase()==="text/javascript"))e.push(f[h].parentNode?f[h].parentNode.removeChild(f[h]):f[h]);else{f[h].nodeType===1&&f.splice.apply(f,[h+1,0].concat(c.makeArray(f[h].getElementsByTagName("script"))));
+d.appendChild(f[h])}return f},cleanData:function(a){for(var b,d,e=c.cache,f=c.event.special,h=c.support.deleteExpando,l=0,k;(k=a[l])!=null;l++)if(!(k.nodeName&&c.noData[k.nodeName.toLowerCase()]))if(d=k[c.expando]){if((b=e[d])&&b.events)for(var o in b.events)f[o]?c.event.remove(k,o):c.removeEvent(k,o,b.handle);if(h)delete k[c.expando];else k.removeAttribute&&k.removeAttribute(c.expando);delete e[d]}}});var Ea=/alpha\([^)]*\)/i,gb=/opacity=([^)]*)/,hb=/-([a-z])/ig,ib=/([A-Z])/g,Fa=/^-?\d+(?:px)?$/i,
+jb=/^-?\d/,kb={position:"absolute",visibility:"hidden",display:"block"},Pa=["Left","Right"],Qa=["Top","Bottom"],W,Ga,aa,lb=function(a,b){return b.toUpperCase()};c.fn.css=function(a,b){if(arguments.length===2&&b===B)return this;return c.access(this,a,b,true,function(d,e,f){return f!==B?c.style(d,e,f):c.css(d,e)})};c.extend({cssHooks:{opacity:{get:function(a,b){if(b){var d=W(a,"opacity","opacity");return d===""?"1":d}else return a.style.opacity}}},cssNumber:{zIndex:true,fontWeight:true,opacity:true,
+zoom:true,lineHeight:true},cssProps:{"float":c.support.cssFloat?"cssFloat":"styleFloat"},style:function(a,b,d,e){if(!(!a||a.nodeType===3||a.nodeType===8||!a.style)){var f,h=c.camelCase(b),l=a.style,k=c.cssHooks[h];b=c.cssProps[h]||h;if(d!==B){if(!(typeof d==="number"&&isNaN(d)||d==null)){if(typeof d==="number"&&!c.cssNumber[h])d+="px";if(!k||!("set"in k)||(d=k.set(a,d))!==B)try{l[b]=d}catch(o){}}}else{if(k&&"get"in k&&(f=k.get(a,false,e))!==B)return f;return l[b]}}},css:function(a,b,d){var e,f=c.camelCase(b),
+h=c.cssHooks[f];b=c.cssProps[f]||f;if(h&&"get"in h&&(e=h.get(a,true,d))!==B)return e;else if(W)return W(a,b,f)},swap:function(a,b,d){var e={},f;for(f in b){e[f]=a.style[f];a.style[f]=b[f]}d.call(a);for(f in b)a.style[f]=e[f]},camelCase:function(a){return a.replace(hb,lb)}});c.curCSS=c.css;c.each(["height","width"],function(a,b){c.cssHooks[b]={get:function(d,e,f){var h;if(e){if(d.offsetWidth!==0)h=oa(d,b,f);else c.swap(d,kb,function(){h=oa(d,b,f)});if(h<=0){h=W(d,b,b);if(h==="0px"&&aa)h=aa(d,b,b);
+if(h!=null)return h===""||h==="auto"?"0px":h}if(h<0||h==null){h=d.style[b];return h===""||h==="auto"?"0px":h}return typeof h==="string"?h:h+"px"}},set:function(d,e){if(Fa.test(e)){e=parseFloat(e);if(e>=0)return e+"px"}else return e}}});if(!c.support.opacity)c.cssHooks.opacity={get:function(a,b){return gb.test((b&&a.currentStyle?a.currentStyle.filter:a.style.filter)||"")?parseFloat(RegExp.$1)/100+"":b?"1":""},set:function(a,b){var d=a.style;d.zoom=1;var e=c.isNaN(b)?"":"alpha(opacity="+b*100+")",f=
+d.filter||"";d.filter=Ea.test(f)?f.replace(Ea,e):d.filter+" "+e}};if(t.defaultView&&t.defaultView.getComputedStyle)Ga=function(a,b,d){var e;d=d.replace(ib,"-$1").toLowerCase();if(!(b=a.ownerDocument.defaultView))return B;if(b=b.getComputedStyle(a,null)){e=b.getPropertyValue(d);if(e===""&&!c.contains(a.ownerDocument.documentElement,a))e=c.style(a,d)}return e};if(t.documentElement.currentStyle)aa=function(a,b){var d,e,f=a.currentStyle&&a.currentStyle[b],h=a.style;if(!Fa.test(f)&&jb.test(f)){d=h.left;
+e=a.runtimeStyle.left;a.runtimeStyle.left=a.currentStyle.left;h.left=b==="fontSize"?"1em":f||0;f=h.pixelLeft+"px";h.left=d;a.runtimeStyle.left=e}return f===""?"auto":f};W=Ga||aa;if(c.expr&&c.expr.filters){c.expr.filters.hidden=function(a){var b=a.offsetHeight;return a.offsetWidth===0&&b===0||!c.support.reliableHiddenOffsets&&(a.style.display||c.css(a,"display"))==="none"};c.expr.filters.visible=function(a){return!c.expr.filters.hidden(a)}}var mb=c.now(),nb=/<script\b[^<]*(?:(?!<\/script>)<[^<]*)*<\/script>/gi,
+ob=/^(?:select|textarea)/i,pb=/^(?:color|date|datetime|email|hidden|month|number|password|range|search|tel|text|time|url|week)$/i,qb=/^(?:GET|HEAD)$/,Ra=/\[\]$/,T=/\=\?(&|$)/,ja=/\?/,rb=/([?&])_=[^&]*/,sb=/^(\w+:)?\/\/([^\/?#]+)/,tb=/%20/g,ub=/#.*$/,Ha=c.fn.load;c.fn.extend({load:function(a,b,d){if(typeof a!=="string"&&Ha)return Ha.apply(this,arguments);else if(!this.length)return this;var e=a.indexOf(" ");if(e>=0){var f=a.slice(e,a.length);a=a.slice(0,e)}e="GET";if(b)if(c.isFunction(b)){d=b;b=null}else if(typeof b===
+"object"){b=c.param(b,c.ajaxSettings.traditional);e="POST"}var h=this;c.ajax({url:a,type:e,dataType:"html",data:b,complete:function(l,k){if(k==="success"||k==="notmodified")h.html(f?c("<div>").append(l.responseText.replace(nb,"")).find(f):l.responseText);d&&h.each(d,[l.responseText,k,l])}});return this},serialize:function(){return c.param(this.serializeArray())},serializeArray:function(){return this.map(function(){return this.elements?c.makeArray(this.elements):this}).filter(function(){return this.name&&
+!this.disabled&&(this.checked||ob.test(this.nodeName)||pb.test(this.type))}).map(function(a,b){var d=c(this).val();return d==null?null:c.isArray(d)?c.map(d,function(e){return{name:b.name,value:e}}):{name:b.name,value:d}}).get()}});c.each("ajaxStart ajaxStop ajaxComplete ajaxError ajaxSuccess ajaxSend".split(" "),function(a,b){c.fn[b]=function(d){return this.bind(b,d)}});c.extend({get:function(a,b,d,e){if(c.isFunction(b)){e=e||d;d=b;b=null}return c.ajax({type:"GET",url:a,data:b,success:d,dataType:e})},
+getScript:function(a,b){return c.get(a,null,b,"script")},getJSON:function(a,b,d){return c.get(a,b,d,"json")},post:function(a,b,d,e){if(c.isFunction(b)){e=e||d;d=b;b={}}return c.ajax({type:"POST",url:a,data:b,success:d,dataType:e})},ajaxSetup:function(a){c.extend(c.ajaxSettings,a)},ajaxSettings:{url:location.href,global:true,type:"GET",contentType:"application/x-www-form-urlencoded",processData:true,async:true,xhr:function(){return new E.XMLHttpRequest},accepts:{xml:"application/xml, text/xml",html:"text/html",
+script:"text/javascript, application/javascript",json:"application/json, text/javascript",text:"text/plain",_default:"*/*"}},ajax:function(a){var b=c.extend(true,{},c.ajaxSettings,a),d,e,f,h=b.type.toUpperCase(),l=qb.test(h);b.url=b.url.replace(ub,"");b.context=a&&a.context!=null?a.context:b;if(b.data&&b.processData&&typeof b.data!=="string")b.data=c.param(b.data,b.traditional);if(b.dataType==="jsonp"){if(h==="GET")T.test(b.url)||(b.url+=(ja.test(b.url)?"&":"?")+(b.jsonp||"callback")+"=?");else if(!b.data||
+!T.test(b.data))b.data=(b.data?b.data+"&":"")+(b.jsonp||"callback")+"=?";b.dataType="json"}if(b.dataType==="json"&&(b.data&&T.test(b.data)||T.test(b.url))){d=b.jsonpCallback||"jsonp"+mb++;if(b.data)b.data=(b.data+"").replace(T,"="+d+"$1");b.url=b.url.replace(T,"="+d+"$1");b.dataType="script";var k=E[d];E[d]=function(m){if(c.isFunction(k))k(m);else{E[d]=B;try{delete E[d]}catch(p){}}f=m;c.handleSuccess(b,w,e,f);c.handleComplete(b,w,e,f);r&&r.removeChild(A)}}if(b.dataType==="script"&&b.cache===null)b.cache=
+false;if(b.cache===false&&l){var o=c.now(),x=b.url.replace(rb,"$1_="+o);b.url=x+(x===b.url?(ja.test(b.url)?"&":"?")+"_="+o:"")}if(b.data&&l)b.url+=(ja.test(b.url)?"&":"?")+b.data;b.global&&c.active++===0&&c.event.trigger("ajaxStart");o=(o=sb.exec(b.url))&&(o[1]&&o[1].toLowerCase()!==location.protocol||o[2].toLowerCase()!==location.host);if(b.dataType==="script"&&h==="GET"&&o){var r=t.getElementsByTagName("head")[0]||t.documentElement,A=t.createElement("script");if(b.scriptCharset)A.charset=b.scriptCharset;
+A.src=b.url;if(!d){var C=false;A.onload=A.onreadystatechange=function(){if(!C&&(!this.readyState||this.readyState==="loaded"||this.readyState==="complete")){C=true;c.handleSuccess(b,w,e,f);c.handleComplete(b,w,e,f);A.onload=A.onreadystatechange=null;r&&A.parentNode&&r.removeChild(A)}}}r.insertBefore(A,r.firstChild);return B}var J=false,w=b.xhr();if(w){b.username?w.open(h,b.url,b.async,b.username,b.password):w.open(h,b.url,b.async);try{if(b.data!=null&&!l||a&&a.contentType)w.setRequestHeader("Content-Type",
+b.contentType);if(b.ifModified){c.lastModified[b.url]&&w.setRequestHeader("If-Modified-Since",c.lastModified[b.url]);c.etag[b.url]&&w.setRequestHeader("If-None-Match",c.etag[b.url])}o||w.setRequestHeader("X-Requested-With","XMLHttpRequest");w.setRequestHeader("Accept",b.dataType&&b.accepts[b.dataType]?b.accepts[b.dataType]+", */*; q=0.01":b.accepts._default)}catch(I){}if(b.beforeSend&&b.beforeSend.call(b.context,w,b)===false){b.global&&c.active--===1&&c.event.trigger("ajaxStop");w.abort();return false}b.global&&
+c.triggerGlobal(b,"ajaxSend",[w,b]);var L=w.onreadystatechange=function(m){if(!w||w.readyState===0||m==="abort"){J||c.handleComplete(b,w,e,f);J=true;if(w)w.onreadystatechange=c.noop}else if(!J&&w&&(w.readyState===4||m==="timeout")){J=true;w.onreadystatechange=c.noop;e=m==="timeout"?"timeout":!c.httpSuccess(w)?"error":b.ifModified&&c.httpNotModified(w,b.url)?"notmodified":"success";var p;if(e==="success")try{f=c.httpData(w,b.dataType,b)}catch(q){e="parsererror";p=q}if(e==="success"||e==="notmodified")d||
+c.handleSuccess(b,w,e,f);else c.handleError(b,w,e,p);d||c.handleComplete(b,w,e,f);m==="timeout"&&w.abort();if(b.async)w=null}};try{var g=w.abort;w.abort=function(){w&&Function.prototype.call.call(g,w);L("abort")}}catch(i){}b.async&&b.timeout>0&&setTimeout(function(){w&&!J&&L("timeout")},b.timeout);try{w.send(l||b.data==null?null:b.data)}catch(n){c.handleError(b,w,null,n);c.handleComplete(b,w,e,f)}b.async||L();return w}},param:function(a,b){var d=[],e=function(h,l){l=c.isFunction(l)?l():l;d[d.length]=
+encodeURIComponent(h)+"="+encodeURIComponent(l)};if(b===B)b=c.ajaxSettings.traditional;if(c.isArray(a)||a.jquery)c.each(a,function(){e(this.name,this.value)});else for(var f in a)da(f,a[f],b,e);return d.join("&").replace(tb,"+")}});c.extend({active:0,lastModified:{},etag:{},handleError:function(a,b,d,e){a.error&&a.error.call(a.context,b,d,e);a.global&&c.triggerGlobal(a,"ajaxError",[b,a,e])},handleSuccess:function(a,b,d,e){a.success&&a.success.call(a.context,e,d,b);a.global&&c.triggerGlobal(a,"ajaxSuccess",
+[b,a])},handleComplete:function(a,b,d){a.complete&&a.complete.call(a.context,b,d);a.global&&c.triggerGlobal(a,"ajaxComplete",[b,a]);a.global&&c.active--===1&&c.event.trigger("ajaxStop")},triggerGlobal:function(a,b,d){(a.context&&a.context.url==null?c(a.context):c.event).trigger(b,d)},httpSuccess:function(a){try{return!a.status&&location.protocol==="file:"||a.status>=200&&a.status<300||a.status===304||a.status===1223}catch(b){}return false},httpNotModified:function(a,b){var d=a.getResponseHeader("Last-Modified"),
+e=a.getResponseHeader("Etag");if(d)c.lastModified[b]=d;if(e)c.etag[b]=e;return a.status===304},httpData:function(a,b,d){var e=a.getResponseHeader("content-type")||"",f=b==="xml"||!b&&e.indexOf("xml")>=0;a=f?a.responseXML:a.responseText;f&&a.documentElement.nodeName==="parsererror"&&c.error("parsererror");if(d&&d.dataFilter)a=d.dataFilter(a,b);if(typeof a==="string")if(b==="json"||!b&&e.indexOf("json")>=0)a=c.parseJSON(a);else if(b==="script"||!b&&e.indexOf("javascript")>=0)c.globalEval(a);return a}});
+if(E.ActiveXObject)c.ajaxSettings.xhr=function(){if(E.location.protocol!=="file:")try{return new E.XMLHttpRequest}catch(a){}try{return new E.ActiveXObject("Microsoft.XMLHTTP")}catch(b){}};c.support.ajax=!!c.ajaxSettings.xhr();var ea={},vb=/^(?:toggle|show|hide)$/,wb=/^([+\-]=)?([\d+.\-]+)(.*)$/,ba,pa=[["height","marginTop","marginBottom","paddingTop","paddingBottom"],["width","marginLeft","marginRight","paddingLeft","paddingRight"],["opacity"]];c.fn.extend({show:function(a,b,d){if(a||a===0)return this.animate(S("show",
+3),a,b,d);else{d=0;for(var e=this.length;d<e;d++){a=this[d];b=a.style.display;if(!c.data(a,"olddisplay")&&b==="none")b=a.style.display="";b===""&&c.css(a,"display")==="none"&&c.data(a,"olddisplay",qa(a.nodeName))}for(d=0;d<e;d++){a=this[d];b=a.style.display;if(b===""||b==="none")a.style.display=c.data(a,"olddisplay")||""}return this}},hide:function(a,b,d){if(a||a===0)return this.animate(S("hide",3),a,b,d);else{a=0;for(b=this.length;a<b;a++){d=c.css(this[a],"display");d!=="none"&&c.data(this[a],"olddisplay",
+d)}for(a=0;a<b;a++)this[a].style.display="none";return this}},_toggle:c.fn.toggle,toggle:function(a,b,d){var e=typeof a==="boolean";if(c.isFunction(a)&&c.isFunction(b))this._toggle.apply(this,arguments);else a==null||e?this.each(function(){var f=e?a:c(this).is(":hidden");c(this)[f?"show":"hide"]()}):this.animate(S("toggle",3),a,b,d);return this},fadeTo:function(a,b,d,e){return this.filter(":hidden").css("opacity",0).show().end().animate({opacity:b},a,d,e)},animate:function(a,b,d,e){var f=c.speed(b,
+d,e);if(c.isEmptyObject(a))return this.each(f.complete);return this[f.queue===false?"each":"queue"](function(){var h=c.extend({},f),l,k=this.nodeType===1,o=k&&c(this).is(":hidden"),x=this;for(l in a){var r=c.camelCase(l);if(l!==r){a[r]=a[l];delete a[l];l=r}if(a[l]==="hide"&&o||a[l]==="show"&&!o)return h.complete.call(this);if(k&&(l==="height"||l==="width")){h.overflow=[this.style.overflow,this.style.overflowX,this.style.overflowY];if(c.css(this,"display")==="inline"&&c.css(this,"float")==="none")if(c.support.inlineBlockNeedsLayout)if(qa(this.nodeName)===
+"inline")this.style.display="inline-block";else{this.style.display="inline";this.style.zoom=1}else this.style.display="inline-block"}if(c.isArray(a[l])){(h.specialEasing=h.specialEasing||{})[l]=a[l][1];a[l]=a[l][0]}}if(h.overflow!=null)this.style.overflow="hidden";h.curAnim=c.extend({},a);c.each(a,function(A,C){var J=new c.fx(x,h,A);if(vb.test(C))J[C==="toggle"?o?"show":"hide":C](a);else{var w=wb.exec(C),I=J.cur()||0;if(w){var L=parseFloat(w[2]),g=w[3]||"px";if(g!=="px"){c.style(x,A,(L||1)+g);I=(L||
+1)/J.cur()*I;c.style(x,A,I+g)}if(w[1])L=(w[1]==="-="?-1:1)*L+I;J.custom(I,L,g)}else J.custom(I,C,"")}});return true})},stop:function(a,b){var d=c.timers;a&&this.queue([]);this.each(function(){for(var e=d.length-1;e>=0;e--)if(d[e].elem===this){b&&d[e](true);d.splice(e,1)}});b||this.dequeue();return this}});c.each({slideDown:S("show",1),slideUp:S("hide",1),slideToggle:S("toggle",1),fadeIn:{opacity:"show"},fadeOut:{opacity:"hide"},fadeToggle:{opacity:"toggle"}},function(a,b){c.fn[a]=function(d,e,f){return this.animate(b,
+d,e,f)}});c.extend({speed:function(a,b,d){var e=a&&typeof a==="object"?c.extend({},a):{complete:d||!d&&b||c.isFunction(a)&&a,duration:a,easing:d&&b||b&&!c.isFunction(b)&&b};e.duration=c.fx.off?0:typeof e.duration==="number"?e.duration:e.duration in c.fx.speeds?c.fx.speeds[e.duration]:c.fx.speeds._default;e.old=e.complete;e.complete=function(){e.queue!==false&&c(this).dequeue();c.isFunction(e.old)&&e.old.call(this)};return e},easing:{linear:function(a,b,d,e){return d+e*a},swing:function(a,b,d,e){return(-Math.cos(a*
+Math.PI)/2+0.5)*e+d}},timers:[],fx:function(a,b,d){this.options=b;this.elem=a;this.prop=d;if(!b.orig)b.orig={}}});c.fx.prototype={update:function(){this.options.step&&this.options.step.call(this.elem,this.now,this);(c.fx.step[this.prop]||c.fx.step._default)(this)},cur:function(){if(this.elem[this.prop]!=null&&(!this.elem.style||this.elem.style[this.prop]==null))return this.elem[this.prop];var a=parseFloat(c.css(this.elem,this.prop));return a&&a>-1E4?a:0},custom:function(a,b,d){function e(l){return f.step(l)}
+var f=this,h=c.fx;this.startTime=c.now();this.start=a;this.end=b;this.unit=d||this.unit||"px";this.now=this.start;this.pos=this.state=0;e.elem=this.elem;if(e()&&c.timers.push(e)&&!ba)ba=setInterval(h.tick,h.interval)},show:function(){this.options.orig[this.prop]=c.style(this.elem,this.prop);this.options.show=true;this.custom(this.prop==="width"||this.prop==="height"?1:0,this.cur());c(this.elem).show()},hide:function(){this.options.orig[this.prop]=c.style(this.elem,this.prop);this.options.hide=true;
+this.custom(this.cur(),0)},step:function(a){var b=c.now(),d=true;if(a||b>=this.options.duration+this.startTime){this.now=this.end;this.pos=this.state=1;this.update();this.options.curAnim[this.prop]=true;for(var e in this.options.curAnim)if(this.options.curAnim[e]!==true)d=false;if(d){if(this.options.overflow!=null&&!c.support.shrinkWrapBlocks){var f=this.elem,h=this.options;c.each(["","X","Y"],function(k,o){f.style["overflow"+o]=h.overflow[k]})}this.options.hide&&c(this.elem).hide();if(this.options.hide||
+this.options.show)for(var l in this.options.curAnim)c.style(this.elem,l,this.options.orig[l]);this.options.complete.call(this.elem)}return false}else{a=b-this.startTime;this.state=a/this.options.duration;b=this.options.easing||(c.easing.swing?"swing":"linear");this.pos=c.easing[this.options.specialEasing&&this.options.specialEasing[this.prop]||b](this.state,a,0,1,this.options.duration);this.now=this.start+(this.end-this.start)*this.pos;this.update()}return true}};c.extend(c.fx,{tick:function(){for(var a=
+c.timers,b=0;b<a.length;b++)a[b]()||a.splice(b--,1);a.length||c.fx.stop()},interval:13,stop:function(){clearInterval(ba);ba=null},speeds:{slow:600,fast:200,_default:400},step:{opacity:function(a){c.style(a.elem,"opacity",a.now)},_default:function(a){if(a.elem.style&&a.elem.style[a.prop]!=null)a.elem.style[a.prop]=(a.prop==="width"||a.prop==="height"?Math.max(0,a.now):a.now)+a.unit;else a.elem[a.prop]=a.now}}});if(c.expr&&c.expr.filters)c.expr.filters.animated=function(a){return c.grep(c.timers,function(b){return a===
+b.elem}).length};var xb=/^t(?:able|d|h)$/i,Ia=/^(?:body|html)$/i;c.fn.offset="getBoundingClientRect"in t.documentElement?function(a){var b=this[0],d;if(a)return this.each(function(l){c.offset.setOffset(this,a,l)});if(!b||!b.ownerDocument)return null;if(b===b.ownerDocument.body)return c.offset.bodyOffset(b);try{d=b.getBoundingClientRect()}catch(e){}var f=b.ownerDocument,h=f.documentElement;if(!d||!c.contains(h,b))return d||{top:0,left:0};b=f.body;f=fa(f);return{top:d.top+(f.pageYOffset||c.support.boxModel&&
+h.scrollTop||b.scrollTop)-(h.clientTop||b.clientTop||0),left:d.left+(f.pageXOffset||c.support.boxModel&&h.scrollLeft||b.scrollLeft)-(h.clientLeft||b.clientLeft||0)}}:function(a){var b=this[0];if(a)return this.each(function(x){c.offset.setOffset(this,a,x)});if(!b||!b.ownerDocument)return null;if(b===b.ownerDocument.body)return c.offset.bodyOffset(b);c.offset.initialize();var d,e=b.offsetParent,f=b.ownerDocument,h=f.documentElement,l=f.body;d=(f=f.defaultView)?f.getComputedStyle(b,null):b.currentStyle;
+for(var k=b.offsetTop,o=b.offsetLeft;(b=b.parentNode)&&b!==l&&b!==h;){if(c.offset.supportsFixedPosition&&d.position==="fixed")break;d=f?f.getComputedStyle(b,null):b.currentStyle;k-=b.scrollTop;o-=b.scrollLeft;if(b===e){k+=b.offsetTop;o+=b.offsetLeft;if(c.offset.doesNotAddBorder&&!(c.offset.doesAddBorderForTableAndCells&&xb.test(b.nodeName))){k+=parseFloat(d.borderTopWidth)||0;o+=parseFloat(d.borderLeftWidth)||0}e=b.offsetParent}if(c.offset.subtractsBorderForOverflowNotVisible&&d.overflow!=="visible"){k+=
+parseFloat(d.borderTopWidth)||0;o+=parseFloat(d.borderLeftWidth)||0}d=d}if(d.position==="relative"||d.position==="static"){k+=l.offsetTop;o+=l.offsetLeft}if(c.offset.supportsFixedPosition&&d.position==="fixed"){k+=Math.max(h.scrollTop,l.scrollTop);o+=Math.max(h.scrollLeft,l.scrollLeft)}return{top:k,left:o}};c.offset={initialize:function(){var a=t.body,b=t.createElement("div"),d,e,f,h=parseFloat(c.css(a,"marginTop"))||0;c.extend(b.style,{position:"absolute",top:0,left:0,margin:0,border:0,width:"1px",
+height:"1px",visibility:"hidden"});b.innerHTML="<div style='position:absolute;top:0;left:0;margin:0;border:5px solid #000;padding:0;width:1px;height:1px;'><div></div></div><table style='position:absolute;top:0;left:0;margin:0;border:5px solid #000;padding:0;width:1px;height:1px;' cellpadding='0' cellspacing='0'><tr><td></td></tr></table>";a.insertBefore(b,a.firstChild);d=b.firstChild;e=d.firstChild;f=d.nextSibling.firstChild.firstChild;this.doesNotAddBorder=e.offsetTop!==5;this.doesAddBorderForTableAndCells=
+f.offsetTop===5;e.style.position="fixed";e.style.top="20px";this.supportsFixedPosition=e.offsetTop===20||e.offsetTop===15;e.style.position=e.style.top="";d.style.overflow="hidden";d.style.position="relative";this.subtractsBorderForOverflowNotVisible=e.offsetTop===-5;this.doesNotIncludeMarginInBodyOffset=a.offsetTop!==h;a.removeChild(b);c.offset.initialize=c.noop},bodyOffset:function(a){var b=a.offsetTop,d=a.offsetLeft;c.offset.initialize();if(c.offset.doesNotIncludeMarginInBodyOffset){b+=parseFloat(c.css(a,
+"marginTop"))||0;d+=parseFloat(c.css(a,"marginLeft"))||0}return{top:b,left:d}},setOffset:function(a,b,d){var e=c.css(a,"position");if(e==="static")a.style.position="relative";var f=c(a),h=f.offset(),l=c.css(a,"top"),k=c.css(a,"left"),o=e==="absolute"&&c.inArray("auto",[l,k])>-1;e={};var x={};if(o)x=f.position();l=o?x.top:parseInt(l,10)||0;k=o?x.left:parseInt(k,10)||0;if(c.isFunction(b))b=b.call(a,d,h);if(b.top!=null)e.top=b.top-h.top+l;if(b.left!=null)e.left=b.left-h.left+k;"using"in b?b.using.call(a,
+e):f.css(e)}};c.fn.extend({position:function(){if(!this[0])return null;var a=this[0],b=this.offsetParent(),d=this.offset(),e=Ia.test(b[0].nodeName)?{top:0,left:0}:b.offset();d.top-=parseFloat(c.css(a,"marginTop"))||0;d.left-=parseFloat(c.css(a,"marginLeft"))||0;e.top+=parseFloat(c.css(b[0],"borderTopWidth"))||0;e.left+=parseFloat(c.css(b[0],"borderLeftWidth"))||0;return{top:d.top-e.top,left:d.left-e.left}},offsetParent:function(){return this.map(function(){for(var a=this.offsetParent||t.body;a&&!Ia.test(a.nodeName)&&
+c.css(a,"position")==="static";)a=a.offsetParent;return a})}});c.each(["Left","Top"],function(a,b){var d="scroll"+b;c.fn[d]=function(e){var f=this[0],h;if(!f)return null;if(e!==B)return this.each(function(){if(h=fa(this))h.scrollTo(!a?e:c(h).scrollLeft(),a?e:c(h).scrollTop());else this[d]=e});else return(h=fa(f))?"pageXOffset"in h?h[a?"pageYOffset":"pageXOffset"]:c.support.boxModel&&h.document.documentElement[d]||h.document.body[d]:f[d]}});c.each(["Height","Width"],function(a,b){var d=b.toLowerCase();
+c.fn["inner"+b]=function(){return this[0]?parseFloat(c.css(this[0],d,"padding")):null};c.fn["outer"+b]=function(e){return this[0]?parseFloat(c.css(this[0],d,e?"margin":"border")):null};c.fn[d]=function(e){var f=this[0];if(!f)return e==null?null:this;if(c.isFunction(e))return this.each(function(l){var k=c(this);k[d](e.call(this,l,k[d]()))});if(c.isWindow(f))return f.document.compatMode==="CSS1Compat"&&f.document.documentElement["client"+b]||f.document.body["client"+b];else if(f.nodeType===9)return Math.max(f.documentElement["client"+
+b],f.body["scroll"+b],f.documentElement["scroll"+b],f.body["offset"+b],f.documentElement["offset"+b]);else if(e===B){f=c.css(f,d);var h=parseFloat(f);return c.isNaN(h)?f:h}else return this.css(d,typeof e==="string"?e:e+"px")}})})(window);
2 => 'zwei',
3 => 'drei',
4 => 'vier',
- 5 => 'fünf',
+ 5 => 'fünf',
6 => 'sechs',
7 => 'sieben',
8 => 'acht',
9 => 'neun',
10 => 'zehn',
11 => 'elf',
- 12 => 'zwölf',
+ 12 => 'zwölf',
13 => 'dreizehn',
14 => 'vierzehn',
- 15 => 'fünfzehn',
+ 15 => 'fünfzehn',
16 => 'sechzehn',
17 => 'siebzehn',
18 => 'achtzehn',
20 => 'zwanzig',
30 => 'dreissig',
40 => 'vierzig',
- 50 => 'fünfzig',
+ 50 => 'fünfzig',
60 => 'sechzig',
70 => 'siebzig',
80 => 'achtzig',
#!/usr/bin/perl
-# -*- coding: iso-8859-15; -*-
-# vim: fenc=ISO-8859-15
+# -*- coding: utf-8; -*-
+# vim: fenc=UTF-8
# These are all the texts to build the translations files.
# The file has the form of 'english text' => 'foreign text',
'<%total%> -- Amount payable' => '<%total%> -- Noch zu bezahlender Betrag',
'<%total_wo_skonto%> -- Amount payable less discount' => '<%total_wo_skonto%> -- Noch zu bezahlender Betrag abzüglich Skonto',
'*/' => '*/',
- '---please select---' => '---bitte auswählen---',
+ '---please select---' => '---bitte auswählen---',
'...after loggin in' => '...nach dem Anmelden',
'...done' => '...fertig',
'...on the TODO list' => '...auf der Aufgabenliste',
'A Buchungsgruppe consists of a descriptive name and the account numbers for the income and expense accounts for those four tax zones as well as the inventory account number.' => 'Eine Buchungsgruppe besteht aus einem deskriptiven Namen, den Erlös- und Aufwandskonten für diese vier Steuerzonen sowie aus einem Inventarkonto.',
'A group named "Full Access" has been created.' => 'Eine Gruppe namens "Vollzugriff" wurde angelegt.',
'A group with that name does already exist.' => 'Eine Gruppe mit diesem Namen gibt es bereits.',
- 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => 'Die Bedienung von Lx-Office wurde an vielen Stellen mit Javascript verbessert. Obwohl es derzeit möglich ist, jeden Aspekt von Lx-Office auch ohne Javascript zu benutzen, empfehlen wir es. In einer zukünftigen Version wird Javascript eventuell notwendig sein um weitergehende Features zu benutzen.',
+ 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => 'Die Bedienung von Lx-Office wurde an vielen Stellen mit Javascript verbessert. Obwohl es derzeit möglich ist, jeden Aspekt von Lx-Office auch ohne Javascript zu benutzen, empfehlen wir es. In einer zukünftigen Version wird Javascript eventuell notwendig sein um weitergehende Features zu benutzen.',
'A temporary directory could not be created:' => 'Ein temporäres Verzeichnis konnte nicht erstellt werden:',
- 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => 'Eine temporäre Datei konnte nicht angelegt werden. Bitte stellen Sie sicher, dass das Verzeichnis "#1" vom Webserver beschrieben werden darf.',
+ 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => 'Eine temporäre Datei konnte nicht angelegt werden. Bitte stellen Sie sicher, dass das Verzeichnis "#1" vom Webserver beschrieben werden darf.',
'A temporary file could not be created:' => 'Eine temporäre Datei konnte nicht erstellt werden:',
'A unit with this name does already exist.' => 'Eine Einheit mit diesem Namen existiert bereits.',
- 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => 'Eine als \'editierbar\' markierte Variable kann in jedem Angebot, Auftrag, jeder Rechnung etc für jede Position geändert werden.',
- 'ADDED' => 'Hinzugefügt',
+ 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => 'Eine als \'editierbar\' markierte Variable kann in jedem Angebot, Auftrag, jeder Rechnung etc für jede Position geändert werden.',
+ 'ADDED' => 'Hinzugefügt',
'AP' => 'Einkauf',
'AP Aging' => 'Offene Verbindlichkeiten',
'AP Transaction' => 'Kreditorenbuchung',
'AP Transaction Storno (one letter abbreviation)' => 'S',
'AP Transaction with Storno (abbreviation)' => 'K(S)',
'AP Transactions' => 'Kreditorenbuchungen',
- 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
+ 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
'AR' => 'Verkauf',
'AR Aging' => 'Offene Forderungen',
'AR Transaction' => 'Debitorenbuchung',
'Account Category C' => 'Kosten',
'Account Category E' => 'Aufwandskonto',
'Account Category G' => '?Gegenkonto?',
- 'Account Category I' => 'Erlöskonto',
+ 'Account Category I' => 'Erlöskonto',
'Account Category L' => 'Passiva/Mittelherkunft',
'Account Category Q' => 'Passiva',
'Account Description missing!' => 'Beschreibung fehlt!',
'Account Link AP_paid' => 'Verbindlichkeiten Zahlungsausgang',
'Account Link AP_tax' => 'Verbindlichkeiten Steuer',
'Account Link AR' => 'Verkauf',
- 'Account Link AR_amount' => 'Forderungen Erlöskonto',
+ 'Account Link AR_amount' => 'Forderungen Erlöskonto',
'Account Link AR_paid' => 'Forderungen Zahlungseingang',
'Account Link AR_tax' => 'Forderungen Steuer',
'Account Link CT_tax' => 'Kunde/Lieferant Steuer',
'Account Link IC' => 'Inventar',
'Account Link IC_cogs' => 'Warenliste Aufwandskonto',
'Account Link IC_expense' => 'Dienstleistungen Aufwandskonto',
- 'Account Link IC_income' => 'Dienstleistungen Erlöskonto',
- 'Account Link IC_sale' => 'Warenliste Erlöskonto',
+ 'Account Link IC_income' => 'Dienstleistungen Erlöskonto',
+ 'Account Link IC_sale' => 'Warenliste Erlöskonto',
'Account Link IC_taxpart' => 'Warenliste Steuer',
'Account Link IC_taxservice' => 'Dienstleistungen Steuer',
'Account Number' => 'Kontonummer',
'Account Nummer' => 'Kontonummer',
'Account Type' => 'Kontoart',
'Account Type missing!' => 'Kontoart fehlt!',
- 'Account deleted!' => 'Konto gelöscht!',
+ 'Account deleted!' => 'Konto gelöscht!',
'Account for fees' => 'Konto für Gebühren',
'Account for interest' => 'Konto für Zinsen',
'Account number' => 'Kontonummer',
'Add Follow-Up for #1' => 'Wiedervorlage für #1 erstellen',
'Add General Ledger Transaction' => 'Dialogbuchen',
'Add Group' => 'Warengruppe erfassen',
- 'Add Language' => 'Sprache hinzufügen',
+ 'Add Language' => 'Sprache hinzufügen',
'Add Lead' => 'Kundenquelle erfassen',
'Add License' => 'Lizenz erfassen',
'Add Part' => 'Ware erfassen',
- 'Add Payment Terms' => 'Zahlungskonditionen hinzufügen',
+ 'Add Payment Terms' => 'Zahlungskonditionen hinzufügen',
'Add Price Factor' => 'Preisfaktor erfassen',
'Add Pricegroup' => 'Preisgruppe erfassen',
- 'Add Printer' => 'Drucker hinzufügen',
+ 'Add Printer' => 'Drucker hinzufügen',
'Add Project' => 'Projekt erfassen',
'Add Purchase Delivery Order' => 'Lieferschein (Einkauf) erfassen',
'Add Purchase Order' => 'Lieferantenauftrag erfassen',
'Add Sales Invoice' => 'Rechnung erfassen',
'Add Sales Order' => 'Auftrag erfassen',
'Add Service' => 'Dienstleistung erfassen',
- 'Add Storno Credit Note' => 'Gutschrift Storno hinzufügen',
+ 'Add Storno Credit Note' => 'Gutschrift Storno hinzufügen',
'Add Transaction' => 'Dialogbuchen',
'Add User' => 'Neuer Benutzer',
'Add Vendor' => 'Lieferant erfassen',
'Add bank account' => 'Bankkonto erfassen',
'Add custom variable' => 'Benutzerdefinierte Variable erfassen',
'Add note' => 'Notiz erfassen',
- 'Add to group' => 'Zu Gruppe hinzufügen',
+ 'Add to group' => 'Zu Gruppe hinzufügen',
'Add unit' => 'Einheit hinzufügen',
'Address' => 'Adresse',
'Administration' => 'Administration',
'All Datasets up to date!' => 'Alle Datenbanken sind auf aktuellem Stand.',
'All changes in that file have been reverted.' => 'Alle Änderungen in dieser Datei wurden rückgängig gemacht.',
'All database upgrades have been applied.' => 'Alle Datenbankupdates wurden eingespielt.',
- 'All general ledger entries' => 'Alle Hauptbucheinträge',
- 'All of the exports you have selected were already closed.' => 'Alle von Ihnen ausgewählten Exporte sind bereits abgeschlossen.',
+ 'All general ledger entries' => 'Alle Hauptbucheinträge',
+ 'All of the exports you have selected were already closed.' => 'Alle von Ihnen ausgewählten Exporte sind bereits abgeschlossen.',
'All reports' => 'Alle Berichte (Kontenübersicht, Summen- u. Saldenliste, GuV, BWA, Bilanz, Projektbuchungen)',
- 'All the selected exports have already been closed, or all of their items have already been executed.' => 'Alle ausgewählten Exporte sind als abgeschlossen markiert, oder für alle Einträge wurden bereits Zahlungen verbucht.',
+ 'All the selected exports have already been closed, or all of their items have already been executed.' => 'Alle ausgewählten Exporte sind als abgeschlossen markiert, oder für alle Einträge wurden bereits Zahlungen verbucht.',
'Allow access' => 'Zugriff erlauben',
'Allow the following users access to my follow-ups:' => 'Erlaube den folgenden Benutzern Zugriff auf meine Wiedervorlagen:',
'Alternatively you can create a new part which will then be selected.' => 'Sie können auch einen neuen Artikel anlegen, der dann automatisch ausgewählt wird.',
'Alternatively you can skip this step and create groups yourself.' => 'Alternativ können Sie diesen Schritt überspringen und selber Gruppen anlegen.',
'Amended Advance Turnover Tax Return' => 'Berichtigte Anmeldung',
- 'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
+ 'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
'Amount' => 'Betrag',
- 'Amount Due' => 'Betrag fällig',
+ 'Amount Due' => 'Betrag fällig',
'Amount has to be greater then zero! Wrong row number: ' => 'Leere Eingabe oder Werte kleiner, gleich null eingegeben. Fehler in Reihe Nummer: ',
'Annotations' => 'Anmerkungen',
'Another user with the login #1 does already exist.' => 'Es existiert bereits ein anderer Benutzer mit diesem Login.',
'Ap aging on %s' => 'Offene Verbindlichkeiten zum %s',
'Application Error. No Format given' => 'Fehler in der Anwendung. Das Ausgabeformat fehlt.',
'Application Error. Wrong Format' => 'Fehler in der Anwendung. Falsches Format: ',
- 'Applying #1:' => 'Führe #1 aus:',
- 'Approximately #1 prices will be updated.' => 'Ungefähr #1 Preise werden aktualisiert.',
+ 'Applying #1:' => 'Führe #1 aus:',
+ 'Approximately #1 prices will be updated.' => 'Ungefähr #1 Preise werden aktualisiert.',
'Apr' => 'Apr',
'April' => 'April',
'Ar aging on %s' => 'Offene Forderungen zum %s',
'Are you sure you want to delete Delivery Order Number #1?' => 'Sind Sie sicher, dass Sie Lieferschein #1 löschen wollen?',
- 'Are you sure you want to delete Invoice Number' => 'Soll die Rechnung mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Order Number' => 'Soll der Auftrag mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Quotation Number' => 'Sind Sie sicher, dass Angebotnummer gelöscht werden soll?',
- 'Are you sure you want to delete Transaction' => 'Buchung wirklich löschen?',
- 'Are you sure you want to remove the marked entries from the queue?' => 'Sind Sie sicher, dass die markierten Einträge von der Warteschlange gelöscht werden sollen?',
+ 'Are you sure you want to delete Invoice Number' => 'Soll die Rechnung mit folgender Nummer wirklich gelöscht werden:',
+ 'Are you sure you want to delete Order Number' => 'Soll der Auftrag mit folgender Nummer wirklich gelöscht werden:',
+ 'Are you sure you want to delete Quotation Number' => 'Sind Sie sicher, dass Angebotnummer gelöscht werden soll?',
+ 'Are you sure you want to delete Transaction' => 'Buchung wirklich löschen?',
+ 'Are you sure you want to remove the marked entries from the queue?' => 'Sind Sie sicher, dass die markierten Einträge von der Warteschlange gelöscht werden sollen?',
'Are you sure you want to update the prices' => 'Sind Sie sicher, dass Sie die Preise aktualisieren wollen?',
- 'Article Code' => 'Artikelkürzel',
- 'Article Code missing!' => 'Artikelkürzel fehlt',
+ 'Article Code' => 'Artikelkürzel',
+ 'Article Code missing!' => 'Artikelkürzel fehlt',
'As a result, the saved onhand values of the present goods can be stored into a warehouse designated by you, or will be reset for a proper warehouse tracking' => 'Als Konsequenz können die gespeicherten Mengen entweder in ein Lager überführt werden, oder für eine frische Lagerverwaltung resettet werden.',
'Assemblies' => 'Erzeugnisse',
'Assembly Description' => 'Erzeugnis-Beschreibung',
'Assets' => 'Aktiva',
'Assign new units' => 'Neue Einheiten zuweisen',
'Assign units' => 'Einheiten zuweisen',
- 'Assistant for general ledger corrections' => 'Assistent für die Korrektur von Hauptbucheinträgen',
- 'Assume Tax Consultant Data in Tax Computation?' => 'Beraterdaten in UStVA übernehmen?',
+ 'Assistant for general ledger corrections' => 'Assistent für die Korrektur von Hauptbucheinträgen',
+ 'Assume Tax Consultant Data in Tax Computation?' => 'Beraterdaten in UStVA übernehmen?',
'At least' => 'Mindestens',
'At least one Perl module that Lx-Office ERP requires for running is not installed on your system.' => 'Mindestes ein Perl-Modul, das Lx-Office ERP zur Ausführung benötigt, ist auf Ihrem System nicht installiert.',
'At most' => 'Höchstens',
'At the moment the transaction looks like this:' => 'Aktuell sieht die Buchung wie folgt aus:',
- 'Attach PDF:' => 'PDF anhängen',
+ 'Attach PDF:' => 'PDF anhängen',
'Attachment' => 'als Anhang',
'Attachment name' => 'Name des Anhangs',
'Attempt to call an undefined sub named \'%s\'' => 'Es wurde versucht, eine nicht definierte Unterfunktion namens \'%s\' aufzurufen.',
- 'Audit Control' => 'Bücherkontrolle',
+ 'Audit Control' => 'Bücherkontrolle',
'Aug' => 'Aug',
'August' => 'August',
'Authentification database creation' => 'Anlegen der Datenbank zur Benutzerauthentifizierung',
'Authentification tables creation' => 'Anlegen der Tabellen zur Benutzerauthentifizierung',
'Auto Send?' => 'Auto. Versand?',
- 'Automatically created invoice for fee and interest for dunning %s' => 'Automatisch erzeugte Rechnung für Gebühren und Zinsen zu Mahnung %s',
+ 'Automatically created invoice for fee and interest for dunning %s' => 'Automatisch erzeugte Rechnung für Gebühren und Zinsen zu Mahnung %s',
'Available qty' => 'Lagerbestand',
'BALANCE SHEET' => 'BILANZ',
'BIC' => 'BIC',
- 'BOM' => 'Stückliste',
+ 'BOM' => 'Stückliste',
'BWA' => 'BWA',
- 'Back' => 'Zurück',
+ 'Back' => 'Zurück',
'Backup Dataset' => 'Datenbank sichern',
'Backup file' => 'Sicherungsdatei',
'Backup of dataset' => 'Sicherung der Datenbank',
'Bank accounts' => 'Bankkonten',
'Bank code' => 'Bankleitzahl',
'Bank collection amount' => 'Einzugsbetrag',
- 'Bank collection payment list for export #1' => 'Bankeinzugszahlungsliste für SEPA-Export #1',
+ 'Bank collection payment list for export #1' => 'Bankeinzugszahlungsliste für SEPA-Export #1',
'Bank collection via SEPA' => 'Bankeinzug via SEPA',
- 'Bank collections via SEPA' => 'Bankeinzüge via SEPA',
- 'Bank transfer amount' => 'Überweisungssumme',
- 'Bank transfer payment list for export #1' => 'Überweisungszahlungsliste für SEPA-Export #1',
- 'Bank transfer via SEPA' => 'Überweisung via SEPA',
- 'Bank transfers via SEPA' => 'Überweisungen via SEPA',
+ 'Bank collections via SEPA' => 'Bankeinzüge via SEPA',
+ 'Bank transfer amount' => 'Überweisungssumme',
+ 'Bank transfer payment list for export #1' => 'Überweisungszahlungsliste für SEPA-Export #1',
+ 'Bank transfer via SEPA' => 'Überweisung via SEPA',
+ 'Bank transfers via SEPA' => 'Überweisungen via SEPA',
'Base unit' => 'Basiseinheit',
'Basic Data' => 'Basisdaten',
'Batch Printing' => 'Druck',
'Bilanz' => 'Bilanz',
'Billing Address' => 'Rechnungsadresse',
'Billing/shipping address (city)' => 'Rechnungsadresse (Stadt)',
- 'Billing/shipping address (street)' => 'Rechnungsadresse (Straße)',
+ 'Billing/shipping address (street)' => 'Rechnungsadresse (Straße)',
'Billing/shipping address (zipcode)' => 'Rechnungsadresse (PLZ)',
'Bin' => 'Lagerplatz',
'Bin From' => 'Quelllagerplatz',
'Bis Konto: ' => 'bis Konto: ',
'Body' => 'Text',
'Body:' => 'Text:',
- 'Books are open' => 'Die Bücher sind geöffnet.',
- 'Books closed up to' => 'Bücher abgeschlossen bis zum',
+ 'Books are open' => 'Die Bücher sind geöffnet.',
+ 'Books closed up to' => 'Bücher abgeschlossen bis zum',
'Boolean variables: If the default value is non-empty then the checkbox will be checked by default and unchecked otherwise.' => 'Ja/Nein-Variablen: Wenn der Standardwert nicht leer ist, so wird die Checkbox standardmäßig angehakt.',
'Both' => 'Beide',
'Bottom' => 'Unten',
'Buchungskonto' => 'Buchungskonto',
'Buchungsnummer' => 'Buchungsnummer',
'Business Number' => 'Firmennummer',
- 'Business Volume' => 'Geschäftsvolumen',
- 'Business deleted!' => 'Firma gelöscht.',
+ 'Business Volume' => 'Geschäftsvolumen',
+ 'Business deleted!' => 'Firma gelöscht.',
'Business evaluation' => 'Betriebswirtschaftliche Auswertung',
'Business saved!' => 'Firma gespeichert.',
'CANCELED' => 'Storniert',
'CRM user' => 'Admin Benutzer',
'CSV export -- options' => 'CSV-Export -- Optionen',
'Calculate' => 'Berechnen',
- 'Can not create that quantity with current stock' => 'Diese Anzahl kann mit dem gegenwärtigen Lagerbestand nicht hergestellt werden.',
+ 'Can not create that quantity with current stock' => 'Diese Anzahl kann mit dem gegenwärtigen Lagerbestand nicht hergestellt werden.',
'Cancel' => 'Abbrechen',
'Cancel Accounts Payables Transaction' => 'Kreditorenbuchung stornieren',
'Cancel Accounts Receivables Transaction' => 'Debitorenbuchung stornieren',
'Cannot create Lock!' => 'System kann nicht gesperrt werden!',
- 'Cannot delete account!' => 'Konto kann nicht gelöscht werden!',
- 'Cannot delete customer!' => 'Kunde kann nicht gelöscht werden!',
- 'Cannot delete default account!' => 'Das Standard-Konto kann nicht gelöscht werden!',
+ 'Cannot delete account!' => 'Konto kann nicht gelöscht werden!',
+ 'Cannot delete customer!' => 'Kunde kann nicht gelöscht werden!',
+ 'Cannot delete default account!' => 'Das Standard-Konto kann nicht gelöscht werden!',
'Cannot delete delivery order!' => 'Lieferschein kann nicht gelöscht werden!',
- 'Cannot delete invoice!' => 'Rechnung kann nicht gelöscht werden!',
- 'Cannot delete item!' => 'Artikel kann nicht gelöscht werden!',
- 'Cannot delete order!' => 'Auftrag kann nicht gelöscht werden!',
- 'Cannot delete quotation!' => 'Angebot kann nicht gelöscht werden!',
- 'Cannot delete transaction!' => 'Buchung kann nicht gelöscht werden!',
- 'Cannot delete vendor!' => 'Lieferant kann nicht gelöscht werden!',
+ 'Cannot delete invoice!' => 'Rechnung kann nicht gelöscht werden!',
+ 'Cannot delete item!' => 'Artikel kann nicht gelöscht werden!',
+ 'Cannot delete order!' => 'Auftrag kann nicht gelöscht werden!',
+ 'Cannot delete quotation!' => 'Angebot kann nicht gelöscht werden!',
+ 'Cannot delete transaction!' => 'Buchung kann nicht gelöscht werden!',
+ 'Cannot delete vendor!' => 'Lieferant kann nicht gelöscht werden!',
'Cannot have a value in both Debit and Credit!' => 'Es kann nicht gleichzeitig Soll und Haben gebucht werden!',
'Cannot post Payment!' => 'Zahlung kann nicht gebucht werden!',
'Cannot post Receipt!' => 'Beleg kann nicht gebucht werden!',
'Cannot post a transaction without a value!' => 'Eine Buchung ohne Betrag kann nicht vorgenommen werden!',
- 'Cannot post invoice for a closed period!' => 'Das Rechnungsdatum fällt in einen abgeschlossen Zeitraum!',
+ 'Cannot post invoice for a closed period!' => 'Das Rechnungsdatum fällt in einen abgeschlossen Zeitraum!',
'Cannot post invoice!' => 'Rechnung kann nicht gebucht werden!',
- 'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
+ 'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
'Cannot post payment!' => 'Zahlung kann nicht gebucht werden!',
- 'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
+ 'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
'Cannot post transaction with a debit and credit entry for the same account!' => 'Kann Soll und Haben nicht auf dasselbe Konto buchen!',
'Cannot post transaction!' => 'Rechnung kann nicht gebucht werden!',
'Cannot process payment for a closed period!' => 'Es kann keine Zahlung in einem abgeschlossenen Zeitraum verbucht werden!',
- 'Cannot remove files!' => 'Dateien können nicht gelöscht werden!',
+ 'Cannot remove files!' => 'Dateien können nicht gelöscht werden!',
'Cannot save account!' => 'Konto kann nicht gespeichert werden!',
'Cannot save order!' => 'Auftrag kann nicht gespeichert werden!',
- 'Cannot save preferences!' => 'Einstellungen können nicht gespeichert werden!',
+ 'Cannot save preferences!' => 'Einstellungen können nicht gespeichert werden!',
'Cannot save quotation!' => 'Angebot kann nicht gespeichert werden!',
'Cannot storno storno invoice!' => 'Kann eine Stornorechnung nicht stornieren',
'Carry over shipping address' => 'Lieferadresse übernehmen',
'Cash' => 'Zahlungsverkehr',
'Cc' => 'Cc',
'Change Lx-Office installation settings (all menu entries beneath \'System\')' => 'Verändern der Lx-Office-Installationseinstellungen (Menüpunkte unterhalb von \'System\')',
- 'Change representative to' => 'Vertreter ändern in',
+ 'Change representative to' => 'Vertreter ändern in',
'Charge Number' => 'Chargennummer',
'Charge number' => 'Chargennummer',
'Chart' => 'Buchungskonto',
'Chart Type' => 'Kontentyp',
'Chart balance' => 'Kontensaldo',
- 'Chart of Accounts' => 'Kontenübersicht',
+ 'Chart of Accounts' => 'Kontenübersicht',
'Chart of accounts' => 'Kontenrahmen',
- 'Chartaccounts connected to this Tax:' => 'Konten, die mit dieser Steuer verknüpft sind:',
+ 'Chartaccounts connected to this Tax:' => 'Konten, die mit dieser Steuer verknüpft sind:',
'Check' => 'Scheck',
- 'Check Details' => 'Bitte Angaben überprüfen',
+ 'Check Details' => 'Bitte Angaben überprüfen',
'Checks' => 'Schecks',
- 'Choose Customer' => 'Endkunde wählen:',
- 'Choose Outputformat' => 'Ausgabeformat auswählen...',
- 'Choose Vendor' => 'Händler wählen',
+ 'Choose Customer' => 'Endkunde wählen:',
+ 'Choose Outputformat' => 'Ausgabeformat auswählen...',
+ 'Choose Vendor' => 'Händler wählen',
'Choose a Tax Number' => 'Bitte eine Steuernummer angeben',
'City' => 'Stadt',
'Cleared Balance' => 'abgeschlossen',
- 'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
+ 'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
'Click on login name to edit!' => 'Zum Bearbeiten den Benutzernamen anklicken!',
- 'Close' => 'Übernehmen',
- 'Close Books up to' => 'Die Bücher abschließen bis zum',
- 'Close SEPA exports' => 'SEPA-Export abschließen',
+ 'Close' => 'Übernehmen',
+ 'Close Books up to' => 'Die Bücher abschließen bis zum',
+ 'Close SEPA exports' => 'SEPA-Export abschließen',
'Close Window' => 'Fenster Schließen',
'Closed' => 'Geschlossen',
- 'Collective Orders only work for orders from one customer!' => 'Sammelaufträge funktionieren nur für Aufträge von einem Kunden!',
+ 'Collective Orders only work for orders from one customer!' => 'Sammelaufträge funktionieren nur für Aufträge von einem Kunden!',
'Comment' => 'Kommentar',
'Company' => 'Firma',
'Company Name' => 'Firmenname',
- 'Compare to' => 'Gegenüberstellen zu',
+ 'Compare to' => 'Gegenüberstellen zu',
'Configuration of individual TODO items' => 'Konfiguration für die einzelnen Aufgabenlistenpunkte',
'Confirm' => 'Bestätigen',
- 'Confirm!' => 'Bestätigen Sie!',
- 'Confirmation' => 'Auftragsbestätigung',
+ 'Confirm!' => 'Bestätigen Sie!',
+ 'Confirmation' => 'Auftragsbestätigung',
'Contact' => 'Kontakt',
'Contact Person' => 'Ansprechpartner',
'Contact person (surname)' => 'Ansprechpartner (Nachname)',
'Continue' => 'Weiter',
'Contra' => 'gegen',
'Copies' => 'Kopien',
- 'Correct taxkey' => 'Richtiger Steuerschlüssel',
+ 'Correct taxkey' => 'Richtiger Steuerschlüssel',
'Corrections' => 'Korrekturen',
'Cost Center' => 'Kostenstelle',
'Costs' => 'Kosten',
'Create and edit vendor invoices' => 'Eingangsrechnungen erfassen und bearbeiten',
'Create bank collection' => 'Bankeinzug erstellen',
'Create bank collection via SEPA XML' => 'Bankeinzug via SEPA XML erstellen',
- 'Create bank transfer' => 'Überweisung erstellen',
- 'Create bank transfer via SEPA XML' => 'Überweisung via SEPA XML erzeugen',
+ 'Create bank transfer' => 'Überweisung erstellen',
+ 'Create bank transfer via SEPA XML' => 'Überweisung via SEPA XML erzeugen',
'Create invoice?' => 'Rechnung erstellen?',
'Create new' => 'Neu erfassen',
'Create tables' => 'Tabellen anlegen',
'Credit (one letter abbreviation)' => 'H',
'Credit Account' => 'Habenkonto',
'Credit Limit' => 'Kreditlimit',
- 'Credit Limit exceeded!!!' => 'Kreditlimit überschritten!',
+ 'Credit Limit exceeded!!!' => 'Kreditlimit überschritten!',
'Credit Note' => 'Gutschrift',
'Credit Note Date' => 'Gutschriftdatum',
'Credit Note Number' => 'Gutschriftnummer',
'Credit Tax' => 'Umsatzsteuer',
'Credit Tax Account' => 'Umsatzsteuerkonto',
'Credit note (one letter abbreviation)' => 'G',
- 'Curr' => 'Währung',
+ 'Curr' => 'Währung',
'Currencies' => 'Währungen',
- 'Currency' => 'Währung',
- 'Current / Next Level' => 'Aktuelles / Nächstes Mahnlevel',
+ 'Currency' => 'Währung',
+ 'Current / Next Level' => 'Aktuelles / Nächstes Mahnlevel',
'Current Earnings' => 'Gewinn',
+ 'Current assets account' => 'Konto für Umlaufvermögen',
'Current unit' => 'Aktuelle Einheit',
'Current value:' => 'Aktueller Wert:',
'Custom Variables' => 'Benutzerdefinierte Variablen',
- 'Custom variables for module' => 'Benutzerdefinierte Variablen für Modul',
+ 'Custom variables for module' => 'Benutzerdefinierte Variablen für Modul',
'Customer' => 'Kunde',
'Customer Name' => 'Kundenname',
'Customer Number' => 'Kundennummer',
'Customer Order Number' => 'Bestellnummer des Kunden',
- 'Customer deleted!' => 'Kunde gelöscht!',
+ 'Customer deleted!' => 'Kunde gelöscht!',
'Customer details' => 'Kundendetails',
'Customer missing!' => 'Kundenname fehlt!',
'Customer not on file or locked!' => 'Dieser Kunde existiert nicht oder ist gesperrt.',
'Customernumberinit' => 'Kunden-/Lieferantennummernkreis',
'Customers' => 'Kunden',
'Customers and vendors' => 'Kunden und Lieferanten',
- 'Customized Report' => 'Vorgewählte Zeiträume',
+ 'Customized Report' => 'Vorgewählte Zeiträume',
'DATEV - Export Assistent' => 'DATEV-Exportassistent',
'DATEV Angaben' => 'DATEV-Angaben',
'DATEV Export' => 'DATEV-Export',
'DATEX - Export Assistent' => 'DATEV-Exportassistent',
- 'DELETED' => 'Gelöscht',
+ 'DELETED' => 'Gelöscht',
'DFV-Kennzeichen' => 'DFV-Kennzeichen',
'DR' => 'S',
'DUNNING STARTED' => 'Mahnprozess gestartet',
'Debit Starting Balance' => 'EB Passiva',
'Debit Tax' => 'Vorsteuer',
'Debit Tax Account' => 'Vorsteuerkonto',
- 'Debit and credit out of balance!' => 'Soll und Haben müssen gleich sein.',
+ 'Debit and credit out of balance!' => 'Soll und Haben müssen gleich sein.',
'Dec' => 'Dez',
'December' => 'Dezember',
'Decimalplaces' => 'Dezimalstellen',
'Decrease' => 'Verringern',
- 'Default (no language selected)' => 'Standard (keine Sprache ausgewählt)',
+ 'Default (no language selected)' => 'Standard (keine Sprache ausgewählt)',
'Default Accounts' => 'Standardkonten',
'Default output medium' => 'Standardausgabekanal',
'Default printer' => 'Standarddrucker',
'Default template format' => 'Standardvorlagenformat',
'Default value' => 'Standardwert',
'Defaults saved.' => 'Die Standardeinstellungen wurden gespeichert.',
- 'Delete' => 'Löschen',
- 'Delete Account' => 'Konto löschen',
- 'Delete Contact' => 'Ansprechpartner löschen',
- 'Delete Dataset' => 'Datenbank löschen',
- 'Delete Shipto' => 'Lieferadresse löschen',
+ 'Delete' => 'Löschen',
+ 'Delete Account' => 'Konto löschen',
+ 'Delete Contact' => 'Ansprechpartner löschen',
+ 'Delete Dataset' => 'Datenbank löschen',
+ 'Delete Shipto' => 'Lieferadresse löschen',
'Delete delivery order' => 'Lieferschein löschen',
- 'Delete drafts' => 'Entwürfe löschen',
+ 'Delete drafts' => 'Entwürfe löschen',
'Delete group' => 'Gruppe löschen',
- 'Delete transaction' => 'Buchung löschen',
+ 'Delete transaction' => 'Buchung löschen',
'Delivered' => 'Geliefert',
'Delivery Date' => 'Lieferdatum',
'Delivery Order' => 'Lieferschein',
'Delivery Orders' => 'Lieferscheine',
'Department' => 'Abteilung',
'Department Id' => 'Abteilungsnummer',
- 'Department deleted!' => 'Abteilung gelöscht.',
+ 'Department deleted!' => 'Abteilung gelöscht.',
'Department saved!' => 'Abteilung gespeichert.',
'Departments' => 'Abteilungen',
'Dependency loop detected:' => 'Schleife in den Abhängigkeiten entdeckt:',
'Deposit' => 'Gutschrift',
'Description' => 'Beschreibung',
- 'Description (Click on Description for details)' => 'Beschreibung (Klick öffnet einzelne Kontendetails)',
+ 'Description (Click on Description for details)' => 'Beschreibung (Klick öffnet einzelne Kontendetails)',
'Description missing!' => 'Beschreibung fehlt.',
'Description must not be empty!' => 'Beschreibung darf nicht leer sein',
'Destination BIC' => 'Ziel-BIC',
'Display' => 'Anzeigen',
'Display file' => 'Datei anzeigen',
'Display options' => 'Anzeigeoptionen',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank collections that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to delete AP transaction #1?' => 'Wollen Sie wirklich die Kreditorenbuchung #1 löschen?',
- 'Do you really want to delete AR transaction #1?' => 'Wollen Sie wirklich die Debitorenbuchung #1 löschen?',
- 'Do you really want to delete GL transaction #1?' => 'Wollen Sie wirklich die Dialogbuchung #1 löschen?',
+ 'Do you really want to close the following SEPA exports? No payment will be recorded for bank collections that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
+ 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
+ 'Do you really want to delete AP transaction #1?' => 'Wollen Sie wirklich die Kreditorenbuchung #1 löschen?',
+ 'Do you really want to delete AR transaction #1?' => 'Wollen Sie wirklich die Debitorenbuchung #1 löschen?',
+ 'Do you really want to delete GL transaction #1?' => 'Wollen Sie wirklich die Dialogbuchung #1 löschen?',
'Do you really want to delete this group?' => 'Gruppe wirklich löschen?',
+ 'Do you really want to delete this object?' => 'Wollen Sie dieses Objekt wirklich löschen?',
'Do you really want to delete this warehouse?' => 'Wollen Sie dieses Lager wirklich löschen?',
'Do you want Lx-Office to create a group for access to all functions?' => 'Wollen Sie, dass Lx-Office eine Gruppe mit Zugriff auf alle Funktionen anlegt?',
'Do you want to <b>limit</b> your search?' => 'Wollen Sie Ihre Suche <b>spezialisieren</b>?',
'Drawing' => 'Zeichnung',
'Driver' => 'Treiber',
'Dropdown Limit' => 'Auswahllistenbegrenzung',
- 'Due' => 'Fällig',
- 'Due Date' => 'Fälligkeitsdatum',
- 'Due Date missing!' => 'Fälligkeitsdatum fehlt!',
- 'Duedate +Days' => 'Fällikeitsdatum +Tage',
+ 'Due' => 'Fällig',
+ 'Due Date' => 'Fälligkeitsdatum',
+ 'Due Date missing!' => 'Fälligkeitsdatum fehlt!',
+ 'Duedate +Days' => 'Fällikeitsdatum +Tage',
'Dunning' => 'Mahnung',
'Dunning Amount' => 'gemahnter Betrag',
'Dunning Date' => 'Mahndatum',
'Dunning Level' => 'Mahnlevel',
'Dunning Level missing in row ' => 'Mahnlevel fehlt in ',
'Dunning Process Config saved!' => 'Mahnwesenkonfiguration gespeichert!',
- 'Dunning Process started for selected invoices!' => 'Mahnprozess für selektierte Rechnungen gestartet',
+ 'Dunning Process started for selected invoices!' => 'Mahnprozess für selektierte Rechnungen gestartet',
'Dunning number' => 'Mahnungsnummer',
- 'Dunning overview' => 'Mahnungsübersicht',
+ 'Dunning overview' => 'Mahnungsübersicht',
'Dunnings' => 'Mahnungen',
'During this user migration Lx-Office can create such a group for you and grant all users access to all of Lx-Office\'s functions.' => 'Im Rahmen dieser Benutzerdatenmigration kann Lx-Office eine solche Gruppe für Sie anlegen und allen Benutzern Zugriff auf alle Lx-Office-Funktionen gewähren.',
'E-mail' => 'eMail',
- 'E-mail Statement to' => 'Fälligkeitsabrechnung als eMail an',
+ 'E-mail Statement to' => 'Fälligkeitsabrechnung als eMail an',
'E-mail address missing!' => 'E-Mail-Adresse fehlt!',
'EAN' => 'EAN',
'EAN-Code' => 'EAN-Code',
'EQUITY' => 'EIGENTUM',
'EU with VAT ID' => 'EU mit UstId-Nummer',
'EU without VAT ID' => 'EU ohne UstId-Nummer',
- 'EUER' => 'Einnahmen-/Überschussrechnung',
- 'EUR' => 'E/Ü-Rechnung',
- 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => 'Frühere Versionen von Lx-Office enthielten Bugs, die zu falschen Einträgen im Hauptbuch geführt haben können.',
+ 'EUER' => 'Einnahmen-/Überschussrechnung',
+ 'EUR' => 'E/Ü-Rechnung',
+ 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => 'Frühere Versionen von Lx-Office enthielten Bugs, die zu falschen Einträgen im Hauptbuch geführt haben können.',
'Edit' => 'Bearbeiten',
'Edit Access Rights' => 'Zugriffsrechte bearbeiten',
'Edit Access Rights for Follow-Ups' => 'Zugriff auf meine Wiedervorlagen regeln',
'Edit Purchase Order' => 'Lieferantenaufrag bearbeiten',
'Edit Quotation' => 'Angebot bearbeiten',
'Edit Request for Quotation' => 'Anfrage bearbeiten',
- 'Edit SEPA strings' => 'Begriffe bei SEPA-Überweisungen bearbeiten',
+ 'Edit SEPA strings' => 'Begriffe bei SEPA-Überweisungen bearbeiten',
'Edit Sales Delivery Order' => 'Lieferschein (Verkauf) bearbeiten',
'Edit Sales Invoice' => 'Rechnung bearbeiten',
'Edit Sales Order' => 'Auftrag bearbeiten',
'Edit the stylesheet' => 'Stilvorlage bearbeiten',
'Edit units' => 'Einheiten bearbeiten',
'Editable' => 'Bearbeitbar',
- 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => 'Entweder gibt es keine offenen Rechnungen, oder es wurden bereits Überweisungen über die offenen Beträge aller offenen Rechnungen erstellt.',
+ 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => 'Entweder gibt es keine offenen Rechnungen, oder es wurden bereits Überweisungen über die offenen Beträge aller offenen Rechnungen erstellt.',
'Element disabled' => 'Element deaktiviert',
'Employee' => 'Bearbeiter',
'Empty transaction!' => 'Buchung ist leer!',
'Enter a description for this new draft.' => 'Geben Sie eine Beschreibung für diesen Entwurf ein.',
'Enter longdescription' => 'Langtext eingeben',
- 'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
+ 'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
+ 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
'Equity' => 'Passiva',
'Error' => 'Fehler',
'Error in database control file \'%s\': %s' => 'Fehler in Datenbankupgradekontrolldatei \'%s\': %s',
'Exch' => 'Wechselkurs.',
'Exchangerate' => 'Wechselkurs',
'Exchangerate Difference' => 'Wechselkursunterschied',
- 'Exchangerate for payment missing!' => 'Es fehlt der Wechselkurs für die Bezahlung!',
+ 'Exchangerate for payment missing!' => 'Es fehlt der Wechselkurs für die Bezahlung!',
'Exchangerate missing!' => 'Es fehlt der Wechselkurs!',
- 'Executed' => 'Ausgeführt',
- 'Execution date' => 'Ausführungsdatum',
- 'Execution date from' => 'Ausführungsdatum von',
- 'Execution date to' => 'Ausführungsdatum bis',
+ 'Executed' => 'Ausgeführt',
+ 'Execution date' => 'Ausführungsdatum',
+ 'Execution date from' => 'Ausführungsdatum von',
+ 'Execution date to' => 'Ausführungsdatum bis',
'Existing Buchungsgruppen' => 'Existierende Buchungsgruppen',
'Existing Datasets' => 'Existierende Datenbanken',
'Existing pending follow-ups for this item' => 'Noch nicht erledigte Wiedervorlagen für dieses Dokument',
'Export date from' => 'Exportdatum von',
'Export date to' => 'Exportdatum bis',
'Extended' => 'Gesamt',
- 'Extension Of Time' => 'Dauerfristverlängerung',
+ 'Extension Of Time' => 'Dauerfristverlängerung',
'Factor' => 'Faktor',
'Factor missing!' => 'Der Faktor fehlt.',
'Falsches Datumsformat!' => 'Falsches Datumsformat!',
- 'Favorites' => 'Favoriten (nur im XUL-Menü)',
+ 'Favorites' => 'Favoriten (nur im XUL-Menü)',
'Fax' => 'Fax',
'Feb' => 'Feb',
'February' => 'Februar',
- 'Fee' => 'Gebühr',
+ 'Fee' => 'Gebühr',
'File' => 'Datei',
'File name' => 'Dateiname',
'Files created by Lx-Office\'s "Backup Dataset" function are such files.' => 'Dateien, die von Lx-Office\' Funktion "Datenbank sichern" erstellt wurden, erfüllen diese Kriterien.',
'Follow-Up for user' => 'Wiedervorlage für Benutzer',
'Follow-Up saved.' => 'Wiedervorlage gespeichert.',
'Follow-Ups' => 'Wiedervorlagen',
- 'Follow-up for' => 'Wiedervorlage für',
+ 'Follow-up for' => 'Wiedervorlage für',
'Font' => 'Schriftart',
'Font size' => 'Schriftgröße',
- 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => 'Bei Kreditorenbuchungen werden die Umsatzsteuer-Steuerschlüssel durch Vorsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
- 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => 'Bei Debitorenbuchungen werden die Vorsteuer-Steuerschlüssel durch Umsatzsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
+ 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => 'Bei Kreditorenbuchungen werden die Umsatzsteuer-Steuerschlüssel durch Vorsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
+ 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => 'Bei Debitorenbuchungen werden die Vorsteuer-Steuerschlüssel durch Umsatzsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
'For each unit there\'s either no or exactly one base unit. If you chose a base unit then you also have to chose a factor. That way the new unit will be defined as a multiple of the base unit. The base unit must be the "smaller" one. A factor may not be less than 1. Therefore you may define "kg" with the base unit "g" and a factor of "1", but not the other way round.' => 'Einheiten haben entweder keine oder genau eine Basiseinheit, von der sie ein Vielfaches sind. Wenn Sie eine Basiseinheit auswählen, dann müssen Sie auch einen Faktor eingeben. Sie müssen Einheiten als ein Vielfaches einer kleineren Einheit eingeben. So ist die Definition von "kg" mit der Basiseinheit "g" und dem Faktor 1000 zulässig, die Definition von "g" mit der Basiseinheit "kg" und dem Faktor "0,001" hingegen nicht.',
- 'Foreign Exchange Gain' => 'Wechselkurserträge',
+ 'Foreign Exchange Gain' => 'Wechselkurserträge',
'Foreign Exchange Loss' => 'Wechselkursaufwendungen',
'Foreign Expenses' => 'Aufwand Ausland',
'Foreign Revenues' => 'Erlöse Ausland',
'Group' => 'Warengruppe',
'Group Invoices' => 'Rechnungen zusammenfassen',
'Group Items' => 'Waren gruppieren',
- 'Group deleted!' => 'Warengruppe gelöscht!',
- 'Group membership' => 'Gruppenzugehörigkeit',
+ 'Group deleted!' => 'Warengruppe gelöscht!',
+ 'Group membership' => 'Gruppenzugehörigkeit',
'Group missing!' => 'Warengruppe fehlt!',
'Group saved!' => 'Warengruppe gespeichert!',
'Groups' => 'Warengruppen',
'HTML Templates' => 'HTML-Vorlagen',
'Hardcopy' => 'Seite drucken',
'Has serial number' => 'Hat eine Serienummer',
- 'Heading' => 'Überschrift',
- 'Headings' => 'Überschriften',
+ 'Heading' => 'Überschrift',
+ 'Headings' => 'Überschriften',
'Help' => 'Hilfe',
'Help Template Variables' => 'Hilfe zu Dokumenten-Variablen',
'Here\'s an example command line:' => 'Hier ist eine Kommandozeile, die als Beispiel dient:',
'IV' => 'IV',
'If the automatic creation of invoices for fees and interest is switched on for a dunning level then the following accounts will be used for the invoice.' => 'Wenn das automatische Erstellen einer Rechnung über Mahngebühren und Zinsen für ein Mahnlevel aktiviert ist, so werden die folgenden Konten für die Rechnung benutzt.',
'If the database user listed above does not have the right to create a database then enter the name and password of the superuser below:' => 'Falls der oben genannte Datenbankbenutzer nicht die Berechtigung zum Anlegen neuer Datenbanken hat, so können Sie hier den Namen und das Passwort des Datenbankadministratoraccounts angeben:',
- 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => 'Falls Sie sich entscheiden, Lx-Office die Migration durchführen zu lassen, so wird Lx-Office ein Backup der alten Dateien im Verzeichnis "#1" erstellen und die Dateien anschließend löschen.',
+ 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => 'Falls Sie sich entscheiden, Lx-Office die Migration durchführen zu lassen, so wird Lx-Office ein Backup der alten Dateien im Verzeichnis "#1" erstellen und die Dateien anschließend löschen.',
'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => 'Wenn Sie für die Artikelnummer und / oder die Beschreibung etwas eingeben, so werden nur die Lagerplätze angezeigt, in denen Waren eingelagert sind, die Ihre Suchbegriffe enthalten.',
'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => 'Wenn Sie diese Meldung sehen haben Sie wahrscheinlich ein frisches LX-Office Setup und noch keine Buchungsgruppen eingerichtet. Ein Administrator kann dies im Systemmenü erledigen.',
'If you want to change any of these parameters then press the "Back" button, edit the file "config/authentication.pl" and login into the admin module again.' => 'Wenn Sie einen der Parameter ändern wollen, so drücken Sie auf den "Zurück"-Button, bearbeiten Sie die Datei "config/authentication.pl", und melden Sie sich erneut im Administrationsbereich an.',
'Image' => 'Grafik',
'Import CSV' => 'CSV-Import',
'In Lx-Office 2.4.0 the administrator has to enter a list of units in the administrative section.' => 'In Lx-Office 2.4.0 muss der Administrator in den Systemeinstellungen eine Liste von verwendbaren Einheiten angeben.',
- 'In order to do that hit the button "Delete transaction".' => 'Drücken Sie dafür auf den Button "Buchung löschen".',
- 'In the latter case the tables needed by Lx-Office will be created in that database.' => 'In letzterem Fall werden die von Lx-Office benötigten Tabellen in dieser existierenden Datenbank angelegt.',
+ 'In order to do that hit the button "Delete transaction".' => 'Drücken Sie dafür auf den Button "Buchung löschen".',
+ 'In the latter case the tables needed by Lx-Office will be created in that database.' => 'In letzterem Fall werden die von Lx-Office benötigten Tabellen in dieser existierenden Datenbank angelegt.',
'In-line' => 'im Text',
'Inactive' => 'Inaktiv',
'Include Exchangerate Difference' => 'Wechselkursunterschied einbeziehen',
'Include column headings' => 'Spaltenüberschriften erzeugen',
'Include empty bins' => 'Leere Lagerplätze anzeigen',
'Include in Report' => 'In Bericht aufnehmen',
- 'Include in drop-down menus' => 'In Aufklappmenü aufnehmen',
+ 'Include in drop-down menus' => 'In Aufklappmenü aufnehmen',
'Includeable in reports' => 'In Berichten anzeigbar',
'Income Statement' => 'GuV',
'Income accno' => 'Erlöskonto',
- 'Incoming Payments' => 'Zahlungseingänge',
+ 'Incoming Payments' => 'Zahlungseingänge',
'Incoming invoice number' => 'Eingangsrechnungsnummer',
- 'Incorrect Password!' => 'Ungültiges Passwort!',
- 'Incorrect username or password!' => 'Ungültiger Benutzername oder falsches Passwort!',
- 'Increase' => 'Erhöhen',
+ 'Incorrect Password!' => 'Ungültiges Passwort!',
+ 'Incorrect username or password!' => 'Ungültiger Benutzername oder falsches Passwort!',
+ 'Increase' => 'Erhöhen',
'Individual Items' => 'Einzelteile',
'Information' => 'Information',
'Interest' => 'Zinsen',
'Internet' => 'Internet',
'Introduction of Buchungsgruppen' => 'Einführung von Buchungsgruppen',
'Introduction of units' => 'Einführung von Einheiten',
- 'Inv. Duedate' => 'Rg. Fälligkeit',
+ 'Inv. Duedate' => 'Rg. Fälligkeit',
'Invalid' => 'Ungültig',
'Invalid follow-up ID.' => 'Ungültige Wiedervorlage-ID.',
'Invalid quantity.' => 'Die Mengenangabe ist ungültig.',
'Invdate from' => 'Rechnungen von',
'Inventory' => 'Inventar',
'Inventory Account' => 'Warenbestand',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'Bevor dieses Erzeugnis als ungültig markiert werden kann, muß das Inventar auf Null sein!',
- 'Inventory quantity must be zero before you can set this part obsolete!' => 'Bevor diese Ware als ungültig markiert werden kann, muß das Inventar Null sein!',
+ 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'Bevor dieses Erzeugnis als ungültig markiert werden kann, muß das Inventar auf Null sein!',
+ 'Inventory quantity must be zero before you can set this part obsolete!' => 'Bevor diese Ware als ungültig markiert werden kann, muß das Inventar Null sein!',
'Invno.' => 'Rg. Nr.',
'Invnumber' => 'Rechnungsnummer',
'Invnumber missing!' => 'Rechnungsnummer fehlt!',
'Invoice (one letter abbreviation)' => 'R',
'Invoice Date' => 'Rechnungsdatum',
'Invoice Date missing!' => 'Rechnungsdatum fehlt!',
- 'Invoice Duedate' => 'Fälligkeitsdatum',
+ 'Invoice Duedate' => 'Fälligkeitsdatum',
'Invoice Number' => 'Rechnungsnummer',
'Invoice Number missing!' => 'Rechnungsnummer fehlt!',
- 'Invoice deleted!' => 'Rechnung gelöscht!',
- 'Invoice for fees' => 'Rechnung über Gebühren',
+ 'Invoice deleted!' => 'Rechnung gelöscht!',
+ 'Invoice for fees' => 'Rechnung über Gebühren',
'Invoice has already been storno\'d!' => 'Diese Rechnung wurde bereits storniert.',
'Invoice number' => 'Rechnungsnummer',
'Invoice with Storno (abbreviation)' => 'R(S)',
'Invoices' => 'Rechnungen',
'Is Searchable' => 'Durchsuchbar',
'Is this a summary account to record' => 'Buchungskonto in',
- 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
+ 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => 'Es ist möglich, dies für einige, aber nicht für alle Buchungsgruppen automatisch zu erledigen.',
'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => 'Das ist für einige Einheiten automatisch möglich, aber bei anderen muss der Benutzer die neue Einheit auswählen.',
'It may optionally be compressed with "gzip".' => 'Sie darf optional mit "gzip" komprimiert sein.',
- 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
- 'Item deleted!' => 'Artikel gelöscht!',
+ 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
+ 'Item deleted!' => 'Artikel gelöscht!',
'Item not on file!' => 'Dieser Artikel ist nicht in der Datenbank!',
'Jahresverkehrszahlen neu' => 'Jahresverkehrszahlen neu',
'Jan' => 'Jan',
'LaTeX Templates' => 'LaTeX-Vorlagen',
'Landscape' => 'Querformat',
'Language' => 'Sprache',
- 'Language Values' => 'Sprachübersetzungen',
- 'Language deleted!' => 'Sprache gelöscht!',
+ 'Language Values' => 'Sprachübersetzungen',
+ 'Language deleted!' => 'Sprache gelöscht!',
'Language missing!' => 'Sprache fehlt!',
'Language saved!' => 'Sprache gespeichert!',
'Languages' => 'Sprachen',
'Left' => 'Links',
'Liability' => 'Passiva/Mittelherkunft',
'License' => 'Lizenz',
- 'License key' => 'Lizenzschlüssel',
+ 'License key' => 'Lizenzschlüssel',
'Licenses' => 'Lizenzen',
'Limit part selection' => 'Artikelauswahl eingrenzen',
'Line Total' => 'Zeilensumme',
'List export' => 'Export anzeigen',
'List of bank accounts' => 'Liste der Bankkonten',
'List of bank collections' => 'Bankeinzugsliste',
- 'List of bank transfers' => 'Überweisungsliste',
+ 'List of bank transfers' => 'Überweisungsliste',
'List of custom variables' => 'Liste der benutzerdefinierten Variablen',
- 'List open SEPA exports' => 'Noch nicht ausgeführte SEPA-Exporte anzeigen',
+ 'List open SEPA exports' => 'Noch nicht ausgeführte SEPA-Exporte anzeigen',
'Load draft' => 'Entwurf laden',
'Local Tax Office Preferences' => 'Angaben zum Finanzamt',
'Lock System' => 'System sperren',
'Manage license keys' => 'Lizenzschlüssel verwalten',
'Mandantennummer' => 'Mandantennummer',
'Mandatory Departments' => 'Benutzer muss Abteilungen vergeben',
- 'Mar' => 'März',
- 'March' => 'März',
+ 'Mar' => 'März',
+ 'March' => 'März',
'Margepercent' => 'Ertrag prozentual',
'Margetotal' => 'Ertrag',
'Margins' => 'Seitenränder',
- 'Mark as closed' => 'Abschließen',
+ 'Mark as closed' => 'Abschließen',
'Mark as paid?' => 'Als bezahlt markieren?',
'Mark closed' => 'Als geschlossen markieren',
'Marked as paid' => 'Als bezahlt markiert',
- 'Marked entries printed!' => 'Markierte Einträge wurden gedruckt!',
+ 'Marked entries printed!' => 'Markierte Einträge wurden gedruckt!',
'Master Data' => 'Stammdaten',
- 'Max. Dunning Level' => 'höchste Mahnstufe',
+ 'Max. Dunning Level' => 'höchste Mahnstufe',
'May' => 'Mai',
'May ' => 'Mai',
'May set the BCC field when sending emails' => 'Beim Verschicken von Emails das Feld \'BCC\' setzen',
'Monthly' => 'monatlich',
'More than one #1 found matching, please be more specific.' => 'Mehr als ein #1 wurde gefunden, bitte geben Sie den Namen genauer an.',
'More than one control file with the tag \'%s\' exist.' => 'Es gibt mehr als eine Kontrolldatei mit dem Tag \'%s\'.',
- 'Multi mode not supported.' => 'Multimodus wird nicht unterstützt.',
+ 'Multi mode not supported.' => 'Multimodus wird nicht unterstützt.',
'Multibyte Encoding' => 'Zeichenkodierung',
'MwSt. inkl.' => 'MwSt. inkl.',
'Name' => 'Name',
'New service' => 'Neue Dienstleistung',
'New unit' => 'Neue Einheit',
'New vendor' => 'Neuer Lieferant',
- 'Next Dunning Level' => 'Nächste Mahnstufe',
+ 'Next Dunning Level' => 'Nächste Mahnstufe',
'No' => 'Nein',
'No %s was found matching the search parameters.' => 'Es wurde kein %s gefunden, auf den die Suchparameter zutreffen.',
'No Company Address given' => 'Keine Firmenadresse hinterlegt!',
'No Company Name given' => 'Kein Firmenname hinterlegt!',
'No Customer was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Endkunde gefunden',
- 'No Database Drivers available!' => 'Kein Datenbanktreiber verfügbar!',
- 'No Dataset selected!' => 'Keine Datenbank ausgewählt!',
- 'No Vendor was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Händler gefunden',
+ 'No Database Drivers available!' => 'Kein Datenbanktreiber verfügbar!',
+ 'No Dataset selected!' => 'Keine Datenbank ausgewählt!',
+ 'No Vendor was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Händler gefunden',
'No action defined.' => 'Keine Aktion definiert.',
'No backup file has been uploaded.' => 'Es wurde keine Sicherungsdatei hochgeladen.',
- 'No bank information has been entered in this customer\'s master data entry. You cannot create bank collections unless you enter bank information.' => 'Für diesen Kunden wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
- 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => 'Für diesen Lieferanten wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
+ 'No bank information has been entered in this customer\'s master data entry. You cannot create bank collections unless you enter bank information.' => 'Für diesen Kunden wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
+ 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => 'Für diesen Lieferanten wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
'No bins have been added to this warehouse yet.' => 'Es wurden zu diesem Lager noch keine Lagerplätze angelegt.',
- 'No customer has been selected yet.' => 'Es wurde noch kein Kunde ausgewählt.',
+ 'No customer has been selected yet.' => 'Es wurde noch kein Kunde ausgewählt.',
'No data was found.' => 'Es wurden keine Daten gefunden.',
'No databases have been found on this server.' => 'Auf diesem Server wurden keine Datenbanken gefunden.',
'No datasets have been selected.' => 'Es wurden keine Datenbanken ausgewählt.',
'No licenses were found that match the search criteria.' => 'Es wurden keine Lizenzen gefunden, auf die die Suchkriterien zutreffen.',
'No or an unknown authenticantion module specified in "config/authentication.pl".' => 'Es wurde kein oder ein unbekanntes Authentifizierungsmodul in "config/authentication.pl" angegeben.',
'No part was found matching the search parameters.' => 'Es wurde kein Artikel gefunden, auf den die Suchparameter zutreffen.',
- 'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
+ 'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
'No problems were recognized.' => 'Es wurden keine Probleme gefunden.',
- 'No transaction selected!' => 'Keine Transaktion ausgewählt',
- 'No transfers were executed in this export.' => 'In diesem SEPA-Export wurden keine Überweisungen ausgeführt.',
+ 'No transaction selected!' => 'Keine Transaktion ausgewählt',
+ 'No transfers were executed in this export.' => 'In diesem SEPA-Export wurden keine Überweisungen ausgeführt.',
'No unknown units where found.' => 'Es wurden keine unbekannten Einheiten gefunden.',
'No user has been selected.' => 'Es wurde kein Benutzer ausgewählt.',
- 'No valid number entered for pricegroup "#1".' => 'Für Preisgruppe "#1" wurde keine gültige Nummer eingegeben.',
- 'No vendor has been selected yet.' => 'Es wurde noch kein Lieferant ausgewählt.',
- 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => 'Es wurde noch kein Lager angelegt, bzw. die dazugehörigen Lagerplätze sind noch nicht konfiguriert.',
+ 'No valid number entered for pricegroup "#1".' => 'Für Preisgruppe "#1" wurde keine gültige Nummer eingegeben.',
+ 'No vendor has been selected yet.' => 'Es wurde noch kein Lieferant ausgewählt.',
+ 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => 'Es wurde noch kein Lager angelegt, bzw. die dazugehörigen Lagerplätze sind noch nicht konfiguriert.',
'No.' => 'Position',
- 'Non-taxable Purchases' => 'Nicht zu versteuernde Einkäufe',
- 'Non-taxable Sales' => 'Nicht zu versteuernde Verkäufe',
+ 'Non-taxable Purchases' => 'Nicht zu versteuernde Einkäufe',
+ 'Non-taxable Sales' => 'Nicht zu versteuernde Verkäufe',
'None' => 'Kein',
- 'Not Discountable' => 'Nicht rabattierfähig',
+ 'Not Discountable' => 'Nicht rabattierfähig',
'Not delivered' => 'Nicht geliefert',
'Not done yet' => 'Noch nicht fertig',
- 'Not obsolete' => 'Gültig',
+ 'Not obsolete' => 'Gültig',
'Note' => 'Hinweis',
- 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => 'Achtung: Steuerschlüssel brauchen ein gültiges "Gültig ab"-Datum und werden andernfalls ignoriert.',
+ 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => 'Achtung: Steuerschlüssel brauchen ein gültiges "Gültig ab"-Datum und werden andernfalls ignoriert.',
'Notes' => 'Bemerkungen',
'Notes (will appear on hard copy)' => 'Bemerkungen',
'Nothing has been selected for removal.' => 'Es wurde nichts für eine Entnahme ausgewählt.',
'Nothing has been selected for transfer.' => 'Es wurde nichts zum Umlagern ausgewählt.',
- 'Nothing selected!' => 'Es wurde nichts ausgewählt!',
- 'Nothing to delete!' => 'Es konnte nichts gelöscht werden!',
+ 'Nothing selected!' => 'Es wurde nichts ausgewählt!',
+ 'Nothing to delete!' => 'Es konnte nichts gelöscht werden!',
'Nov' => 'Nov',
'November' => 'November',
'Now the user must select a single Buchungsgruppe for each part instead of three distinct accounts.' => 'Der Benutzer muss nun für jeden Artikel nur noch die Buchungsgruppe anstelle der drei einzelnen Konten auswählen.',
'Number missing in Row' => 'Nummer fehlt in Zeile',
'Number of bins' => 'Anzahl Lagerplätze',
'Number of copies' => 'Anzahl Kopien',
- 'Number of entries changed: #1' => 'Anzahl geänderter Einträge: #1',
+ 'Number of entries changed: #1' => 'Anzahl geänderter Einträge: #1',
'Number of new bins' => 'Anzahl neuer Lagerplätze',
'Number pages' => 'Seiten nummerieren',
'Number variables: \'PRECISION=n\' forces numbers to be shown with exactly n decimal places.' => 'Zahlenvariablen: Mit \'PRECISION=n\' erzwingt man, dass Zahlen mit n Nachkommastellen formatiert werden.',
'OB Transaction' => 'EB-Buchung',
'OBE-Export erfolgreich!' => 'OBE-Export erfolgreich!',
- 'Obsolete' => 'Ungültig',
+ 'Obsolete' => 'Ungültig',
'Oct' => 'Okt',
'October' => 'Oktober',
'Off' => 'Aus',
'Open in new window' => 'In neuem Fenster öffnen.',
'Open this Website' => 'Homepage in neuem Fenster öffnen',
'OpenDocument/OASIS' => 'OpenDocument/OASIS',
- 'Openings' => 'Öffnungszeiten',
+ 'Openings' => 'Öffnungszeiten',
'Optional comment' => 'Optionaler Kommentar',
'Options' => 'Optionen',
'Order' => 'Auftrag',
'Order Date missing!' => 'Auftragsdatum fehlt!',
'Order Number' => 'Auftragsnummer',
'Order Number missing!' => 'Auftragsnummer fehlt!',
- 'Order deleted!' => 'Auftrag gelöscht!',
+ 'Order deleted!' => 'Auftrag gelöscht!',
'Ordered' => 'Vom Kunde bestellt',
'Orientation' => 'Seitenformat',
'Orphaned' => 'Nie benutzt',
'Other values are ignored.' => 'Andere Eingaben werden ignoriert.',
'Others' => 'Andere',
'Otherwise all users will only have access to their own settings.' => 'Andernfalls haben alle Benutzer nur Zugriff auf ihre Einstellungen.',
- 'Otherwise the variable is only available for printing.' => 'Andernfalls steht die Variable nur beim Ausdruck zur Verfügung.',
+ 'Otherwise the variable is only available for printing.' => 'Andernfalls steht die Variable nur beim Ausdruck zur Verfügung.',
'Out of balance transaction!' => 'Buchung ist nicht ausgeglichen!',
'Out of balance!' => 'Summen stimmen nicht berein!',
'Output Number Format' => 'Zahlenformat (Ausgabe)',
'Outputformat' => 'Ausgabeformat',
- 'Overdue sales quotations and requests for quotations' => 'Überfällige Angebote und Preisanfragen',
+ 'Overdue sales quotations and requests for quotations' => 'Überfällige Angebote und Preisanfragen',
'Own Product' => 'eigenes Produkt',
'PAYMENT POSTED' => 'Rechung gebucht',
'PDF' => 'PDF',
'POSTED AS NEW' => 'Als neu gebucht',
'PRINTED' => 'Gedruckt',
'Packing List' => 'Packliste',
- 'Packing List Date missing!' => 'Datum für Packliste fehlt!',
+ 'Packing List Date missing!' => 'Datum für Packliste fehlt!',
'Packing List Number missing!' => 'Packlistennummer fehlt!',
'Packing Lists' => 'Lieferschein',
'Page #1/#2' => 'Seite #1/#2',
'Payment date missing!' => 'Tag der Zahlung fehlt!',
'Payment list as PDF' => 'Zahlungsliste als PDF',
'Payment posted!' => 'Zahlung gebucht!',
- 'Payment terms deleted!' => 'Zahlungskonditionen gelöscht!',
- 'Payments' => 'Zahlungsausgänge',
+ 'Payment terms deleted!' => 'Zahlungskonditionen gelöscht!',
+ 'Payments' => 'Zahlungsausgänge',
'Period' => 'Zeitraum',
'Period:' => 'Zeitraum:',
'Personal settings' => 'Persönliche Einstellungen',
'Phone1' => 'Telefon 1 ',
'Phone2' => 'Telefon 2',
'Pick List' => 'Sammelliste',
- 'Please Check the bank information for each customer:' => 'Bitte überprüfen Sie die Bankinformationen der Kunden:',
- 'Please Check the bank information for each vendor:' => 'Bitte überprüfen Sie die Kontoinformationen der Lieferanten:',
+ 'Please Check the bank information for each customer:' => 'Bitte überprüfen Sie die Bankinformationen der Kunden:',
+ 'Please Check the bank information for each vendor:' => 'Bitte überprüfen Sie die Kontoinformationen der Lieferanten:',
'Please ask your administrator to create warehouses and bins.' => 'Bitten Sie Ihren Administrator, dass er Lager und Lagerplätze anlegt.',
- 'Please enter a license key.' => 'Bitte geben Sie einen Lizenzschlüssel an.',
- 'Please enter a number of licenses.' => 'Bitte geben Sie die Anzahl Lizenzschlüssel an.',
- 'Please enter the login for the new user.' => 'Bitte geben Sie das Login für den neuen Benutzer ein.',
+ 'Please enter a license key.' => 'Bitte geben Sie einen Lizenzschlüssel an.',
+ 'Please enter a number of licenses.' => 'Bitte geben Sie die Anzahl Lizenzschlüssel an.',
+ 'Please enter the login for the new user.' => 'Bitte geben Sie das Login für den neuen Benutzer ein.',
'Please enter the name of the database that will be used as the template for the new database:' => 'Bitte geben Sie den Namen der Datenbank an, die als Vorlage für die neue Datenbank benutzt wird:',
'Please enter the name of the dataset you want to restore the backup in.' => 'Bitte geben Sie den Namen der Datenbank ein, in der Sie die Sicherung wiederherstellen wollen.',
+ 'Please enter the sales tax identification number.' => 'Bitte geben Sie die Umsatzsteueridentifikationsnummer an.',
'Please enter the taxnumber in the administration menu user preferences' => 'Bitte bei den Einstellungen des aktuellen Benutzers im Administrationsmodul angeben.',
'Please enter values' => 'Bitte Werte eingeben',
'Please insert object dimensions below.' => 'Bitte geben Sie die Abmessungen unten ein',
- 'Please insert your language values below' => 'Bitte die Übersetzungen unten eintragen',
+ 'Please insert your language values below' => 'Bitte die Übersetzungen unten eintragen',
'Please insert your longdescription below' => 'Bitte den Langtext eingeben',
'Please install the below listed modules or ask your system administrator to.' => 'Bitte installieren Sie die unten aufgeführten Module, oder bitten Sie Ihren Administrator darum.',
- 'Please re-run the analysis for broken general ledger entries by clicking this button:' => 'Bitte wiederholen Sie die Analyse der Hauptbucheinträge, indem Sie auf diesen Button klicken:',
+ 'Please re-run the analysis for broken general ledger entries by clicking this button:' => 'Bitte wiederholen Sie die Analyse der Hauptbucheinträge, indem Sie auf diesen Button klicken:',
'Please read the file' => 'Bitte lesen Sie die Datei',
- 'Please select a customer from the list below.' => 'Bitte einen Endkunden aus der Liste auswählen',
+ 'Please select a customer from the list below.' => 'Bitte einen Endkunden aus der Liste auswählen',
'Please select a part from the list below.' => 'Bitte wählen Sie einen Artikel aus der Liste aus.',
- 'Please select a user' => 'Bitte wählen Sie einen Benutzer aus',
- 'Please select a vendor from the list below.' => 'Bitte einen Händler aus der Liste auswählen',
+ 'Please select a user' => 'Bitte wählen Sie einen Benutzer aus',
+ 'Please select a vendor from the list below.' => 'Bitte einen Händler aus der Liste auswählen',
'Please select the chart of accounts this installation is using from the list below.' => 'Bitte wählen Sie den Kontenrahmen aus, der bei dieser Installation verwendet wird.',
'Please select the database you want to backup' => 'Bitte wählen Sie die zu sichernde Datenbank gefunden',
- 'Please select the destination bank account for the collections:' => 'Bitte wählen Sie das Bankkonto als Ziel für die Einzüge aus:',
- 'Please select the source bank account for the transfers:' => 'Bitte wählen Sie das Bankkonto als Quelle für die Überweisungen aus:',
+ 'Please select the destination bank account for the collections:' => 'Bitte wählen Sie das Bankkonto als Ziel für die Einzüge aus:',
+ 'Please select the source bank account for the transfers:' => 'Bitte wählen Sie das Bankkonto als Quelle für die Überweisungen aus:',
'Please seletct the dataset you want to delete:' => 'Bitte wählen Sie die zu löschende Datenbank aus:',
'Please specify a description for the warehouse designated for these goods.' => 'Bitte geben Sie den Namen des Ziellagers für die übernommenen Daten ein.',
'Plural' => 'Plural',
'Preisgruppe' => 'Preisgruppe',
'Preisklasse' => 'Preisgruppe',
'Prepare bank collection via SEPA XML' => 'Einzug via SEPA XML vorbereiten',
- 'Prepare bank transfer via SEPA XML' => 'Überweisung via SEPA XML vorbereiten',
+ 'Prepare bank transfer via SEPA XML' => 'Überweisung via SEPA XML vorbereiten',
'Prepayment' => 'Vorauszahlung',
'Preview' => 'Druckvorschau',
'Previous transdate text' => 'wurde gespeichert am',
'Price factor deleted!' => 'Preisfaktor gelöscht.',
'Price factor saved!' => 'Preisfaktor gespeichert.',
'Pricegroup' => 'Preisgruppe',
- 'Pricegroup deleted!' => 'Preisgruppe gelöscht!',
+ 'Pricegroup deleted!' => 'Preisgruppe gelöscht!',
'Pricegroup missing!' => 'Preisgruppe fehlt!',
'Pricegroup saved!' => 'Preisgruppe gespeichert!',
'Pricegroups' => 'Preisgruppen',
'Printer Command' => 'Druckbefehl',
'Printer Command missing!' => 'Druckbefehl fehlt',
'Printer Management' => 'Druckeradministration',
- 'Printers are created for a user database. Please select a user. The associated database will be edited.' => 'Drucker werden für eine Benutzerdatenbank erzeugt. Bitte wählen Sie einen Benutzer aus. Die Drucker werden in der verknüpften Datenbank angelegt.',
+ 'Printers are created for a user database. Please select a user. The associated database will be edited.' => 'Drucker werden für eine Benutzerdatenbank erzeugt. Bitte wählen Sie einen Benutzer aus. Die Drucker werden in der verknüpften Datenbank angelegt.',
'Printing ... ' => 'Es wird gedruckt.',
'Prior to Lx-Office v2.4.0 the user could enter arbitrary strings as units for parts, services and in invoices, sales quotations etc.' => 'Vor Lx-Office 2.4.0 konnte der Benutzer bei Artikeln, Dienstleistungen und Rechnungen, Angeboten etc beliebige Einheiten angeben.',
'Prior to Lx-Office v2.4.0 the user had to chose the accounts for each part and service.' => 'Vor Lx-Office 2.4.0 musste der Benutzer die Konten bei jeder Ware und jeder Dienstleistung einzeln auswählen.',
'Private Phone' => 'Privates Tel.',
'Problem' => 'Problem',
'Produce Assembly' => 'Erzeugnis fertigen',
- 'Productivity' => 'Produktivität',
+ 'Productivity' => 'Produktivität',
'Profit Center' => 'Erfolgsbereich',
'Proforma Invoice' => 'Proformarechnung',
'Program' => 'Programm',
'Project Number missing!' => 'Projektnummer fehlt!',
'Project Numbers' => 'Projektnummern',
'Project Transactions' => 'Projektbuchungen',
- 'Project deleted!' => 'Projekt gelöscht!',
+ 'Project deleted!' => 'Projekt gelöscht!',
'Project not on file!' => 'Dieses Projekt ist nicht in der Datenbank!',
'Project saved!' => 'Projekt gespeichert!',
'Projects' => 'Projekte',
'Prozentual/Absolut' => 'Prozentual/Absolut',
'Purchase Invoice' => 'Einkaufsrechnung',
'Purchase Order' => 'Lieferantenauftrag',
- 'Purchase Orders' => 'Lieferantenaufträge',
+ 'Purchase Orders' => 'Lieferantenaufträge',
'Purchase Price' => 'Einkaufspreis',
'Purchase Prices' => 'Einkaufspreise',
'Purchase delivery order' => 'Lieferschein (Einkauf)',
'Quotation Date missing!' => 'Angebotsdatum fehlt!',
'Quotation Number' => 'Angebotsnummer',
'Quotation Number missing!' => 'Angebotsnummer fehlt!',
- 'Quotation deleted!' => 'Angebot wurde gelöscht.',
+ 'Quotation deleted!' => 'Angebot wurde gelöscht.',
'Quotations' => 'Angebote',
'Quote chararacter' => 'Anführungszeichen',
'Quoted' => 'Angeboten',
'Receipt' => 'Zahlungseingang',
'Receipt posted!' => 'Beleg gebucht!',
'Receipt, payment, reconciliation' => 'Zahlungseingang, Zahlungsausgang, Kontenabgleich',
- 'Receipts' => 'Zahlungseingänge',
+ 'Receipts' => 'Zahlungseingänge',
'Receivables' => 'Forderungen',
'Rechnungsnummer' => 'Rechnungsnummer',
'Reconciliation' => 'Kontenabgleich',
'Record Vendor Invoice' => 'Einkaufsrechnung erfassen',
'Record in' => 'Buchen auf',
'Recorded Tax' => 'Gespeicherte Steuern',
- 'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
+ 'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
'Reference' => 'Referenz',
'Reference missing!' => 'Referenz fehlt!',
'Release From Stock' => 'Lagerausgang',
'Remaining' => 'Rest',
- 'Remittance information prefix' => 'Verwendungszweckvorbelegung (Präfix)',
+ 'Remittance information prefix' => 'Verwendungszweckvorbelegung (Präfix)',
'Removal' => 'Entnahme',
'Removal from Warehouse' => 'Lagerentnahme',
'Removal from warehouse' => 'Entnahme aus Lager',
'Remove draft when posting' => 'Entwurf beim Buchen löschen',
'Remove from group' => 'Aus Gruppe entfernen',
'Removed spoolfiles!' => 'Druckdateien entfernt!',
- 'Removing marked entries from queue ...' => 'Markierte Einträge werden von der Warteschlange entfernt ...',
+ 'Removing marked entries from queue ...' => 'Markierte Einträge werden von der Warteschlange entfernt ...',
'Rename the group' => 'Gruppe umbenennen',
'Report Positions' => 'Berichte',
'Report about warehouse contents' => 'Lagerbestand anzeigen',
'Report about warehouse transactions' => 'Lagerbuchungen anzeigen',
'Report and misc. Preferences' => 'Sonstige Einstellungen',
- 'Report for' => 'Bericht für',
+ 'Report for' => 'Bericht für',
'Reports' => 'Berichte',
'Representative' => 'Vertreter',
'Reqdate' => 'Lieferdatum',
'Request for Quotation' => 'Anfrage',
'Request for Quotations' => 'Anfragen',
'Request quotation' => 'Preisanfrage',
- 'Requested execution date' => 'Gewünschtes Ausführungsdatum',
- 'Requested execution date from' => 'Gewünschtes Ausführungsdatum von',
- 'Requested execution date to' => 'Gewünschtes Ausführungsdatum bis',
+ 'Requested execution date' => 'Gewünschtes Ausführungsdatum',
+ 'Requested execution date from' => 'Gewünschtes Ausführungsdatum von',
+ 'Requested execution date to' => 'Gewünschtes Ausführungsdatum bis',
'Required by' => 'Lieferdatum',
'Restore Dataset' => 'Datenbank wiederherstellen',
- 'Revenue' => 'Erlöskonto',
- 'Revenue Account' => 'Erlöskonto',
+ 'Revenue' => 'Erlöskonto',
+ 'Revenue Account' => 'Erlöskonto',
'Revenues EU with UStId' => 'Erlöse EU m. UStId',
'Revenues EU without UStId' => 'Erlöse EU o. UStId',
'Review of Aging list' => 'Altersstrukturliste',
'SEPA XML download' => 'SEPA-XML-Download',
'SEPA creditor ID' => 'SEPA-Kreditoren-Identifikation',
'SEPA exports:' => 'SEPA-Exporte:',
- 'SEPA strings' => 'SEPA-Überweisungen',
+ 'SEPA strings' => 'SEPA-Überweisungen',
'Saldo Credit' => 'Saldo Haben',
'Saldo Debit' => 'Saldo Soll',
'Saldo neu' => 'Saldo neu',
'Sales Invoice' => 'Rechnung',
'Sales Invoices' => 'Kundenrechnung',
'Sales Order' => 'Kundenauftrag',
- 'Sales Orders' => 'Aufträge',
+ 'Sales Orders' => 'Aufträge',
'Sales Report' => 'Verkaufsbericht',
- 'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
+ 'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
'Sales delivery order' => 'Lieferschein (Verkauf)',
'Sales invoice number' => 'Ausgangsrechnungsnummer',
'Sales invoices' => 'Verkaufsrechnungen',
'Sales price' => 'VK-Preis',
'Sales price total' => 'VK-Betrag',
'Sales quotation' => 'Angebot',
- 'Salesman' => 'Verkäufer/in',
- 'Salesperson' => 'Verkäufer',
+ 'Salesman' => 'Verkäufer/in',
+ 'Salesperson' => 'Verkäufer',
'Same as the quote character' => 'Wie Anführungszeichen',
'Sat. Fax' => 'Sat. Fax',
'Sat. Phone' => 'Sat. Tel.',
'Satz %' => 'Satz %',
'Save' => 'Speichern',
'Save Draft' => 'Entwurf speichern',
- 'Save account first to insert taxkeys' => 'Einstellungen sind nach dem Speichern des Kontos verfügbar...',
+ 'Save account first to insert taxkeys' => 'Einstellungen sind nach dem Speichern des Kontos verfügbar...',
'Save and AP Transaction' => 'Speichern und Kreditorenbuchung erfassen',
'Save and AR Transaction' => 'Speichern und Debitorenbuchung erfassen',
- 'Save and Close' => 'Speichern und schließen',
+ 'Save and Close' => 'Speichern und schließen',
'Save and Invoice' => 'Speichern und Rechnung erfassen',
'Save and Order' => 'Speichern und Auftrag erfassen',
'Save and Quotation' => 'Speichern und Angebot',
'Search AP Aging' => 'Offene Verbindlichkeiten',
'Search AR Aging' => 'Offene Forderungen',
'Searchable' => 'Durchsuchbar',
- 'Select' => 'auswählen',
- 'Select a Customer' => 'Endkunde auswählen',
+ 'Select' => 'auswählen',
+ 'Select a Customer' => 'Endkunde auswählen',
'Select a customer' => 'Einen Kunden auswählen',
'Select a part' => 'Artikel auswählen',
'Select a part or assembly' => 'Artikel oder Erzeugnis auswählen',
- 'Select a period' => 'Bitte Zeitraum auswählen',
+ 'Select a period' => 'Bitte Zeitraum auswählen',
'Select a vendor' => 'Einen Lieferanten auswählen',
- 'Select all' => 'Alle auswählen',
- 'Select federal state...' => 'Bundesland auswählen...',
- 'Select from one of the items below' => 'Wählen Sie einen der untenstehenden Einträge',
- 'Select from one of the names below' => 'Wählen Sie einen der untenstehenden Namen',
- 'Select from one of the projects below' => 'Wählen Sie eines der untenstehenden Projekte',
- 'Select postscript or PDF!' => 'Postscript oder PDF auswählen!',
- 'Select tax office...' => 'Finanzamt auswählen...',
+ 'Select all' => 'Alle auswählen',
+ 'Select federal state...' => 'Bundesland auswählen...',
+ 'Select from one of the items below' => 'Wählen Sie einen der untenstehenden Einträge',
+ 'Select from one of the names below' => 'Wählen Sie einen der untenstehenden Namen',
+ 'Select from one of the projects below' => 'Wählen Sie eines der untenstehenden Projekte',
+ 'Select postscript or PDF!' => 'Postscript oder PDF auswählen!',
+ 'Select tax office...' => 'Finanzamt auswählen...',
'Select the chart of accounts in use' => 'Benutzten Kontenrahmen auswählen',
'Select the checkboxes that match users to the groups they should belong to.' => 'Wählen Sie diejenigen Checkboxen aus, die die Benutzer zu den gewüschten Gruppen zuordnen.',
'Select type of removal' => 'Grund der Entnahme auswählen',
'Services' => 'Dienstleistungen',
'Set Language Values' => 'Spracheinstellungen',
'Set eMail text' => 'eMail Text eingeben',
- 'Setup Menu' => 'Menü-Variante',
- 'Setup Templates' => 'Vorlagen auswählen',
+ 'Setup Menu' => 'Menü-Variante',
+ 'Setup Templates' => 'Vorlagen auswählen',
'Ship to' => 'Lieferadresse',
'Ship via' => 'Transportmittel',
'Shipping Address' => 'Lieferadresse',
'Shopartikel' => 'Shopartikel',
'Short' => 'Knapp',
'Show' => 'Zeigen',
- 'Show Salesman' => 'Verkäufer anzeigen',
+ 'Show Salesman' => 'Verkäufer anzeigen',
'Show TODO list' => 'Aufgabenliste anzeigen',
'Show by default' => 'Standardmäßig anzeigen',
- 'Show custom variable search inputs' => 'Suchoptionen für Benutzerdefinierte Variablen verstecken',
+ 'Show custom variable search inputs' => 'Suchoptionen für Benutzerdefinierte Variablen verstecken',
'Show details' => 'Detailsanzeige',
'Show follow ups...' => 'Zeige Wiedervorlagen...',
'Show old dunnings' => 'Alte Mahnungen anzeigen',
- 'Show overdue sales quotations and requests for quotations...' => 'Überfällige Angebote und Preisanfragen anzeigen...',
+ 'Show overdue sales quotations and requests for quotations...' => 'Überfällige Angebote und Preisanfragen anzeigen...',
'Show your TODO list after loggin in' => 'Aufgabenliste nach dem Anmelden anzeigen',
'Signature' => 'Unterschrift',
'Since bin is not enforced in the parts data, please specify a bin where goods without a specified bin will be put.' => 'Da Lagerplätze kein Pflichtfeld sind, geben Sie bitte einen Lagerplatz an, in dem Waren ohne spezifizierten Lagerplatz eingelagert werden sollen.',
- 'Skip' => 'Überspringen',
+ 'Skip' => 'Überspringen',
'Skonto' => 'Skonto',
'Skonto Terms' => 'Zahlungsziel Skonto',
'Sold' => 'Verkauft',
- 'Solution' => 'Lösung',
+ 'Solution' => 'Lösung',
'Source' => 'Beleg',
'Source BIC' => 'Quell-BIC',
'Source IBAN' => 'Quell-IBAN',
'Start Dunning Process' => 'Mahnprozess starten',
'Start analysis' => 'Analyse beginnen',
'Start the correction assistant' => 'Korrekturassistenten starten',
- 'Startdate_coa' => 'Gültig ab',
- 'Starting Balance' => 'Eröffnungsbilanzwerte',
+ 'Startdate_coa' => 'Gültig ab',
+ 'Starting Balance' => 'Eröffnungsbilanzwerte',
'Statement' => 'Sammelrechnung',
'Statement Balance' => 'Sammelrechnungsbilanz',
'Statement sent to' => 'Sammelrechnung verschickt an',
'Storno (one letter abbreviation)' => 'S',
'Storno Invoice' => 'Stornorechnung',
'Storno Packing List' => 'Stornolieferschein',
- 'Street' => 'Straße',
+ 'Street' => 'Straße',
'Stylesheet' => 'Stilvorlage',
'Subject' => 'Betreff',
'Subject:' => 'Betreff:',
'Subtotal' => 'Zwischensumme',
- 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => 'Solche Einträge sind aber nicht DATEV-exportiertbar und müssen ebenfalls korrigiert werden.',
+ 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => 'Solche Einträge sind aber nicht DATEV-exportiertbar und müssen ebenfalls korrigiert werden.',
'Sum Credit' => 'Summe Haben',
'Sum Debit' => 'Summe Soll',
- 'Sum for' => 'Summe für',
+ 'Sum for' => 'Summe für',
'Sum per' => 'Summe per',
'Summen- und Saldenliste' => 'Summen- und Saldenliste',
'Superuser name' => 'Datenbankadministrator',
'Tax Period' => 'Voranmeldungszeitraum',
'Tax Position' => 'Position',
'Tax collected' => 'vereinnahmte Steuer',
- 'Tax deleted!' => 'Steuer gelöscht!',
+ 'Tax deleted!' => 'Steuer gelöscht!',
'Tax number' => 'Steuernummer',
'Tax paid' => 'Vorsteuer',
'Tax saved!' => 'Steuer gespeichert!',
'Taxdescription missing!' => 'Steuername fehlt!',
'Taxdescription_coa' => 'Steuer',
'Taxes' => 'Steuern',
- 'Taxkey' => 'Steuerschlüssel',
- 'Taxkey missing!' => 'Steuerschlüssel fehlt!',
- 'Taxkey_coa' => 'Steuerschlüssel',
+ 'Taxkey' => 'Steuerschlüssel',
+ 'Taxkey missing!' => 'Steuerschlüssel fehlt!',
+ 'Taxkey_coa' => 'Steuerschlüssel',
'Taxkeys and Taxreport Preferences' => 'Steuerautomatik und UStVA',
'Taxlink_coa' => 'Steuerautomatik',
'Taxnumber' => 'Steuernummer',
'Tel.' => 'Telefon',
'Telephone' => 'Telefon',
'Template' => 'Druckvorlage',
- 'Template Code' => 'Vorlagenkürzel',
- 'Template Code missing!' => 'Vorlagenkürzel fehlt!',
+ 'Template Code' => 'Vorlagenkürzel',
+ 'Template Code missing!' => 'Vorlagenkürzel fehlt!',
'Template database' => 'Datenbankvorlage',
'Templates' => 'Vorlagen',
'Terms missing in row ' => '+Tage fehlen in Zeile ',
'Text, text field and number variables: The default value will be used as-is.' => 'Textzeilen, Textfelder und Zahlenvariablen: Der Standardwert wird so wie er ist übernommen.',
'That export does not exist.' => 'Dieser Export existiert nicht.',
'The \'tag\' field must only consist of alphanumeric characters or the carachters - _ ( )' => 'Das Feld \'tag\' darf nur aus alphanumerischen Zeichen und den Zeichen - _ ( ) bestehen.',
- 'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
- 'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
- 'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
+ 'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
+ 'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
+ 'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
'The LDAP server "#1:#2" is unreachable. Please check config/authentication.pl.' => 'Der LDAP-Server "#1:#2" ist nicht erreichbar. Bitte überprüfen Sie die Angaben in config/authentication.pl.',
'The SEPA export has been created.' => 'Der SEPA-Export wurde erstellt',
- 'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
+ 'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
'The access rights have been saved.' => 'Die Zugriffsrechte wurden gespeichert.',
- 'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird übersprungen.',
- 'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefügt.',
+ 'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird Ã\83Å\92bersprungen.',
+ 'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefÃ\83Å\92gt.',
'The assembly has been created.' => 'Das Erzeugnis wurde hergestellt.',
'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => 'Der Korrekturassistent konnte kein Problem bei #1 feststellen. Eventuell wurde das Problem in der Zwischenzeit bereits behoben.',
'The authentication configuration file "config/authentication.pl" does not exist. This Lx-Office installation has probably not been updated correctly yet. Please contact your administrator.' => 'Die Konfigurationsdatei für die Authentifizierung "config/authentication.pl" wurde nicht gefunden. Diese Lx-Office-Installation wurde vermutlich noch nicht vollständig aktualisiert oder eingerichtet. Bitte wenden Sie sich an Ihren Administrator.',
'The authentication database is not reachable at the moment. Either it hasn\'t been set up yet or the database server might be down. Please contact your administrator.' => 'Die Authentifizierungsdatenbank kann momentan nicht erreicht werden. Entweder wurde sie noch nicht eingerichtet, oder der Datenbankserver antwortet nicht. Bitte wenden Sie sich an Ihren Administrator.',
'The available options depend on the varibale type:' => 'Die verfügbaren Optionen hängen vom Variablentypen ab:',
'The backup you upload here has to be a file created with "pg_dump -o -Ft".' => 'Die von Ihnen hochzuladende Sicherungsdatei muss mit dem Programm und den Parametern "pg_dump -o -Ft" erstellt worden sein.',
- 'The bank information must not be empty.' => 'Die Bankinformationen müssen vollständig ausgefüllt werden.',
+ 'The bank information must not be empty.' => 'Die Bankinformationen müssen vollständig ausgefüllt werden.',
'The base unit does not exist or it is about to be deleted in row %d.' => 'Die Basiseinheit in Zeile %d existiert nicht oder soll gelöscht werden.',
'The base unit does not exist.' => 'Die Basiseinheit existiert nicht.',
'The base unit relations must not contain loops (e.g. by saying that unit A\'s base unit is B, B\'s base unit is C and C\'s base unit is A) in row %d.' => 'Die Beziehungen der Einheiten dürfen keine Schleifen beinhalten (z.B. wenn gesagt wird, dass Einheit As Basiseinheit B, Bs Basiseinheit C und Cs Basiseinheit A ist) in Zeile %d.',
'The creation of the authentication database failed:' => 'Das Anlegen der Authentifizierungsdatenbank schlug fehl:',
'The custom variable has been deleted.' => 'Die benutzerdefinierte Variable wurde gelöscht.',
'The custom variable has been saved.' => 'Die benutzerdefinierte Variable wurde gespeichert.',
- 'The database #1 has been successfully deleted.' => 'Die Datenbank #1 wurde erfolgreich gelöscht.',
+ 'The database #1 has been successfully deleted.' => 'Die Datenbank #1 wurde erfolgreich gelöscht.',
'The database for user management and authentication does not exist. You can create let Lx-Office create it with the following parameters:' => 'Die Datenbank zur Verwaltung der Benutzerdaten und zur Authentifizierung existiert nicht. Sie können Lx-Office diese Datenbank mit den folgenden Parametern anlegen lassen:',
'The database update/creation did not succeed. The file #1 contained the following error:' => 'Die Datenbankaktualisierung/erstellung schlug fehl. Die Datei #1 enthielt den folgenden Fehler:',
'The database upgrade for the introduction of Buchungsgruppen is now complete.' => 'Das Datenbankupgrade für die Einführung von Buchungsgruppen ist jetzt beendet.',
'The dataset has to exist before a restoration can be started.' => 'Die Datenbank muss vor der Wiederherstellung bereits angelegt worden sein.',
'The dataset name is missing.' => 'Der Datenbankname fehlt.',
'The default value depends on the variable type:' => 'Die Bedeutung des Standardwertes hängt vom Variablentypen ab:',
- 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => 'Der Lieferschein wurde nicht als geliefert markiert. Der Lagerinhalt wurde nicht verändert.',
+ 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => 'Der Lieferschein wurde nicht als geliefert markiert. Der Lagerinhalt wurde nicht verändert.',
'The description is missing.' => 'Die Beschreibung fehlt.',
'The description is shown on the form. Chose something short and descriptive.' => 'Die Beschreibung wird in der jeweiligen Maske angezeigt. Sie sollte kurz und prägnant sein.',
'The directory "%s" could not be created:\n%s' => 'Das Verzeichnis "%s" konnte nicht erstellt werden:\n%s',
'The email address is missing.' => 'Die Emailadresse fehlt.',
'The factor is missing in row %d.' => 'Der Faktor fehlt in Zeile %d.',
'The factor is missing.' => 'Der Faktor fehlt.',
- 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => 'Zum Einen gab es einen Bug in Lx-Office, der dazu führte, dass bei Buchungen mit verschiedenen Steuerschlüssel auf ein Konto teilweise falsche Steuerschlüssel gespeichert wurden.',
+ 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => 'Zum Einen gab es einen Bug in Lx-Office, der dazu führte, dass bei Buchungen mit verschiedenen Steuerschlüssel auf ein Konto teilweise falsche Steuerschlüssel gespeichert wurden.',
'The follow-up date is missing.' => 'Das Wiedervorlagedatum fehlt.',
'The following Buchungsgruppen have already been created:' => 'Die folgenden Buchungsgruppen wurden bereits angelegt:',
- 'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
+ 'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
'The following drafts have been saved and can be loaded.' => 'Die folgenden Entwürfe wurden gespeichert und können geladen werden.',
- 'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
- 'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
+ 'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
+ 'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
'The following units are unknown.' => 'Die folgenden Einheiten sind unbekannt.',
'The following units exist already:' => 'Die folgenden Einheiten existieren bereits:',
'The following users have been migrated into the authentication database:' => 'Die folgenden Benutzer wurden in die Authentifizierungsdatenbank migriert:',
'The following warnings occured during an upgrade to the document templates:' => 'Die folgenden Warnungen traten während einer Aktualisierung der Dokumentenvorlagen auf:',
- 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => 'Die Formeln müssen in der folgenden Syntax eingegeben werden:<br>Bei normalen Artikeln:<br>Variablenname = Variable Einheit;<br>Variablenname2 = Variable2 Einheit2;<br>...<br>###<br>Variable + Variable2 * ( Variable - Variable2 )<br>Variablennamen und Einheiten dürfen nur aus alphanumerischen Zeichen bestehen.<br>Es muss jeweils die Gesamte Zeile eingegeben werden',
+ 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => 'Die Formeln müssen in der folgenden Syntax eingegeben werden:<br>Bei normalen Artikeln:<br>Variablenname = Variable Einheit;<br>Variablenname2 = Variable2 Einheit2;<br>...<br>###<br>Variable + Variable2 * ( Variable - Variable2 )<br>Variablennamen und Einheiten dürfen nur aus alphanumerischen Zeichen bestehen.<br>Es muss jeweils die Gesamte Zeile eingegeben werden',
'The greetings have been saved.' => 'Die Anreden wurden gespeichert',
'The group has been added.' => 'Die Gruppe wurde erfasst.',
'The group has been deleted.' => 'Die Gruppe wurde gelöscht.',
'The name is missing in row %d.' => 'Der Name fehlt in Zeile %d.',
'The name is missing.' => 'Der Name fehlt.',
'The name must only consist of letters, numbers and underscores and start with a letter.' => 'Der Name darf nur aus Buchstaben (keine Umlaute), Ziffern und Unterstrichen bestehen und muss mit einem Buchstaben beginnen.',
- 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => 'Die alte Datei mit den Benutzerdaten existiert in dieser Installation noch immer ("#1"). Wollen Sie diese Benutzer in die neue Authentifizierungsdatenbank migrieren lassen? Falls nicht, so werden Sie sich nicht mehr mit den Benutzerdaten aus der alten Mitgliedsdatei anmelden können.',
+ 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => 'Die alte Datei mit den Benutzerdaten existiert in dieser Installation noch immer ("#1"). Wollen Sie diese Benutzer in die neue Authentifizierungsdatenbank migrieren lassen? Falls nicht, so werden Sie sich nicht mehr mit den Benutzerdaten aus der alten Mitgliedsdatei anmelden können.',
'The option field is empty.' => 'Das Optionsfeld ist leer.',
'The parts for this delivery order have already been transferred in.' => 'Die Artikel dieses Lieferscheins wurden bereits eingelagert.',
'The parts for this delivery order have already been transferred out.' => 'Die Artikel dieses Lieferscheins wurden bereits ausgelagert.',
'The project has been saved.' => 'Das Projekt wurde gespeichert.',
'The restoration process has started. Here\'s the output of the "pg_restore" command:' => 'Der Wiederherstellungsprozess wurde gestartet. Hier ist die Ausgabe des "pg_restore"-Programmes:',
'The restoration process is complete. Please review "pg_restore"\'s output to find out if the restoration was successful.' => 'Die Wiederherstellung ist abgeschlossen. Bitte sehen Sie sich die Ausgabe von "pg_restore" an, um festzustellen, ob die Wiederherstellung erfolgreich war.',
- 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => 'Zum Anderen war es möglich, die Steuern unabhängig vom ausgewählten Steuerschlüssel selber einzugeben.',
+ 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => 'Zum Anderen war es möglich, die Steuern unabhängig vom ausgewählten Steuerschlüssel selber einzugeben.',
'The second way is to use Perl\'s CPAN module and let it download and install the module for you.' => 'Die zweite Variante besteht darin, Perls CPAN-Modul zu benutzen und es das Modul für Sie installieren zu lassen.',
- 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Die ausgewählte PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Deshalb müssen Sie Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
- 'The selected bank account does not exist anymore.' => 'Das ausgewählte Bankkonto existiert nicht mehr.',
+ 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Die ausgewählte PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Deshalb müssen Sie Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
+ 'The selected bank account does not exist anymore.' => 'Das ausgewählte Bankkonto existiert nicht mehr.',
'The selected bin does not exist.' => 'Der ausgewählte Lagerplatz existiert nicht.',
- 'The selected exports have been closed.' => 'Die ausgewählten Exporte wurden abgeschlossen.',
+ 'The selected exports have been closed.' => 'Die ausgewählten Exporte wurden abgeschlossen.',
'The selected warehouse does not exist.' => 'Das ausgewählte Lager existiert nicht.',
'The selected warehouse is empty.' => 'Das ausgewählte Lager ist leer.',
'The session is invalid or has expired.' => 'Sie sind von Lx-Office abgemeldet.',
'The warehouse could not be deleted because it has already been used.' => 'Das Lager konnte nicht gelöscht werden, da es bereits in Benutzung war.',
'The warehouse does not contain any bins.' => 'Das Lager enthält keine Lagerplätze.',
'The warehouse or the bin is missing.' => 'Das Lager oder der Lagerplatz fehlen.',
- 'The wrong taxkeys for AP and AR transactions have been fixed.' => 'Die Probleme mit falschen Steuerschlüssel bei Kreditoren- und Debitorenbuchungen wurden behoben.',
- 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => 'Die falschen Steuerschlüssel für Warenbestandsbuchungen bei Einkaufs- und Verkaufsrechnungen wurden behoben.',
- 'The wrong taxkeys have been fixed.' => 'Die Steuerschlüssel wurden nach Ihrer Auswahl korrigiert.',
- 'There are #1 more open invoices for this customer with other currencies.' => 'Es gibt #1 weitere offene Rechnungen für diesen Kunden, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 more open invoices from this vendor with other currencies.' => 'Es gibt #1 weitere offene Rechnungen von diesem Lieferanten, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 unfinished follow-ups of which #2 are due.' => 'Es gibt #1 Wiedervorlage(n), von denen #2 fällig ist/sind.',
+ 'The wrong taxkeys for AP and AR transactions have been fixed.' => 'Die Probleme mit falschen Steuerschlüssel bei Kreditoren- und Debitorenbuchungen wurden behoben.',
+ 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => 'Die falschen Steuerschlüssel für Warenbestandsbuchungen bei Einkaufs- und Verkaufsrechnungen wurden behoben.',
+ 'The wrong taxkeys have been fixed.' => 'Die Steuerschlüssel wurden nach Ihrer Auswahl korrigiert.',
+ 'There are #1 more open invoices for this customer with other currencies.' => 'Es gibt #1 weitere offene Rechnungen für diesen Kunden, die in anderen Währungen ausgestellt wurden.',
+ 'There are #1 more open invoices from this vendor with other currencies.' => 'Es gibt #1 weitere offene Rechnungen von diesem Lieferanten, die in anderen Währungen ausgestellt wurden.',
+ 'There are #1 unfinished follow-ups of which #2 are due.' => 'Es gibt #1 Wiedervorlage(n), von denen #2 fällig ist/sind.',
'There are bookings to the account 3803 after 01.01.2007. If you didn\'t change this account manually to 19% the bookings are probably incorrect.' => 'Das Konto 3803 wurde nach dem 01.01.2007 bebucht. Falls Sie dieses Konto nicht manuell auf 19% gestellt haben sind die Buchungen wahrscheinlich mit falscher Umsatzsteuer gebucht worden.',
'There are four tax zones.' => 'Es gibt vier Steuerzonen.',
'There are no items in stock.' => 'Dieser Artikel ist nicht eingelagert.',
'There are no items on your TODO list at the moment.' => 'Ihre Aufgabenliste enthält momentan keine Einträge.',
'There are still entries in the database for which no unit has been assigned.' => 'Es gibt noch Einträge in der Datenbank, für die keine Einheit zugeordnet ist.',
'There are usually three ways to install Perl modules.' => 'Es gibt normalerweise drei Arten, ein Perlmodul zu installieren.',
- 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => 'Es gibt mindestens eine Einkaufs- oder Verkaufsrechnung, für die Lx-Office einen Steuerschlüssel ungleich 0 verzeichnet hat, obwohl für Warenbestandsbuchugen bei Rechnungen nie Steuern gebucht werden.',
- 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => 'Es gibt mindestens eine Buchung, bei der ein logisch nicht passender Steuerschlüssel ausgewählt wurde.',
+ 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => 'Es gibt mindestens eine Einkaufs- oder Verkaufsrechnung, für die Lx-Office einen Steuerschlüssel ungleich 0 verzeichnet hat, obwohl für Warenbestandsbuchugen bei Rechnungen nie Steuern gebucht werden.',
+ 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => 'Es gibt mindestens eine Buchung, bei der ein logisch nicht passender Steuerschlüssel ausgewählt wurde.',
'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, #5, for the transfer of #6.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4, #5, nicht genügend eingelagert, um insgesamt #6 auszulagern.',
'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, for the transfer of #5.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4 nicht genügend eingelagert, um insgesamt #5 auszulagern.',
'There is not enough left of \'#1\' in bin \'#2\' for the removal of #3.' => 'In Lagerplatz \'#2\' ist nicht genug von \'#1\' vorhanden, um #3 zu entnehmen.',
'There is nothing to do in this step.' => 'In diesem Schritt gibt es nichts mehr zu tun.',
'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => 'Deswegen muss man den gleichen Artikel nicht mehr mehrmals anlegen, wenn er in verschiedenen Steuerzonen gehandelt werden soll.',
'These units can be based on other units so that Lx-Office can convert prices when the user switches from one unit to another.' => 'Diese Einheiten können auf anderen Einheiten basieren, sodass Lx-Office Preise umrechnen kann, wenn der Benutzer von einer Einheit zu einer anderen Wechselt.',
- 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => 'Dieser Block ist nur dann gültig, wenn das Konto KEIN Buchungskonto ist, und wenn ein gültiger Steuerschlüssel für das Konto existiert. Wird das Konto als Buchungskonto markiert, werden diese Einstellungen entfernt.',
- 'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
+ 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => 'Dieser Block ist nur dann gültig, wenn das Konto KEIN Buchungskonto ist, und wenn ein gültiger Steuerschlüssel für das Konto existiert. Wird das Konto als Buchungskonto markiert, werden diese Einstellungen entfernt.',
+ 'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
'This corresponds to Lx-Office\'s behavior prior to version 2.4.4.' => 'Dieses entspricht dem Verhalten von Lx-Office vor Version 2.4.4.',
- 'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
+ 'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
'This customer number is already in use.' => 'Diese Kundennummer wird bereits verwendet.',
'This group will be called "Full Access".' => 'Diese Gruppe wird "Vollzugriff" genannt.',
'This installation uses an unknown chart of accounts ("#1"). This database upgrade cannot create standard buchungsgruppen automatically.' => 'Diese Installation benutzt einen unbekannten Kontenrahmen ("#1"). Dieses Datenbankupgrade kann die Standardbuchungsgruppen nicht automatisch anlegen.',
'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => 'In diesem Schritt werden bestehende Datenbanken gesucht. Es werden noch keine Änderungen vorgenommen!',
- 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
- 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
- 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
+ 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
+ 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
+ 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
'This transaction has to be split into several transactions manually.' => 'Diese Buchung muss manuell in mehrere Buchungen aufgeteilt werden.',
'This update will change the nature the onhand of goods is tracked.' => 'Dieses update ändert die Art und Weise wie Lagermengen gezält werden.',
'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => 'Dieses Upgradescript versucht, bei allen bestehenden Artikeln neu erstellte Buchungsgruppen zuzuordnen.',
'To (email)' => 'An',
'To (time)' => 'Bis',
'To Date' => 'Bis',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Um einer Gruppe einen neuen Benutzer hinzuzufügen, ändern und speichern Sie am einfachsten einen bestehenden Benutzernamen. Unter dem neuen Namen wird dann ein Benutzer mit denselben Einstellungen angelegt.',
+ 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Um einer Gruppe einen neuen Benutzer hinzuzufügen, ändern und speichern Sie am einfachsten einen bestehenden Benutzernamen. Unter dem neuen Namen wird dann ein Benutzer mit denselben Einstellungen angelegt.',
'Top' => 'Oben',
'Top (CSS)' => 'Oben (mit CSS)',
'Top (CSS) new' => 'Oben (mit CSS, neu)',
'Top (Javascript)' => 'Oben (mit Javascript)',
'Top (XUL; only for Mozilla Firefox)' => 'Oben + links (XUL, nur Mozilla Firefox)',
'Top 100' => 'Top 100',
- 'Top 100 hinzufuegen' => 'Top 100 hinzufügen',
+ 'Top 100 hinzufuegen' => 'Top 100 hinzufügen',
'Top Level' => 'Hauptartikelbezeichnung',
'Total' => 'Summe',
- 'Total Fees' => 'Kumulierte Gebühren',
+ 'Total Fees' => 'Kumulierte Gebühren',
'Total stock value' => 'Gesamter Bestandswert',
'Totals' => 'Summen',
'Trade Discount' => 'Rabatt',
'Transaction %d cancelled.' => 'Buchung %d erfolgreich storniert.',
'Transaction Date missing!' => 'Buchungsdatum fehlt!',
'Transaction ID missing.' => 'Die Buchungs-ID fehlt.',
- 'Transaction deleted!' => 'Buchung gelöscht!',
+ 'Transaction deleted!' => 'Buchung gelöscht!',
'Transaction description' => 'Vorgangsbezeichnung',
'Transaction has already been cancelled!' => 'Diese Buchung wurde bereits storniert.',
'Transaction has been split on both the credit and the debit side' => 'Sowohl auf der Soll- als auch auf der Haben-Seite gesplittete Buchung',
'USTVA 2005' => 'USTVA 2005',
'USTVA 2006' => 'USTVA 2006',
'USTVA 2007' => 'USTVA 2007',
- 'USTVA-Hint: Method' => 'Wenn Sie Ist-Versteuert sind, wählen Sie die Einnahmen-/Überschuß-Rechnung aus. Sind Sie Soll-Versteuert und bilanzverpflichtet, dann wählen Sie Bilanz aus.',
- 'USTVA-Hint: Tax Authoritys' => 'Bitte das Bundesland UND die Stadt bzw. den Einzugsbereich Ihres zuständigen Finanzamts auswählen.',
+ 'USTVA-Hint: Method' => 'Wenn Sie Ist-Versteuert sind, wählen Sie die Einnahmen-/Überschuß-Rechnung aus. Sind Sie Soll-Versteuert und bilanzverpflichtet, dann wählen Sie Bilanz aus.',
+ 'USTVA-Hint: Tax Authoritys' => 'Bitte das Bundesland UND die Stadt bzw. den Einzugsbereich Ihres zuständigen Finanzamts auswählen.',
'USt-IdNr.' => 'USt-IdNr.',
'USt-Konto' => 'USt-Konto',
'UStVA' => 'UStVA',
'UStVa' => 'UStVa',
'UStVa Einstellungen' => 'UStVa Einstellungen',
'Unbalanced Ledger' => 'Bilanzfehler',
- 'Unchecked custom variables will not appear in orders and invoices.' => 'Unmarkierte Variablen werden für diesen Artikel nicht in Aufträgen und Rechnungen angezeigt.',
+ 'Unchecked custom variables will not appear in orders and invoices.' => 'Unmarkierte Variablen werden für diesen Artikel nicht in Aufträgen und Rechnungen angezeigt.',
'Unfinished follow-ups' => 'Nicht erledigte Wiedervorlagen',
'Unit' => 'Einheit',
'Unit missing.' => 'Die Einheit fehlt.',
- 'Unit of measure' => 'Maßeinheit',
+ 'Unit of measure' => 'Maßeinheit',
'Units marked for deletion will be deleted upon saving.' => 'Einheiten, die zum Löschen markiert sind, werden beim Speichern gelöscht.',
'Units that have already been used (e.g. for parts and services or in invoices or warehouse transactions) cannot be changed.' => 'Einheiten, die bereits in Benutzung sind (z.B. bei einer Warendefinition, einer Rechnung oder bei einer Lagerbuchung) können nachträglich nicht mehr verändert werden.',
'Unknown Category' => 'Unbekannte Kategorie',
- 'Unknown Link' => 'Unbekannte Verknüpfung',
+ 'Unknown Link' => 'Unbekannte Verknüpfung',
'Unknown chart of accounts' => 'Unbekannter Kontenrahmen',
'Unknown dependency \'%s\'.' => 'Unbekannte Abhängigkeit \'%s\'.',
'Unknown problem type.' => 'Unbekannter Problem-Typ',
'Update' => 'Erneuern',
'Update Dataset' => 'Datenbank aktualisieren',
'Update Prices' => 'Preise aktualisieren',
- 'Update SKR04: new tax account 3804 (19%)' => 'Update SKR04: neues Steuerkonto 3804 (19%) für innergemeinschaftlichen Erwerb',
+ 'Update SKR04: new tax account 3804 (19%)' => 'Update SKR04: neues Steuerkonto 3804 (19%) fÃ\83Å\92r innergemeinschaftlichen Erwerb',
'Update complete' => 'Update beendet.',
'Update prices' => 'Preise aktualisieren',
'Update?' => 'Aktualisieren?',
'User Config' => 'Einstellungen',
'User Login' => 'Als Benutzer anmelden',
'User data migration' => 'Benutzerdatenmigration',
- 'User deleted!' => 'Benutzer gelöscht!',
+ 'User deleted!' => 'Benutzer gelöscht!',
'User migration complete' => 'Benutzermigration abgeschlossen',
'User name' => 'Benutzername',
'User saved!' => 'Benutzer gespeichert!',
'Username' => 'Benutzername',
'Ust-IDNr' => 'USt-IdNr.',
- 'Valid from' => 'Gültig ab',
- 'Valid until' => 'gültig bis',
+ 'Valid from' => 'Gültig ab',
+ 'Valid until' => 'gültig bis',
'Value' => 'Wert',
'Variable' => 'Variable',
'Variable Description' => 'Datenfeldbezeichnung',
'Vendor Name' => 'Lieferantenname',
'Vendor Number' => 'Lieferantennummer',
'Vendor Order Number' => 'Bestellnummer beim Lieferanten',
- 'Vendor deleted!' => 'Lieferant gelöscht!',
+ 'Vendor deleted!' => 'Lieferant gelöscht!',
'Vendor details' => 'Lieferantendetails',
'Vendor missing!' => 'Lieferant fehlt!',
'Vendor not on file or locked!' => 'Dieser Lieferant existiert nicht oder ist gesperrt.',
'Warehouse To' => 'Ziellager',
'Warehouse content' => 'Lagerbestand',
'Warehouse deleted.' => 'Lager gelöscht.',
- 'Warehouse management' => 'Lagerverwaltung/Bestandsveränderung',
+ 'Warehouse management' => 'Lagerverwaltung/Bestandsveränderung',
'Warehouse saved.' => 'Lager gespeichert.',
'Warehouses' => 'Lager',
'Warnings during template upgrade' => 'Warnungen bei Aktualisierung der Dokumentenvorlagen',
'Weight unit' => 'Gewichtseinheit',
'What <b>term</b> you are looking for?' => 'Nach welchem <b>Begriff</b> wollen Sie suchen?',
'What type of item is this?' => 'Was ist dieser Artikel?',
- 'With Extension Of Time' => 'mit Dauerfristverlängerung',
+ 'With Extension Of Time' => 'mit Dauerfristverlängerung',
'Workflow Delivery Order' => 'Workflow Lieferschein',
'Workflow purchase_order' => 'Workflow Lieferantenauftrag',
'Workflow request_quotation' => 'Workflow Preisanfrage',
'Workflow sales_quotation' => 'Workflow Angebot',
'Wrong Period' => 'Falscher Zeitraum',
'Wrong date format!' => 'Falsches Datumsformat!',
- 'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
- 'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
+ 'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
+ 'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
'YYYY' => 'JJJJ',
'Year' => 'Jahr',
- 'Year End' => 'Jahresende',
- 'Yearly' => 'jährlich',
- 'Yearly taxreport not yet implemented' => 'Jährlicher Steuerreport für dieses Ausgabeformat noch nicht implementiert',
+ 'Yearly' => 'jährlich',
+ 'Yearly taxreport not yet implemented' => 'Jährlicher Steuerreport für dieses Ausgabeformat noch nicht implementiert',
'Yes' => 'Ja',
'Yes, included by default' => 'Ja, standardmäßig an',
'Yes/No (Checkbox)' => 'Ja/Nein (Checkbox)',
'You are logged out!' => 'Auf Wiedersehen!',
'You can also create new units now.' => 'Sie können jetzt auch neue Einheiten anlegen.',
- 'You can also delete this transaction and re-enter it manually.' => 'Alternativ können Sie die Buchung auch mit löschen lassen und sie anschließend neu eingeben.',
- 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => 'Sie haben die Möglichkeit, die Buchung zu korrigieren, indem Sie in den Drop-Down-Boxen die richtigen Steuerschlüssel auswählen und anschließend auf den Button "Buchung korrigieren" drücken.',
+ 'You can also delete this transaction and re-enter it manually.' => 'Alternativ können Sie die Buchung auch mit löschen lassen und sie anschließend neu eingeben.',
+ 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => 'Sie haben die Möglichkeit, die Buchung zu korrigieren, indem Sie in den Drop-Down-Boxen die richtigen Steuerschlüssel auswählen und anschließend auf den Button "Buchung korrigieren" drücken.',
'You can create a missing dataset by going back and chosing "Create Dataset".' => 'Sie können eine fehlende Datenbank erstellen, indem Sie jetzt zuück gehen und den Punkt "Neue Datenbank anlegen" wählen.',
'You can create warehouses and bins via the menu "System -> Warehouses".' => 'Sie können Lager und Lagerplätze über das Menü "System -> Lager" anlegen.',
'You can declare different translations for singular and plural for each unit (e.g. "day" and "days).' => 'Bei den Übersetzungen können Sie unterschiedliche Varianten für singular und plural angeben (z.B. "day" und "days").',
- 'You can either create a new database or chose an existing database.' => 'Sie können entweder eine neue Datenbank erstellen oder eine existierende auswählen.',
+ 'You can either create a new database or chose an existing database.' => 'Sie können entweder eine neue Datenbank erstellen oder eine existierende auswählen.',
'You can only delete datasets that are not in use.' => 'Sie können nur Datenbanken löschen, die momentan nicht in Benutzung sind.',
- 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => 'Sie können im Langtext und allen Übersetzungen die folgenden Variablen benutzen, die vor der Ausgabe von Lx-Office automatisch ersetzt werden:',
- 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => 'Sie können den Preis für Preisgruppe "#1" um einen negativen Prozentwert anpassen.',
+ 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => 'Sie können im Langtext und allen Übersetzungen die folgenden Variablen benutzen, die vor der Ausgabe von Lx-Office automatisch ersetzt werden:',
+ 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => 'Sie können den Preis für Preisgruppe "#1" um einen negativen Prozentwert anpassen.',
'You cannot continue before all required modules are installed.' => 'Sie können nicht fortfahren, bevor alle benötigten Pakete installiert sind.',
'You cannot continue until all unknown units have been mapped to known ones.' => 'Sie können nicht fortfahren, bis alle unbekannten Einheiten in neue Einheiten umgewandelt wurden.',
- 'You cannot create an invoice for delivery orders for different customers.' => 'Sie können keine Rechnung zu Lieferscheinen für verschiedene Kunden erstellen.',
- 'You cannot create an invoice for delivery orders from different vendors.' => 'Sie können keine Rechnung aus Lieferscheinen von verschiedenen Lieferanten erstellen.',
+ 'You cannot create an invoice for delivery orders for different customers.' => 'Sie können keine Rechnung zu Lieferscheinen für verschiedene Kunden erstellen.',
+ 'You cannot create an invoice for delivery orders from different vendors.' => 'Sie können keine Rechnung aus Lieferscheinen von verschiedenen Lieferanten erstellen.',
'You did not enter a name!' => 'Sie haben keinen Namen eingegeben!',
'You do not have the permissions to access this function.' => 'Sie verfügen nicht über die notwendigen Rechte, um auf diese Funktion zuzugreifen.',
'You have entered or selected the following shipping address for this customer:' => 'Sie haben die folgende Lieferadresse eingegeben oder ausgewählt:',
'You have not added bank accounts yet.' => 'Sie haben noch keine Bankkonten angelegt.',
- 'You have not selected any delivery order.' => 'Sie haben keinen Lieferschein ausgewählt.',
- 'You have not selected any export.' => 'Sie haben keinen Export ausgewählt.',
- 'You have not selected any item.' => 'Sie haben keine noch nicht gebuchten Einträge ausgewählt.',
- 'You have selected none of the invoices.' => 'Sie haben keine der Rechnungen ausgewählt.',
+ 'You have not selected any delivery order.' => 'Sie haben keinen Lieferschein ausgewählt.',
+ 'You have not selected any export.' => 'Sie haben keinen Export ausgewählt.',
+ 'You have not selected any item.' => 'Sie haben keine noch nicht gebuchten Einträge ausgewählt.',
+ 'You have selected none of the invoices.' => 'Sie haben keine der Rechnungen ausgewählt.',
'You have to chose a dimension unit and a service unit which will then be assigned to those entries.' => 'Sie müssen eine Maß- und eine Dienstleistungseinheit auswählen, die diesen Waren und Dienstleistungen, denen noch keine Einheit zugeordnet ist, zugeordnet wird.',
'You have to chose which unit to save for each of them.' => 'Sie müssen für jeden Artikel die neue Einheit auswählen.',
'You have to create at least one group, grant it access to Lx-Office\'s functions and assign users to it.' => 'Sie müssen mindestens eine Benutzergruppe anlegen, ihr Zugriff auf die verschiedenen Funktionsbereiche von Lx-Office gewähren und Benutzer dieser Gruppe zuordnen.',
'You have to create new Buchungsgruppen for all the combinations of inventory, income and expense accounts that have been used already.' => 'Sie müssen neue Buchungsgruppen für alle Kombinationen aus Inventar-, Erlös- und Aufwandskonto, die bereits benutzt wurden.',
- 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to enter the SEPA creditor ID in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen die SEPA-Kreditoren-Identifikation in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => 'Sie müssen zumindest die Kontonummer, die Bankleitzahl, die IBAN und den BIC angeben.',
- 'You have to specify a department.' => 'Sie müssen eine Abteilung wählen.',
- 'You have to specify an execution date for each antry.' => 'Sie müssen für jeden zu buchenden Eintrag ein Ausführungsdatum angeben.',
+ 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
+ 'You have to enter the SEPA creditor ID in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen die SEPA-Kreditoren-Identifikation in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
+ 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => 'Sie müssen zumindest die Kontonummer, die Bankleitzahl, die IBAN und den BIC angeben.',
+ 'You have to specify a department.' => 'Sie müssen eine Abteilung wählen.',
+ 'You have to specify an execution date for each antry.' => 'Sie müssen für jeden zu buchenden Eintrag ein Ausführungsdatum angeben.',
'You must chose a user.' => 'Sie müssen einen Benutzer auswählen.',
- 'You should create a backup of the database before proceeding because the backup might not be reversible.' => 'Sie sollten eine Sicherungskopie der Datenbank erstellen, bevor Sie fortfahren, da die Aktualisierung unter Umständen nicht umkehrbar ist.',
+ 'You should create a backup of the database before proceeding because the backup might not be reversible.' => 'Sie sollten eine Sicherungskopie der Datenbank erstellen, bevor Sie fortfahren, da die Aktualisierung unter Umständen nicht umkehrbar ist.',
'You will now be forwarded to the administration panel.' => 'Sie werden nun zum Administrationsbereich weitergeleitet.',
'You\'re not editing a file.' => 'Sie bearbeiten momentan keine Datei.',
'You\'ve already chosen the following limitations:' => 'Sie haben bereits die folgenden Einschränkungen vorgenommen:',
- 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Ihre PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Sie müssen deshalb Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
+ 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Ihre PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Sie müssen deshalb Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
'Your TODO list' => 'Ihre Aufgabenliste',
- 'Your browser does not currently support Javascript.' => 'Ihr Browser unterstützt im Moment kein Javascript!',
+ 'Your browser does not currently support Javascript.' => 'Ihr Browser unterstützt im Moment kein Javascript!',
'Your download does not exist anymore. Please re-run the DATEV export assistant.' => 'Ihr Download existiert nicht mehr. Bitte starten Sie den DATEV-Exportassistenten erneut.',
'Zeitpunkt' => 'Zeitpunkt',
'Zeitraum' => 'Zeitraum',
'[email]' => '[email]',
'account_description' => 'Beschreibung',
'accrual' => 'Bilanzierung (Soll-Versteuerung)',
- 'all entries' => 'alle Einträge',
+ 'all entries' => 'alle Einträge',
'ap_aging_list' => 'liste_offene_verbindlichkeiten',
'ar_aging_list' => 'liste_offene_forderungen',
'as at' => 'zum Stand',
'assembly_list' => 'erzeugnisliste',
- 'back' => 'zurück',
+ 'back' => 'zurück',
'bank_collection_payment_list_#1' => 'bankeinzugszahlungsliste_#1',
'bank_transfer_payment_list_#1' => 'ueberweisungszahlungsliste_#1',
'bankaccounts' => 'Bankkonten',
'bin_list' => 'Lagerliste',
'bis' => 'bis',
'button' => '?',
- 'cash' => 'E/Ü-Rechnung (Ist-Versteuerung)',
+ 'cash' => 'E/Ü-Rechnung (Ist-Versteuerung)',
'chargenumber #1' => 'Chargennummer #1',
'chart_of_accounts' => 'kontenuebersicht',
- 'choice' => 'auswählen',
- 'choice part' => 'Artikel auswählen',
+ 'choice' => 'auswählen',
+ 'choice part' => 'Artikel auswählen',
'click here to edit cvars' => 'Klicken Sie hier, um nach benutzerdefinierten Variablen zu suchen',
- 'close' => 'schließen',
+ 'close' => 'schließen',
'closed' => 'geschlossen',
'companylogo_subtitle' => 'Lizenziert für',
'config/authentication.pl: Key "DB_config" is missing.' => 'config/authentication.pl: Das Schlüsselwort "DB_config" fehlt.',
'customer' => 'Kunde',
'customer_list' => 'kundenliste',
'debug' => 'Debug',
- 'delete' => 'Löschen',
+ 'delete' => 'Löschen',
'deliverydate' => 'Lieferdatum',
'direct debit' => 'Lastschrift',
'disposed' => 'Entsorgung',
'eMail?' => 'eMail?',
'ea' => 'St.',
'emailed to' => 'gemailt an',
- 'executed' => 'ausgeführt',
+ 'executed' => 'ausgeführt',
'female' => 'weiblich',
'follow_up_list' => 'wiedervorlageliste',
'for' => 'für',
- 'for Period' => 'für den Zeitraum',
+ 'for Period' => 'für den Zeitraum',
'found' => 'Gefunden',
'from (time)' => 'von',
'general_ledger_list' => 'buchungsjournal',
'history search engine' => 'Historien Suchmaschine',
'invoice' => 'Rechnung',
'invoice_list' => 'debitorenbuchungsliste',
- 'lead deleted!' => 'Kundenquelle gelöscht',
+ 'lead deleted!' => 'Kundenquelle gelöscht',
'lead saved!' => 'Kundenquelle geichert',
'list' => 'auflisten',
'list_of_payments' => 'zahlungsausgaenge',
'list_of_receipts' => 'zahlungseingaenge',
'list_of_transactions' => 'buchungsliste',
'logout' => 'abmelden',
- 'male' => 'männlich',
+ 'male' => 'männlich',
'mark as paid' => 'als bezahlt markieren',
'missing' => 'Fehlbestand',
'month' => 'Monatliche Abgabe',
'no bestbefore' => 'keine Mindesthaltbarkeit',
'no chargenumber' => 'keine Chargennummer',
'none (pricegroup)' => 'keine',
- 'not executed' => 'nicht ausgeführt',
+ 'not executed' => 'nicht ausgeführt',
'not transferred in yet' => 'noch nicht eingelagert',
'not transferred out yet' => 'noch nicht ausgelagert',
- 'not yet executed' => 'Noch nicht ausgeführt',
+ 'not yet executed' => 'Noch nicht ausgeführt',
'number' => 'Nummer',
'oe.pl::search called with unknown type' => 'oe.pl::search mit unbekanntem Typ aufgerufen',
'open' => 'Offen',
'plural first char' => 'P',
'pos_bilanz' => 'Bilanz',
'pos_bwa' => 'BWA',
- 'pos_eur' => 'E/ÜR',
+ 'pos_eur' => 'E/ÜR',
'pos_ustva' => 'UStVA',
'posted!' => 'gebucht',
'print' => 'drucken',
'purchase_delivery_order_list' => 'lieferscheinliste_einkauf',
'purchase_order' => 'Auftrag',
'purchase_order_list' => 'lieferantenauftragsliste',
- 'quarter' => 'Vierteljährliche (quartalsweise) Abgabe',
+ 'quarter' => 'Vierteljährliche (quartalsweise) Abgabe',
'quotation_list' => 'angebotsliste',
'release_material' => 'Materialausgabebe',
'report_generator_dispatch_to is not defined.' => 'report_generator_dispatch_to ist nicht definiert.',
'report_generator_nextsub is not defined.' => 'report_generator_nextsub ist nicht definiert.',
'request_quotation' => 'Angebotsanforderung',
- 'reset' => 'zurücksetzen',
+ 'reset' => 'zurücksetzen',
'return_material' => 'Materialrückgabe',
'rfq_list' => 'anfragenliste',
'sales tax identification number' => 'USt-IdNr.',
'tax_percent' => 'Prozentsatz',
'tax_rate' => 'Prozent',
'tax_taxdescription' => 'Steuername',
- 'tax_taxkey' => 'Steuerschlüssel',
+ 'tax_taxkey' => 'Steuerschlüssel',
'taxnumber' => 'Automatikkonto',
'to (date)' => 'bis',
'to (time)' => 'bis',
'up' => 'hoch',
'use program settings' => 'benutze Programmeinstellungen',
'used' => 'Verbraucht',
- 'valid from' => 'Gültig ab',
+ 'valid from' => 'Gültig ab',
'vendor' => 'Lieferant',
'vendor_invoice_list' => 'kreditorenbuchungsliste',
'vendor_list' => 'lieferantenliste',
[HTML]
-order=& ä ö ü Ä Ö Ü ß " < >
-ä=ä
-ö=ö
-ü=ü
-Ä=Ä
-Ö=Ö
-Ü=Ü
-ß=ß
+order=& ä ö ü Ä Ö Ü ß " < >
+ä=ä
+ö=ö
+ü=ü
+Ä=Ä
+Ö=Ö
+Ü=Ü
+ß=ß
"="
&=&
<=<
\n=<br>
[Template/LaTeX]
-order=\\ <pagebreak> & \n \r " $ % _ # ^ { } < > £ ± \xe1 ² ³ °
+order=\\ <pagebreak> & \n \r " $ % _ # ^ { } < > £ ± \xe1 ² ³ °
\\=\\textbackslash\s
<pagebreak>=
"=''
}=\\}
<=$<$
>=$>$
-£=\\pounds\s
+£=\\pounds\s
\n=\\newline\s
\r=
-±=$\\pm$
+±=$\\pm$
\xe1=$\\bullet$
^=\\^\\\s
-²=$^2$
-³=$^3$
-°=$^\\circ$
+²=$^2$
+³=$^3$
+°=$^\\circ$
[Template/OpenDocument]
order=& < > " ' \x80 \n \r
\r=
[filenames]
-order=ä ö ü Ä Ö Ü ß
-ä=ae
-ö=oe
-ü=ue
-Ä=Ae
-Ö=Oe
-Ü=Ue
-ß=ss
+order=ä ö ü Ä Ö Ü ß
+ä=ae
+ö=oe
+ü=ue
+Ä=Ae
+Ö=Oe
+Ü=Ue
+ß=ss
2 => 'zwei',
3 => 'drei',
4 => 'vier',
- 5 => 'fünf',
+ 5 => 'fünf',
6 => 'sechs',
7 => 'sieben',
8 => 'acht',
9 => 'neun',
10 => 'zehn',
11 => 'elf',
- 12 => 'zwölf',
+ 12 => 'zwölf',
13 => 'dreizehn',
14 => 'vierzehn',
- 15 => 'fünfzehn',
+ 15 => 'fünfzehn',
16 => 'sechzehn',
17 => 'siebzehn',
18 => 'achtzehn',
20 => 'zwanzig',
30 => 'dreissig',
40 => 'vierzig',
- 50 => 'fünfzig',
+ 50 => 'fünfzig',
60 => 'sechzig',
70 => 'siebzig',
80 => 'achtzig',
#!/usr/bin/perl
-# -*- coding: iso-8859-15; -*-
-# vim: fenc=ISO-8859-15
+# -*- coding: utf-8; -*-
+# vim: fenc=UTF-8
# These are all the texts to build the translations files.
# The file has the form of 'english text' => 'foreign text',
'<%total%> -- Amount payable' => '<%total%> -- Noch zu bezahlender Betrag',
'<%total_wo_skonto%> -- Amount payable less discount' => '<%total_wo_skonto%> -- Noch zu bezahlender Betrag abzüglich Skonto',
'*/' => '*/',
- '---please select---' => '---bitte auswählen---',
+ '---please select---' => '---bitte auswählen---',
'...after loggin in' => '...nach dem Anmelden',
'...done' => '...fertig',
'...on the TODO list' => '...auf der Aufgabenliste',
'A Buchungsgruppe consists of a descriptive name and the account numbers for the income and expense accounts for those four tax zones as well as the inventory account number.' => 'Eine Buchungsgruppe besteht aus einem deskriptiven Namen, den Erlös- und Aufwandskonten für diese vier Steuerzonen sowie aus einem Inventarkonto.',
'A group named "Full Access" has been created.' => 'Eine Gruppe namens "Vollzugriff" wurde angelegt.',
'A group with that name does already exist.' => 'Eine Gruppe mit diesem Namen gibt es bereits.',
- 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => 'Die Bedienung von Lx-Office wurde an vielen Stellen mit Javascript verbessert. Obwohl es derzeit möglich ist, jeden Aspekt von Lx-Office auch ohne Javascript zu benutzen, empfehlen wir es. In einer zukünftigen Version wird Javascript eventuell notwendig sein um weitergehende Features zu benutzen.',
+ 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => 'Die Bedienung von Lx-Office wurde an vielen Stellen mit Javascript verbessert. Obwohl es derzeit möglich ist, jeden Aspekt von Lx-Office auch ohne Javascript zu benutzen, empfehlen wir es. In einer zukünftigen Version wird Javascript eventuell notwendig sein um weitergehende Features zu benutzen.',
'A temporary directory could not be created:' => 'Ein temporäres Verzeichnis konnte nicht erstellt werden:',
- 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => 'Eine temporäre Datei konnte nicht angelegt werden. Bitte stellen Sie sicher, dass das Verzeichnis "#1" vom Webserver beschrieben werden darf.',
+ 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => 'Eine temporäre Datei konnte nicht angelegt werden. Bitte stellen Sie sicher, dass das Verzeichnis "#1" vom Webserver beschrieben werden darf.',
'A temporary file could not be created:' => 'Eine temporäre Datei konnte nicht erstellt werden:',
'A unit with this name does already exist.' => 'Eine Einheit mit diesem Namen existiert bereits.',
- 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => 'Eine als \'editierbar\' markierte Variable kann in jedem Angebot, Auftrag, jeder Rechnung etc für jede Position geändert werden.',
- 'ADDED' => 'Hinzugefügt',
+ 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => 'Eine als \'editierbar\' markierte Variable kann in jedem Angebot, Auftrag, jeder Rechnung etc für jede Position geändert werden.',
+ 'ADDED' => 'Hinzugefügt',
'AP' => 'Einkauf',
'AP Aging' => 'Verbindlichkeiten',
'AP Transaction' => 'Kreditorenbuchung',
'AP Transaction Storno (one letter abbreviation)' => 'S',
'AP Transaction with Storno (abbreviation)' => 'K(S)',
'AP Transactions' => 'Eingangsrechnungen',
- 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
+ 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
'AR' => 'Verkauf',
'AR Aging' => 'Forderungen',
'AR Transaction' => 'Debitorenbuchung',
'Account Category C' => 'Kosten',
'Account Category E' => 'Aufwandskonto',
'Account Category G' => '?Gegenkonto?',
- 'Account Category I' => 'Erlöskonto',
+ 'Account Category I' => 'Erlöskonto',
'Account Category L' => 'Passiva/Mittelherkunft',
'Account Category Q' => 'Passiva',
'Account Description missing!' => 'Beschreibung fehlt!',
'Account Link AP_paid' => 'Verbindlichkeiten Zahlungsausgang',
'Account Link AP_tax' => 'Verbindlichkeiten Steuer',
'Account Link AR' => 'Verkauf',
- 'Account Link AR_amount' => 'Forderungen Erlöskonto',
+ 'Account Link AR_amount' => 'Forderungen Erlöskonto',
'Account Link AR_paid' => 'Forderungen Zahlungseingang',
'Account Link AR_tax' => 'Forderungen Steuer',
'Account Link CT_tax' => 'Kunde/Lieferant Steuer',
'Account Link IC' => 'Inventar',
'Account Link IC_cogs' => 'Warenliste Aufwandskonto',
'Account Link IC_expense' => 'Dienstleistungen Aufwandskonto',
- 'Account Link IC_income' => 'Dienstleistungen Erlöskonto',
- 'Account Link IC_sale' => 'Warenliste Erlöskonto',
+ 'Account Link IC_income' => 'Dienstleistungen Erlöskonto',
+ 'Account Link IC_sale' => 'Warenliste Erlöskonto',
'Account Link IC_taxpart' => 'Warenliste Steuer',
'Account Link IC_taxservice' => 'Dienstleistungen Steuer',
'Account Number' => 'Kontonummer',
'Account Nummer' => 'Kontonummer',
'Account Type' => 'Kontoart',
'Account Type missing!' => 'Kontoart fehlt!',
- 'Account deleted!' => 'Konto gelöscht!',
+ 'Account deleted!' => 'Konto gelöscht!',
'Account for fees' => 'Konto für Gebühren',
'Account for interest' => 'Konto für Zinsen',
'Account number' => 'Kontonummer',
'Add Follow-Up for #1' => 'Wiedervorlage für #1 erstellen',
'Add General Ledger Transaction' => 'Dialogbuchen',
'Add Group' => 'Warengruppe erfassen',
- 'Add Language' => 'Sprache hinzufügen',
+ 'Add Language' => 'Sprache hinzufügen',
'Add Lead' => 'Kundenquelle erfassen',
'Add License' => 'Neue Lizenz',
'Add Part' => 'Neuer Artikel',
- 'Add Payment Terms' => 'Zahlungskonditionen hinzufügen',
+ 'Add Payment Terms' => 'Zahlungskonditionen hinzufügen',
'Add Price Factor' => 'Preisfaktor erfassen',
'Add Pricegroup' => 'Preisgruppe erfassen',
- 'Add Printer' => 'Drucker hinzufügen',
+ 'Add Printer' => 'Drucker hinzufügen',
'Add Project' => 'Neues Projekt',
'Add Purchase Delivery Order' => 'Lieferschein (Eingang) erfassen',
'Add Purchase Order' => 'Einkaufsbestellung',
'Add Sales Invoice' => 'Neue Rechnung',
'Add Sales Order' => 'Neuer Auftrag',
'Add Service' => 'Neue Dienstleistung',
- 'Add Storno Credit Note' => 'Gutschrift Storno hinzufügen',
+ 'Add Storno Credit Note' => 'Gutschrift Storno hinzufügen',
'Add Transaction' => 'Dialogbuchen',
'Add User' => 'Neuer Benutzer',
'Add Vendor' => 'Neuer Lieferant',
'Add bank account' => 'Bankkonto erfassen',
'Add custom variable' => 'Erweitertes Datenfeld anlegen.',
'Add note' => 'Notiz erfassen',
- 'Add to group' => 'Zu Gruppe hinzufügen',
+ 'Add to group' => 'Zu Gruppe hinzufügen',
'Add unit' => 'Einheit hinzufügen',
'Address' => 'Adresse',
'Administration' => 'Administration',
'All Datasets up to date!' => 'Alle Datenbanken sind auf aktuellem Stand.',
'All changes in that file have been reverted.' => 'Alle Änderungen in dieser Datei wurden rückgängig gemacht.',
'All database upgrades have been applied.' => 'Alle Datenbankupdates wurden eingespielt.',
- 'All general ledger entries' => 'Alle Hauptbucheinträge',
- 'All of the exports you have selected were already closed.' => 'Alle von Ihnen ausgewählten Exporte sind bereits abgeschlossen.',
+ 'All general ledger entries' => 'Alle Hauptbucheinträge',
+ 'All of the exports you have selected were already closed.' => 'Alle von Ihnen ausgewählten Exporte sind bereits abgeschlossen.',
'All reports' => 'Alle Berichte (Kontenübersicht, Summen- u. Saldenliste, GuV, BWA, Bilanz, Projektbuchungen)',
- 'All the selected exports have already been closed, or all of their items have already been executed.' => 'Alle ausgewählten Exporte sind als abgeschlossen markiert, oder für alle Einträge wurden bereits Zahlungen verbucht.',
+ 'All the selected exports have already been closed, or all of their items have already been executed.' => 'Alle ausgewählten Exporte sind als abgeschlossen markiert, oder für alle Einträge wurden bereits Zahlungen verbucht.',
'Allow access' => 'Zugriff erlauben',
'Allow the following users access to my follow-ups:' => 'Erlaube den folgenden Benutzern Zugriff auf meine Wiedervorlagen:',
'Alternatively you can create a new part which will then be selected.' => 'Sie können auch einen neuen Artikel anlegen, der dann automatisch ausgewählt wird.',
'Alternatively you can skip this step and create groups yourself.' => 'Alternativ können Sie diesen Schritt überspringen und selber Gruppen anlegen.',
'Amended Advance Turnover Tax Return' => 'Berichtigte Anmeldung',
- 'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
+ 'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
'Amount' => 'Betrag',
- 'Amount Due' => 'Betrag fällig',
- 'Amount has to be greater then zero! Wrong row number: ' => '"Betrag" muss größer Null sein. Fehlerhafte Zeile: ',
+ 'Amount Due' => 'Betrag fällig',
+ 'Amount has to be greater then zero! Wrong row number: ' => '"Betrag" muss größer Null sein. Fehlerhafte Zeile: ',
'Annotations' => 'Hilfe',
'Another user with the login #1 does already exist.' => 'Es existiert bereits ein anderer Benutzer mit diesem Login.',
'Ap aging on %s' => 'Offene Verbindlichkeiten zum %s',
'Application Error. No Format given' => 'Fehler in der Anwendung. Das Ausgabeformat fehlt.',
'Application Error. Wrong Format' => 'Fehler in der Anwendung. Falsches Format: ',
- 'Applying #1:' => 'Führe #1 aus:',
- 'Approximately #1 prices will be updated.' => 'Ungefähr #1 Preise werden aktualisiert.',
+ 'Applying #1:' => 'Führe #1 aus:',
+ 'Approximately #1 prices will be updated.' => 'Ungefähr #1 Preise werden aktualisiert.',
'Apr' => 'Apr',
'April' => 'April',
'Ar aging on %s' => 'Offene Forderungen zum %s',
'Are you sure you want to delete Delivery Order Number #1?' => 'Sind Sie sicher, dass Sie Lieferschein #1 löschen wollen?',
- 'Are you sure you want to delete Invoice Number' => 'Soll die Rechnung mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Order Number' => 'Soll der Auftrag mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Quotation Number' => 'Sind Sie sicher, dass Angebotnummer gelöscht werden soll?',
- 'Are you sure you want to delete Transaction' => 'Buchung wirklich löschen?',
- 'Are you sure you want to remove the marked entries from the queue?' => 'Sind Sie sicher, dass die markierten Einträge von der Warteschlange gelöscht werden sollen?',
+ 'Are you sure you want to delete Invoice Number' => 'Soll die Rechnung mit folgender Nummer wirklich gelöscht werden:',
+ 'Are you sure you want to delete Order Number' => 'Soll der Auftrag mit folgender Nummer wirklich gelöscht werden:',
+ 'Are you sure you want to delete Quotation Number' => 'Sind Sie sicher, dass Angebotnummer gelöscht werden soll?',
+ 'Are you sure you want to delete Transaction' => 'Buchung wirklich löschen?',
+ 'Are you sure you want to remove the marked entries from the queue?' => 'Sind Sie sicher, dass die markierten Einträge von der Warteschlange gelöscht werden sollen?',
'Are you sure you want to update the prices' => 'Sind Sie sicher, dass Sie die Preise aktualisieren wollen?',
- 'Article Code' => 'Artikelkürzel',
- 'Article Code missing!' => 'Artikelkürzel fehlt',
+ 'Article Code' => 'Artikelkürzel',
+ 'Article Code missing!' => 'Artikelkürzel fehlt',
'As a result, the saved onhand values of the present goods can be stored into a warehouse designated by you, or will be reset for a proper warehouse tracking' => 'Als Konsequenz können die gespeicherten Mengen entweder in ein Lager überführt werden, oder für eine frische Lagerverwaltung resettet werden.',
'Assemblies' => 'Erzeugnisse',
'Assembly Description' => 'Erzeugnis-Beschreibung',
'Assets' => 'Aktiva',
'Assign new units' => 'Neue Einheiten zuweisen',
'Assign units' => 'Einheiten zuweisen',
- 'Assistant for general ledger corrections' => 'Assistent für die Korrektur von Hauptbucheinträgen',
- 'Assume Tax Consultant Data in Tax Computation?' => 'Beraterdaten in UStVA übernehmen?',
+ 'Assistant for general ledger corrections' => 'Assistent für die Korrektur von Hauptbucheinträgen',
+ 'Assume Tax Consultant Data in Tax Computation?' => 'Beraterdaten in UStVA übernehmen?',
'At least' => 'Mindestens',
'At least one Perl module that Lx-Office ERP requires for running is not installed on your system.' => 'Mindestes ein Perl-Modul, das Lx-Office ERP zur Ausführung benötigt, ist auf Ihrem System nicht installiert.',
'At most' => 'Höchstens',
'At the moment the transaction looks like this:' => 'Aktuell sieht die Buchung wie folgt aus:',
- 'Attach PDF:' => 'PDF anhängen',
+ 'Attach PDF:' => 'PDF anhängen',
'Attachment' => 'als Anhang',
'Attachment name' => 'Name des Anhangs',
'Attempt to call an undefined sub named \'%s\'' => 'Es wurde versucht, eine nicht definierte Unterfunktion namens \'%s\' aufzurufen.',
- 'Audit Control' => 'Bücherkontrolle',
+ 'Audit Control' => 'Bücherkontrolle',
'Aug' => 'Aug',
'August' => 'August',
'Authentification database creation' => 'Anlegen der Datenbank zur Benutzerauthentifizierung',
'Authentification tables creation' => 'Anlegen der Tabellen zur Benutzerauthentifizierung',
'Auto Send?' => 'Auto. Versand?',
- 'Automatically created invoice for fee and interest for dunning %s' => 'Automatisch erzeugte Rechnung für Gebühren und Zinsen zu Mahnung %s',
+ 'Automatically created invoice for fee and interest for dunning %s' => 'Automatisch erzeugte Rechnung für Gebühren und Zinsen zu Mahnung %s',
'Available qty' => 'Lagerbestand',
'BALANCE SHEET' => 'BILANZ',
'BIC' => 'BIC',
- 'BOM' => 'Stückliste',
+ 'BOM' => 'Stückliste',
'BWA' => 'BWA',
- 'Back' => 'Zurück',
+ 'Back' => 'Zurück',
'Backup Dataset' => 'Datenbank sichern',
'Backup file' => 'Sicherungsdatei',
'Backup of dataset' => 'Sicherung der Datenbank',
'Bank accounts' => 'Bankkonten',
'Bank code' => 'Bankleitzahl',
'Bank collection amount' => 'Einzugsbetrag',
- 'Bank collection payment list for export #1' => 'Bankeinzugszahlungsliste für SEPA-Export #1',
+ 'Bank collection payment list for export #1' => 'Bankeinzugszahlungsliste für SEPA-Export #1',
'Bank collection via SEPA' => 'Bankeinzug via SEPA',
- 'Bank collections via SEPA' => 'Bankeinzüge via SEPA',
- 'Bank transfer amount' => 'Überweisungssumme',
- 'Bank transfer payment list for export #1' => 'Überweisungszahlungsliste für SEPA-Export #1',
- 'Bank transfer via SEPA' => 'SEPA-Überweisung',
- 'Bank transfers via SEPA' => 'SEPA-Überweisungen',
+ 'Bank collections via SEPA' => 'Bankeinzüge via SEPA',
+ 'Bank transfer amount' => 'Überweisungssumme',
+ 'Bank transfer payment list for export #1' => 'Überweisungszahlungsliste für SEPA-Export #1',
+ 'Bank transfer via SEPA' => 'SEPA-Überweisung',
+ 'Bank transfers via SEPA' => 'SEPA-Überweisungen',
'Base unit' => 'Basiseinheit',
'Basic Data' => 'Basisdaten',
'Batch Printing' => 'Druck',
'Bilanz' => 'Bilanz',
'Billing Address' => 'Rechnungsadresse',
'Billing/shipping address (city)' => 'Rechnungsadresse (Stadt)',
- 'Billing/shipping address (street)' => 'Rechnungsadresse (Straße)',
+ 'Billing/shipping address (street)' => 'Rechnungsadresse (Straße)',
'Billing/shipping address (zipcode)' => 'Rechnungsadresse (PLZ)',
'Bin' => 'Lagerplatz',
'Bin From' => 'von Lagerplatz',
'Bis Konto: ' => 'bis Konto: ',
'Body' => 'Text',
'Body:' => 'Text:',
- 'Books are open' => 'Die Bücher sind geöffnet.',
- 'Books closed up to' => 'Bücher abgeschlossen bis zum',
+ 'Books are open' => 'Die Bücher sind geöffnet.',
+ 'Books closed up to' => 'Bücher abgeschlossen bis zum',
'Boolean variables: If the default value is non-empty then the checkbox will be checked by default and unchecked otherwise.' => 'Ja/Nein-Datenfeld: Wenn der Standardwert nicht leer ist, so wird die Checkbox standardmäßig angehakt.',
'Both' => 'Beide',
'Bottom' => 'Unten',
'Buchungskonto' => 'Buchungskonto',
'Buchungsnummer' => 'Buchungsnummer',
'Business Number' => 'Firmennummer',
- 'Business Volume' => 'Geschäftsvolumen',
- 'Business deleted!' => 'Firma gelöscht.',
+ 'Business Volume' => 'Geschäftsvolumen',
+ 'Business deleted!' => 'Firma gelöscht.',
'Business evaluation' => 'Betriebswirtschaftliche Auswertung',
'Business saved!' => 'Firma gespeichert.',
'CANCELED' => 'Storniert',
'CRM user' => 'Admin Benutzer',
'CSV export -- options' => 'CSV-Export -- Optionen',
'Calculate' => 'Berechnen',
- 'Can not create that quantity with current stock' => 'Diese Anzahl kann mit dem gegenwärtigen Lagerbestand nicht hergestellt werden.',
+ 'Can not create that quantity with current stock' => 'Diese Anzahl kann mit dem gegenwärtigen Lagerbestand nicht hergestellt werden.',
'Cancel' => 'Abbrechen',
'Cancel Accounts Payables Transaction' => 'Kreditorenbuchung stornieren',
'Cancel Accounts Receivables Transaction' => 'Debitorenbuchung stornieren',
'Cannot create Lock!' => 'System kann nicht gesperrt werden!',
- 'Cannot delete account!' => 'Konto kann nicht gelöscht werden!',
- 'Cannot delete customer!' => 'Kunde kann nicht gelöscht werden!',
- 'Cannot delete default account!' => 'Das Standard-Konto kann nicht gelöscht werden!',
+ 'Cannot delete account!' => 'Konto kann nicht gelöscht werden!',
+ 'Cannot delete customer!' => 'Kunde kann nicht gelöscht werden!',
+ 'Cannot delete default account!' => 'Das Standard-Konto kann nicht gelöscht werden!',
'Cannot delete delivery order!' => 'Lieferschein kann nicht gelöscht werden!',
- 'Cannot delete invoice!' => 'Rechnung kann nicht gelöscht werden!',
- 'Cannot delete item!' => 'Artikel kann nicht gelöscht werden!',
- 'Cannot delete order!' => 'Auftrag kann nicht gelöscht werden!',
- 'Cannot delete quotation!' => 'Angebot kann nicht gelöscht werden!',
- 'Cannot delete transaction!' => 'Buchung kann nicht gelöscht werden!',
- 'Cannot delete vendor!' => 'Lieferant kann nicht gelöscht werden!',
+ 'Cannot delete invoice!' => 'Rechnung kann nicht gelöscht werden!',
+ 'Cannot delete item!' => 'Artikel kann nicht gelöscht werden!',
+ 'Cannot delete order!' => 'Auftrag kann nicht gelöscht werden!',
+ 'Cannot delete quotation!' => 'Angebot kann nicht gelöscht werden!',
+ 'Cannot delete transaction!' => 'Buchung kann nicht gelöscht werden!',
+ 'Cannot delete vendor!' => 'Lieferant kann nicht gelöscht werden!',
'Cannot have a value in both Debit and Credit!' => 'Es kann nicht gleichzeitig Soll und Haben gebucht werden!',
'Cannot post Payment!' => 'Zahlung kann nicht gebucht werden!',
'Cannot post Receipt!' => 'Beleg kann nicht gebucht werden!',
'Cannot post a transaction without a value!' => 'Eine Buchung ohne Betrag kann nicht vorgenommen werden!',
- 'Cannot post invoice for a closed period!' => 'Das Rechnungsdatum fällt in einen abgeschlossen Zeitraum!',
+ 'Cannot post invoice for a closed period!' => 'Das Rechnungsdatum fällt in einen abgeschlossen Zeitraum!',
'Cannot post invoice!' => 'Rechnung kann nicht gebucht werden!',
- 'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
+ 'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
'Cannot post payment!' => 'Zahlung kann nicht gebucht werden!',
- 'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
+ 'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
'Cannot post transaction with a debit and credit entry for the same account!' => 'Kann Soll und Haben nicht auf dasselbe Konto buchen!',
'Cannot post transaction!' => 'Rechnung kann nicht gebucht werden!',
'Cannot process payment for a closed period!' => 'Es kann keine Zahlung in einem abgeschlossenen Zeitraum verbucht werden!',
- 'Cannot remove files!' => 'Dateien können nicht gelöscht werden!',
+ 'Cannot remove files!' => 'Dateien können nicht gelöscht werden!',
'Cannot save account!' => 'Konto kann nicht gespeichert werden!',
'Cannot save order!' => 'Auftrag kann nicht gespeichert werden!',
- 'Cannot save preferences!' => 'Einstellungen können nicht gespeichert werden!',
+ 'Cannot save preferences!' => 'Einstellungen können nicht gespeichert werden!',
'Cannot save quotation!' => 'Angebot kann nicht gespeichert werden!',
'Cannot storno storno invoice!' => 'Kann eine Stornorechnung nicht stornieren',
'Carry over shipping address' => 'Lieferadresse übernehmen',
'Cash' => 'Zahlungsverkehr',
'Cc' => 'Cc',
'Change Lx-Office installation settings (all menu entries beneath \'System\')' => 'Verändern der Lx-Office-Installationseinstellungen (Menüpunkte unterhalb von \'System\')',
- 'Change representative to' => 'Vertreter ändern in',
+ 'Change representative to' => 'Vertreter ändern in',
'Charge Number' => 'Chargennummer',
'Charge number' => 'Chargennummer',
'Chart' => 'Buchungskonto',
'Chart Type' => 'Kontentyp',
'Chart balance' => 'Kontensaldo',
- 'Chart of Accounts' => 'Kontenübersicht',
+ 'Chart of Accounts' => 'Kontenübersicht',
'Chart of accounts' => 'Kontenrahmen',
- 'Chartaccounts connected to this Tax:' => 'Konten, die mit dieser Steuer verknüpft sind:',
+ 'Chartaccounts connected to this Tax:' => 'Konten, die mit dieser Steuer verknüpft sind:',
'Check' => 'Scheck',
- 'Check Details' => 'Bitte Angaben überprüfen',
+ 'Check Details' => 'Bitte Angaben überprüfen',
'Checks' => 'Schecks',
- 'Choose Customer' => 'Endkunde wählen:',
- 'Choose Outputformat' => 'Ausgabeformat auswählen...',
- 'Choose Vendor' => 'Händler wählen',
+ 'Choose Customer' => 'Endkunde wählen:',
+ 'Choose Outputformat' => 'Ausgabeformat auswählen...',
+ 'Choose Vendor' => 'Händler wählen',
'Choose a Tax Number' => 'Bitte eine Steuernummer angeben',
'City' => 'Stadt',
'Cleared Balance' => 'abgeschlossen',
- 'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
+ 'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
'Click on login name to edit!' => 'Zum Bearbeiten den Benutzernamen anklicken!',
- 'Close' => 'Übernehmen',
- 'Close Books up to' => 'Die Bücher abschließen bis zum',
- 'Close SEPA exports' => 'SEPA-Export abschließen',
+ 'Close' => 'Übernehmen',
+ 'Close Books up to' => 'Die Bücher abschließen bis zum',
+ 'Close SEPA exports' => 'SEPA-Export abschließen',
'Close Window' => 'Fenster Schließen',
'Closed' => 'Geschlossen',
- 'Collective Orders only work for orders from one customer!' => 'Sammelaufträge funktionieren nur für Aufträge von einem Kunden!',
+ 'Collective Orders only work for orders from one customer!' => 'Sammelaufträge funktionieren nur für Aufträge von einem Kunden!',
'Comment' => 'Kommentar',
'Company' => 'Firma',
'Company Name' => 'Firmenname',
- 'Compare to' => 'Gegenüberstellen zu',
+ 'Compare to' => 'Gegenüberstellen zu',
'Configuration of individual TODO items' => 'Konfiguration für die einzelnen Aufgabenlistenpunkte',
'Confirm' => 'Bestätigen',
- 'Confirm!' => 'Bestätigen Sie!',
- 'Confirmation' => 'Auftragsbestätigung',
+ 'Confirm!' => 'Bestätigen Sie!',
+ 'Confirmation' => 'Auftragsbestätigung',
'Contact' => 'Kontakt',
'Contact Person' => 'Ansprechpartner',
'Contact person (surname)' => 'Ansprechpartner (Nachname)',
'Continue' => 'Weiter',
'Contra' => 'gegen',
'Copies' => 'Kopien',
- 'Correct taxkey' => 'Richtiger Steuerschlüssel',
+ 'Correct taxkey' => 'Richtiger Steuerschlüssel',
'Corrections' => 'Korrekturen',
'Cost Center' => 'Kostenstelle',
'Costs' => 'Kosten',
'Create and edit vendor invoices' => 'Eingangsrechnungen erfassen und bearbeiten',
'Create bank collection' => 'Bankeinzug erstellen',
'Create bank collection via SEPA XML' => 'Bankeinzug via SEPA XML erstellen',
- 'Create bank transfer' => 'Überweisung erstellen',
- 'Create bank transfer via SEPA XML' => 'Überweisung via SEPA XML erzeugen',
+ 'Create bank transfer' => 'Überweisung erstellen',
+ 'Create bank transfer via SEPA XML' => 'Überweisung via SEPA XML erzeugen',
'Create invoice?' => 'Rechnung erstellen?',
'Create new' => 'Neu erfassen',
'Create tables' => 'Tabellen anlegen',
'Credit (one letter abbreviation)' => 'H',
'Credit Account' => 'Habenkonto',
'Credit Limit' => 'Kreditlimit',
- 'Credit Limit exceeded!!!' => 'Kreditlimit überschritten!',
+ 'Credit Limit exceeded!!!' => 'Kreditlimit überschritten!',
'Credit Note' => 'Gutschrift',
'Credit Note Date' => 'Gutschriftdatum',
'Credit Note Number' => 'Gutschriftnummer',
'Credit Tax' => 'Umsatzsteuer',
'Credit Tax Account' => 'Umsatzsteuerkonto',
'Credit note (one letter abbreviation)' => 'G',
- 'Curr' => 'Währung',
+ 'Curr' => 'Währung',
'Currencies' => 'Währungen',
- 'Currency' => 'Währung',
- 'Current / Next Level' => 'Aktuelles / Nächstes Mahnlevel',
+ 'Currency' => 'Währung',
+ 'Current / Next Level' => 'Aktuelles / Nächstes Mahnlevel',
'Current Earnings' => 'Gewinn',
+ 'Current assets account' => 'Konto für Umlaufvermögen',
'Current unit' => 'Aktuelle Einheit',
'Current value:' => 'Aktueller Wert:',
'Custom Variables' => 'Erweitert',
- 'Custom variables for module' => ' Erweiterte Datenfelder für ',
+ 'Custom variables for module' => ' Erweiterte Datenfelder für ',
'Customer' => 'Kunde',
'Customer Name' => 'Kundenname',
'Customer Number' => 'Kundennummer',
'Customer Order Number' => 'Bestellnummer des Kunden',
- 'Customer deleted!' => 'Kunde gelöscht!',
+ 'Customer deleted!' => 'Kunde gelöscht!',
'Customer details' => 'Kundendetails',
'Customer missing!' => 'Kundenname fehlt!',
'Customer not on file or locked!' => 'Dieser Kunde existiert nicht oder ist gesperrt.',
'Customernumberinit' => 'Kunden-/Lieferantennummernkreis',
'Customers' => 'Kunden',
'Customers and vendors' => 'Kunden und Lieferanten',
- 'Customized Report' => 'Vorgewählte Zeiträume',
+ 'Customized Report' => 'Vorgewählte Zeiträume',
'DATEV - Export Assistent' => 'DATEV-Exportassistent',
'DATEV Angaben' => 'DATEV-Angaben',
'DATEV Export' => 'DATEV-Export',
'DATEX - Export Assistent' => 'DATEV-Exportassistent',
- 'DELETED' => 'Gelöscht',
+ 'DELETED' => 'Gelöscht',
'DFV-Kennzeichen' => 'DFV-Kennzeichen',
'DR' => 'S',
'DUNNING STARTED' => 'Mahnprozess gestartet',
'Debit Starting Balance' => 'EB Passiva',
'Debit Tax' => 'Vorsteuer',
'Debit Tax Account' => 'Vorsteuerkonto',
- 'Debit and credit out of balance!' => 'Soll und Haben müssen gleich sein.',
+ 'Debit and credit out of balance!' => 'Soll und Haben müssen gleich sein.',
'Dec' => 'Dez',
'December' => 'Dezember',
'Decimalplaces' => 'Dezimalstellen',
'Decrease' => 'Verringern',
- 'Default (no language selected)' => 'Standard (keine Sprache ausgewählt)',
+ 'Default (no language selected)' => 'Standard (keine Sprache ausgewählt)',
'Default Accounts' => 'Standardkonten',
'Default output medium' => 'Standardausgabekanal',
'Default printer' => 'Standarddrucker',
'Default template format' => 'Standardvorlagenformat',
'Default value' => 'Standardwert',
'Defaults saved.' => 'Die Standardeinstellungen wurden gespeichert.',
- 'Delete' => 'Löschen',
- 'Delete Account' => 'Konto löschen',
- 'Delete Contact' => 'Ansprechpartner löschen',
- 'Delete Dataset' => 'Datenbank löschen',
- 'Delete Shipto' => 'Lieferadresse löschen',
+ 'Delete' => 'Löschen',
+ 'Delete Account' => 'Konto löschen',
+ 'Delete Contact' => 'Ansprechpartner löschen',
+ 'Delete Dataset' => 'Datenbank löschen',
+ 'Delete Shipto' => 'Lieferadresse löschen',
'Delete delivery order' => 'Lieferschein löschen',
- 'Delete drafts' => 'Entwürfe löschen',
+ 'Delete drafts' => 'Entwürfe löschen',
'Delete group' => 'Gruppe löschen',
- 'Delete transaction' => 'Buchung löschen',
+ 'Delete transaction' => 'Buchung löschen',
'Delivered' => 'Geliefert',
'Delivery Date' => 'Lieferdatum',
'Delivery Order' => 'Lieferschein',
'Delivery Orders' => 'Lieferscheine',
'Department' => 'Abteilung',
'Department Id' => 'Abteilungsnummer',
- 'Department deleted!' => 'Abteilung gelöscht.',
+ 'Department deleted!' => 'Abteilung gelöscht.',
'Department saved!' => 'Abteilung gespeichert.',
'Departments' => 'Abteilungen',
'Dependency loop detected:' => 'Schleife in den Abhängigkeiten entdeckt:',
'Deposit' => 'Gutschrift',
'Description' => 'Beschreibung',
- 'Description (Click on Description for details)' => 'Beschreibung (Klick öffnet einzelne Kontendetails)',
+ 'Description (Click on Description for details)' => 'Beschreibung (Klick öffnet einzelne Kontendetails)',
'Description missing!' => 'Beschreibung fehlt.',
'Description must not be empty!' => 'Beschreibung darf nicht leer sein',
'Destination BIC' => 'Ziel-BIC',
'Discount' => 'Rabatt',
'Display' => 'Anzeigen',
'Display file' => 'Datei anzeigen',
- 'Display options' => 'Oberfläche',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank collections that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to delete AP transaction #1?' => 'Wollen Sie wirklich die Kreditorenbuchung #1 löschen?',
- 'Do you really want to delete AR transaction #1?' => 'Wollen Sie wirklich die Debitorenbuchung #1 löschen?',
- 'Do you really want to delete GL transaction #1?' => 'Wollen Sie wirklich die Dialogbuchung #1 löschen?',
+ 'Display options' => 'Oberfläche',
+ 'Do you really want to close the following SEPA exports? No payment will be recorded for bank collections that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
+ 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
+ 'Do you really want to delete AP transaction #1?' => 'Wollen Sie wirklich die Kreditorenbuchung #1 löschen?',
+ 'Do you really want to delete AR transaction #1?' => 'Wollen Sie wirklich die Debitorenbuchung #1 löschen?',
+ 'Do you really want to delete GL transaction #1?' => 'Wollen Sie wirklich die Dialogbuchung #1 löschen?',
'Do you really want to delete this group?' => 'Gruppe wirklich löschen?',
+ 'Do you really want to delete this object?' => 'Wirklich löschen?',
'Do you really want to delete this warehouse?' => 'Wollen Sie dieses Lager wirklich löschen?',
'Do you want Lx-Office to create a group for access to all functions?' => 'Wollen Sie, dass Lx-Office eine Gruppe mit Zugriff auf alle Funktionen anlegt?',
'Do you want to <b>limit</b> your search?' => 'Wollen Sie Ihre Suche <b>spezialisieren</b>?',
'Drawing' => 'Zeichnung',
'Driver' => 'Treiber',
'Dropdown Limit' => 'Auswahllistenbegrenzung',
- 'Due' => 'Fällig',
- 'Due Date' => 'Fälligkeitsdatum',
- 'Due Date missing!' => 'Fälligkeitsdatum fehlt!',
- 'Duedate +Days' => 'Fällikeitsdatum +Tage',
+ 'Due' => 'Fällig',
+ 'Due Date' => 'Fälligkeitsdatum',
+ 'Due Date missing!' => 'Fälligkeitsdatum fehlt!',
+ 'Duedate +Days' => 'Fällikeitsdatum +Tage',
'Dunning' => 'Mahnung',
'Dunning Amount' => 'gemahnter Betrag',
'Dunning Date' => 'Mahndatum',
'Dunning Level' => 'Mahnlevel',
'Dunning Level missing in row ' => 'Mahnlevel fehlt in ',
'Dunning Process Config saved!' => 'Mahnwesenkonfiguration gespeichert!',
- 'Dunning Process started for selected invoices!' => 'Mahnprozess für selektierte Rechnungen gestartet',
+ 'Dunning Process started for selected invoices!' => 'Mahnprozess für selektierte Rechnungen gestartet',
'Dunning number' => 'Mahnungsnummer',
- 'Dunning overview' => 'Mahnungsübersicht',
+ 'Dunning overview' => 'Mahnungsübersicht',
'Dunnings' => 'Mahnungen',
'During this user migration Lx-Office can create such a group for you and grant all users access to all of Lx-Office\'s functions.' => 'Im Rahmen dieser Benutzerdatenmigration kann Lx-Office eine solche Gruppe für Sie anlegen und allen Benutzern Zugriff auf alle Lx-Office-Funktionen gewähren.',
'E-mail' => 'eMail',
- 'E-mail Statement to' => 'Fälligkeitsabrechnung als eMail an',
+ 'E-mail Statement to' => 'Fälligkeitsabrechnung als eMail an',
'E-mail address missing!' => 'E-Mail-Adresse fehlt!',
'EAN' => 'EAN',
'EAN-Code' => 'EAN-Code',
'EQUITY' => 'EIGENTUM',
'EU with VAT ID' => 'EU mit UstId-Nummer',
'EU without VAT ID' => 'EU ohne UstId-Nummer',
- 'EUER' => 'Einnahmen-/Überschussrechnung',
- 'EUR' => 'E/Ü-Rechnung',
- 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => 'Frühere Versionen von Lx-Office enthielten Bugs, die zu falschen Einträgen im Hauptbuch geführt haben können.',
+ 'EUER' => 'Einnahmen-/Überschussrechnung',
+ 'EUR' => 'E/Ü-Rechnung',
+ 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => 'Frühere Versionen von Lx-Office enthielten Bugs, die zu falschen Einträgen im Hauptbuch geführt haben können.',
'Edit' => 'Bearbeiten',
'Edit Access Rights' => 'Zugriffsrechte',
'Edit Access Rights for Follow-Ups' => 'Zugriff auf meine Wiedervorlagen regeln',
'Edit Purchase Order' => 'Lieferantenaufrag bearbeiten',
'Edit Quotation' => 'Angebot bearbeiten',
'Edit Request for Quotation' => 'Anfrage bearbeiten',
- 'Edit SEPA strings' => 'Begriffe bei SEPA-Überweisungen bearbeiten',
+ 'Edit SEPA strings' => 'Begriffe bei SEPA-Überweisungen bearbeiten',
'Edit Sales Delivery Order' => 'Lieferschein (Verkauf) bearbeiten',
'Edit Sales Invoice' => 'Rechnung bearbeiten',
'Edit Sales Order' => 'Auftrag bearbeiten',
'Edit the request_quotation' => 'Bearbeiten der Preisanfrage',
'Edit the sales_order' => 'Bearbeiten des Auftrags',
'Edit the sales_quotation' => 'Bearbeiten des Angebots',
- 'Edit the stylesheet' => 'CSS bearbeiten (Oberfläche)',
+ 'Edit the stylesheet' => 'CSS bearbeiten (Oberfläche)',
'Edit units' => 'Einheiten bearbeiten',
'Editable' => 'Bearbeitbar',
- 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => 'Entweder gibt es keine offenen Rechnungen, oder es wurden bereits Überweisungen über die offenen Beträge aller offenen Rechnungen erstellt.',
+ 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => 'Entweder gibt es keine offenen Rechnungen, oder es wurden bereits Überweisungen über die offenen Beträge aller offenen Rechnungen erstellt.',
'Element disabled' => 'Element deaktiviert',
'Employee' => 'Bearbeiter',
'Empty transaction!' => 'Buchung ist leer!',
'Enter a description for this new draft.' => 'Geben Sie eine Beschreibung für diesen Entwurf ein.',
'Enter longdescription' => 'Langtext eingeben',
- 'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
+ 'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
+ 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
'Equity' => 'Passiva',
'Error' => 'Fehler',
'Error in database control file \'%s\': %s' => 'Fehler in Datenbankupgradekontrolldatei \'%s\': %s',
'Exch' => 'Wechselkurs.',
'Exchangerate' => 'Wechselkurs',
'Exchangerate Difference' => 'Wechselkursunterschied',
- 'Exchangerate for payment missing!' => 'Es fehlt der Wechselkurs für die Bezahlung!',
+ 'Exchangerate for payment missing!' => 'Es fehlt der Wechselkurs für die Bezahlung!',
'Exchangerate missing!' => 'Es fehlt der Wechselkurs!',
- 'Executed' => 'Ausgeführt',
- 'Execution date' => 'Ausführungsdatum',
- 'Execution date from' => 'Ausführungsdatum von',
- 'Execution date to' => 'Ausführungsdatum bis',
+ 'Executed' => 'Ausgeführt',
+ 'Execution date' => 'Ausführungsdatum',
+ 'Execution date from' => 'Ausführungsdatum von',
+ 'Execution date to' => 'Ausführungsdatum bis',
'Existing Buchungsgruppen' => 'Existierende Buchungsgruppen',
'Existing Datasets' => 'Existierende Datenbanken',
'Existing pending follow-ups for this item' => 'Noch nicht erledigte Wiedervorlagen für dieses Dokument',
'Export date from' => 'Exportdatum von',
'Export date to' => 'Exportdatum bis',
'Extended' => 'Gesamt',
- 'Extension Of Time' => 'Dauerfristverlängerung',
+ 'Extension Of Time' => 'Dauerfristverlängerung',
'Factor' => 'Faktor',
'Factor missing!' => 'Der Faktor fehlt.',
'Falsches Datumsformat!' => 'Falsches Datumsformat!',
- 'Favorites' => 'Favoriten (nur im XUL-Menü)',
+ 'Favorites' => 'Favoriten (nur im XUL-Menü)',
'Fax' => 'Fax',
'Feb' => 'Feb',
'February' => 'Februar',
- 'Fee' => 'Gebühr',
+ 'Fee' => 'Gebühr',
'File' => 'Datei',
'File name' => 'Dateiname',
'Files created by Lx-Office\'s "Backup Dataset" function are such files.' => 'Dateien, die von Lx-Office\' Funktion "Datenbank sichern" erstellt wurden, erfüllen diese Kriterien.',
'Follow-Up for user' => 'Wiedervorlage für Benutzer',
'Follow-Up saved.' => 'Wiedervorlage gespeichert.',
'Follow-Ups' => 'Wiedervorlagen',
- 'Follow-up for' => 'Wiedervorlage für',
+ 'Follow-up for' => 'Wiedervorlage für',
'Font' => 'Schriftart',
'Font size' => 'Schriftgröße',
- 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => 'Bei Kreditorenbuchungen werden die Umsatzsteuer-Steuerschlüssel durch Vorsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
- 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => 'Bei Debitorenbuchungen werden die Vorsteuer-Steuerschlüssel durch Umsatzsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
+ 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => 'Bei Kreditorenbuchungen werden die Umsatzsteuer-Steuerschlüssel durch Vorsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
+ 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => 'Bei Debitorenbuchungen werden die Vorsteuer-Steuerschlüssel durch Umsatzsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
'For each unit there\'s either no or exactly one base unit. If you chose a base unit then you also have to chose a factor. That way the new unit will be defined as a multiple of the base unit. The base unit must be the "smaller" one. A factor may not be less than 1. Therefore you may define "kg" with the base unit "g" and a factor of "1", but not the other way round.' => 'Einheiten haben entweder keine oder genau eine Basiseinheit, von der sie ein Vielfaches sind. Wenn Sie eine Basiseinheit auswählen, dann müssen Sie auch einen Faktor eingeben. Sie müssen Einheiten als ein Vielfaches einer kleineren Einheit eingeben. So ist die Definition von "kg" mit der Basiseinheit "g" und dem Faktor 1000 zulässig, die Definition von "g" mit der Basiseinheit "kg" und dem Faktor "0,001" hingegen nicht.',
- 'Foreign Exchange Gain' => 'Wechselkurserträge',
+ 'Foreign Exchange Gain' => 'Wechselkurserträge',
'Foreign Exchange Loss' => 'Wechselkursaufwendungen',
'Foreign Expenses' => 'Aufwand Ausland',
'Foreign Revenues' => 'Erlöse Ausland',
'Group' => 'Warengruppe',
'Group Invoices' => 'Rechnungen zusammenfassen',
'Group Items' => 'Waren gruppieren',
- 'Group deleted!' => 'Warengruppe gelöscht!',
- 'Group membership' => 'Gruppenzugehörigkeit',
+ 'Group deleted!' => 'Warengruppe gelöscht!',
+ 'Group membership' => 'Gruppenzugehörigkeit',
'Group missing!' => 'Warengruppe fehlt!',
'Group saved!' => 'Warengruppe gespeichert!',
'Groups' => 'Warengruppen',
'HTML Templates' => 'HTML-Vorlagen',
'Hardcopy' => 'Seite drucken',
'Has serial number' => 'Hat eine Serienummer',
- 'Heading' => 'Überschrift',
- 'Headings' => 'Überschriften',
+ 'Heading' => 'Überschrift',
+ 'Headings' => 'Überschriften',
'Help' => 'Hilfe',
'Help Template Variables' => 'Hilfe zu Dokumenten-Variablen',
'Here\'s an example command line:' => 'Hier ist eine Kommandozeile, die als Beispiel dient:',
'IV' => 'IV',
'If the automatic creation of invoices for fees and interest is switched on for a dunning level then the following accounts will be used for the invoice.' => 'Wenn das automatische Erstellen einer Rechnung über Mahngebühren und Zinsen für ein Mahnlevel aktiviert ist, so werden die folgenden Konten für die Rechnung benutzt.',
'If the database user listed above does not have the right to create a database then enter the name and password of the superuser below:' => 'Falls der oben genannte Datenbankbenutzer nicht die Berechtigung zum Anlegen neuer Datenbanken hat, so können Sie hier den Namen und das Passwort des Datenbankadministratoraccounts angeben:',
- 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => 'Falls Sie sich entscheiden, Lx-Office die Migration durchführen zu lassen, so wird Lx-Office ein Backup der alten Dateien im Verzeichnis "#1" erstellen und die Dateien anschließend löschen.',
+ 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => 'Falls Sie sich entscheiden, Lx-Office die Migration durchführen zu lassen, so wird Lx-Office ein Backup der alten Dateien im Verzeichnis "#1" erstellen und die Dateien anschließend löschen.',
'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => 'Wenn Sie für die Artikelnummer und / oder die Beschreibung etwas eingeben, so werden nur die Lagerplätze angezeigt, in denen Waren eingelagert sind, die Ihre Suchbegriffe enthalten.',
'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => 'Wenn Sie diese Meldung sehen haben Sie wahrscheinlich ein frisches LX-Office Setup und noch keine Buchungsgruppen eingerichtet. Ein Administrator kann dies im Systemmenü erledigen.',
'If you want to change any of these parameters then press the "Back" button, edit the file "config/authentication.pl" and login into the admin module again.' => 'Wenn Sie einen der Parameter ändern wollen, so drücken Sie auf den "Zurück"-Button, bearbeiten Sie die Datei "config/authentication.pl", und melden Sie sich erneut im Administrationsbereich an.',
'Image' => 'Grafik',
'Import CSV' => 'CSV-Import',
'In Lx-Office 2.4.0 the administrator has to enter a list of units in the administrative section.' => 'In Lx-Office 2.4.0 muss der Administrator in den Systemeinstellungen eine Liste von verwendbaren Einheiten angeben.',
- 'In order to do that hit the button "Delete transaction".' => 'Drücken Sie dafür auf den Button "Buchung löschen".',
- 'In the latter case the tables needed by Lx-Office will be created in that database.' => 'In letzterem Fall werden die von Lx-Office benötigten Tabellen in dieser existierenden Datenbank angelegt.',
+ 'In order to do that hit the button "Delete transaction".' => 'Drücken Sie dafür auf den Button "Buchung löschen".',
+ 'In the latter case the tables needed by Lx-Office will be created in that database.' => 'In letzterem Fall werden die von Lx-Office benötigten Tabellen in dieser existierenden Datenbank angelegt.',
'In-line' => 'im Text',
'Inactive' => 'Inaktiv',
'Include Exchangerate Difference' => 'Wechselkursunterschied einbeziehen',
'Include column headings' => 'Spaltenüberschriften erzeugen',
'Include empty bins' => 'Leere Lagerplätze anzeigen',
'Include in Report' => 'In Bericht aufnehmen',
- 'Include in drop-down menus' => 'In Aufklappmenü aufnehmen',
+ 'Include in drop-down menus' => 'In Aufklappmenü aufnehmen',
'Includeable in reports' => 'In Berichten anzeigbar',
- 'Income Statement' => 'GuV (EÜR)',
+ 'Income Statement' => 'GuV (EÜR)',
'Income accno' => 'Erlöskonto',
- 'Incoming Payments' => 'Zahlungseingänge',
+ 'Incoming Payments' => 'Zahlungseingänge',
'Incoming invoice number' => 'Eingangsrechnungsnummer',
'Incorrect Password!' => 'Passwort falsch!',
- 'Incorrect username or password!' => 'Ungültiger Benutzername oder falsches Passwort!',
- 'Increase' => 'Erhöhen',
+ 'Incorrect username or password!' => 'Ungültiger Benutzername oder falsches Passwort!',
+ 'Increase' => 'Erhöhen',
'Individual Items' => 'Einzelteile',
'Information' => 'Information',
'Interest' => 'Zinsen',
'Internet' => 'Internet',
'Introduction of Buchungsgruppen' => 'Einführung von Buchungsgruppen',
'Introduction of units' => 'Einführung von Einheiten',
- 'Inv. Duedate' => 'Rg. Fälligkeit',
+ 'Inv. Duedate' => 'Rg. Fälligkeit',
'Invalid' => 'Ungültig',
'Invalid follow-up ID.' => 'Ungültige Wiedervorlage-ID.',
'Invalid quantity.' => 'Die Mengenangabe ist ungültig.',
'Invdate from' => 'Rechnungen von',
'Inventory' => 'Inventar',
'Inventory Account' => 'Warenbestand',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'Bevor dieses Erzeugnis als ungültig markiert werden kann, muß das Inventar auf Null sein!',
- 'Inventory quantity must be zero before you can set this part obsolete!' => 'Bevor diese Ware als ungültig markiert werden kann, muß das Inventar Null sein!',
+ 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'Bevor dieses Erzeugnis als ungültig markiert werden kann, muß das Inventar auf Null sein!',
+ 'Inventory quantity must be zero before you can set this part obsolete!' => 'Bevor diese Ware als ungültig markiert werden kann, muß das Inventar Null sein!',
'Invno.' => 'Rg. Nr.',
'Invnumber' => 'Rechnungsnummer',
'Invnumber missing!' => 'Rechnungsnummer fehlt!',
'Invoice (one letter abbreviation)' => 'R',
'Invoice Date' => 'Rechnungsdatum',
'Invoice Date missing!' => 'Rechnungsdatum fehlt!',
- 'Invoice Duedate' => 'Fälligkeitsdatum',
+ 'Invoice Duedate' => 'Fälligkeitsdatum',
'Invoice Number' => 'Rechnungsnummer',
'Invoice Number missing!' => 'Rechnungsnummer fehlt!',
- 'Invoice deleted!' => 'Rechnung gelöscht!',
- 'Invoice for fees' => 'Rechnung über Gebühren',
+ 'Invoice deleted!' => 'Rechnung gelöscht!',
+ 'Invoice for fees' => 'Rechnung über Gebühren',
'Invoice has already been storno\'d!' => 'Diese Rechnung wurde bereits storniert.',
'Invoice number' => 'Rechnungsnummer',
'Invoice with Storno (abbreviation)' => 'R(S)',
'Invoices' => 'Rechnungen',
'Is Searchable' => 'Durchsuchbar',
'Is this a summary account to record' => 'Buchungskonto in',
- 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
+ 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => 'Es ist möglich, dies für einige, aber nicht für alle Buchungsgruppen automatisch zu erledigen.',
'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => 'Das ist für einige Einheiten automatisch möglich, aber bei anderen muss der Benutzer die neue Einheit auswählen.',
'It may optionally be compressed with "gzip".' => 'Sie darf optional mit "gzip" komprimiert sein.',
- 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
- 'Item deleted!' => 'Artikel gelöscht!',
+ 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
+ 'Item deleted!' => 'Artikel gelöscht!',
'Item not on file!' => 'Dieser Artikel ist nicht in der Datenbank!',
'Jahresverkehrszahlen neu' => 'Jahresverkehrszahlen neu',
'Jan' => 'Jan',
'LaTeX Templates' => 'LaTeX-Vorlagen',
'Landscape' => 'Querformat',
'Language' => 'Sprache',
- 'Language Values' => 'Sprachübersetzungen',
- 'Language deleted!' => 'Sprache gelöscht!',
+ 'Language Values' => 'Sprachübersetzungen',
+ 'Language deleted!' => 'Sprache gelöscht!',
'Language missing!' => 'Sprache fehlt!',
'Language saved!' => 'Sprache gespeichert!',
'Languages' => 'Sprachen',
'Left' => 'Links',
'Liability' => 'Passiva/Mittelherkunft',
'License' => 'Lizenz',
- 'License key' => 'Lizenzschlüssel',
+ 'License key' => 'Lizenzschlüssel',
'Licenses' => 'Lizenzen',
'Limit part selection' => 'Artikelauswahl eingrenzen',
'Line Total' => 'Zeilensumme',
'List export' => 'Export anzeigen',
'List of bank accounts' => 'Liste der Bankkonten',
'List of bank collections' => 'Bankeinzugsliste',
- 'List of bank transfers' => 'Überweisungsliste',
+ 'List of bank transfers' => 'Überweisungsliste',
'List of custom variables' => 'Erweiterte Datenfelder verwalten',
- 'List open SEPA exports' => 'Noch nicht ausgeführte SEPA-Exporte anzeigen',
+ 'List open SEPA exports' => 'Noch nicht ausgeführte SEPA-Exporte anzeigen',
'Load draft' => 'Entwurf laden',
'Local Tax Office Preferences' => 'Angaben zum Finanzamt',
'Lock System' => 'System sperren',
'Manage license keys' => 'Lizenzschlüssel verwalten',
'Mandantennummer' => 'Mandantennummer',
'Mandatory Departments' => 'Benutzer muss Abteilungen vergeben',
- 'Mar' => 'März',
- 'March' => 'März',
+ 'Mar' => 'März',
+ 'March' => 'März',
'Margepercent' => 'Ertrag prozentual',
'Margetotal' => 'Ertrag',
'Margins' => 'Seitenränder',
- 'Mark as closed' => 'Abschließen',
+ 'Mark as closed' => 'Abschließen',
'Mark as paid?' => 'Als bezahlt markieren?',
'Mark closed' => 'Als geschlossen markieren',
'Marked as paid' => 'Als bezahlt markiert',
- 'Marked entries printed!' => 'Markierte Einträge wurden gedruckt!',
+ 'Marked entries printed!' => 'Markierte Einträge wurden gedruckt!',
'Master Data' => 'Stammdaten',
- 'Max. Dunning Level' => 'höchste Mahnstufe',
+ 'Max. Dunning Level' => 'höchste Mahnstufe',
'May' => 'Mai',
'May ' => 'Mai',
'May set the BCC field when sending emails' => 'Beim Verschicken von Emails das Feld \'BCC\' setzen',
'Monthly' => 'monatlich',
'More than one #1 found matching, please be more specific.' => 'Mehr als ein #1 wurde gefunden, bitte geben Sie den Namen genauer an.',
'More than one control file with the tag \'%s\' exist.' => 'Es gibt mehr als eine Kontrolldatei mit dem Tag \'%s\'.',
- 'Multi mode not supported.' => 'Multimodus wird nicht unterstützt.',
+ 'Multi mode not supported.' => 'Multimodus wird nicht unterstützt.',
'Multibyte Encoding' => 'Zeichenkodierung',
'MwSt. inkl.' => 'MwSt. inkl.',
'Name' => 'Name',
'New service' => 'Neue Dienstleistung',
'New unit' => 'Neue Einheit',
'New vendor' => 'Neuer Lieferant',
- 'Next Dunning Level' => 'Nächste Mahnstufe',
+ 'Next Dunning Level' => 'Nächste Mahnstufe',
'No' => 'Nein',
'No %s was found matching the search parameters.' => 'Es wurde kein %s gefunden, auf den die Suchparameter zutreffen.',
'No Company Address given' => 'Keine Firmenadresse hinterlegt!',
'No Company Name given' => 'Kein Firmenname hinterlegt!',
'No Customer was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Endkunde gefunden',
- 'No Database Drivers available!' => 'Kein Datenbanktreiber verfügbar!',
- 'No Dataset selected!' => 'Keine Datenbank ausgewählt!',
- 'No Vendor was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Händler gefunden',
+ 'No Database Drivers available!' => 'Kein Datenbanktreiber verfügbar!',
+ 'No Dataset selected!' => 'Keine Datenbank ausgewählt!',
+ 'No Vendor was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Händler gefunden',
'No action defined.' => 'Keine Aktion definiert.',
'No backup file has been uploaded.' => 'Es wurde keine Sicherungsdatei hochgeladen.',
- 'No bank information has been entered in this customer\'s master data entry. You cannot create bank collections unless you enter bank information.' => 'Für diesen Kunden wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
- 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => 'Für diesen Lieferanten wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
+ 'No bank information has been entered in this customer\'s master data entry. You cannot create bank collections unless you enter bank information.' => 'Für diesen Kunden wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
+ 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => 'Für diesen Lieferanten wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
'No bins have been added to this warehouse yet.' => 'Es wurden zu diesem Lager noch keine Lagerplätze angelegt.',
- 'No customer has been selected yet.' => 'Es wurde noch kein Kunde ausgewählt.',
+ 'No customer has been selected yet.' => 'Es wurde noch kein Kunde ausgewählt.',
'No data was found.' => 'Es wurden keine Daten gefunden.',
'No databases have been found on this server.' => 'Auf diesem Server wurden keine Datenbanken gefunden.',
'No datasets have been selected.' => 'Es wurden keine Datenbanken ausgewählt.',
'No licenses were found that match the search criteria.' => 'Es wurden keine Lizenzen gefunden, auf die die Suchkriterien zutreffen.',
'No or an unknown authenticantion module specified in "config/authentication.pl".' => 'Es wurde kein oder ein unbekanntes Authentifizierungsmodul in "config/authentication.pl" angegeben.',
'No part was found matching the search parameters.' => 'Es wurde kein Artikel gefunden, auf den die Suchparameter zutreffen.',
- 'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
+ 'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
'No problems were recognized.' => 'Es wurden keine Probleme gefunden.',
- 'No transaction selected!' => 'Bitte mindestens einen Haken in der Spalte "auswählen" setzen.',
- 'No transfers were executed in this export.' => 'In diesem SEPA-Export wurden keine Überweisungen ausgeführt.',
+ 'No transaction selected!' => 'Bitte mindestens einen Haken in der Spalte "auswählen" setzen.',
+ 'No transfers were executed in this export.' => 'In diesem SEPA-Export wurden keine Überweisungen ausgeführt.',
'No unknown units where found.' => 'Es wurden keine unbekannten Einheiten gefunden.',
'No user has been selected.' => 'Es wurde kein Benutzer ausgewählt.',
- 'No valid number entered for pricegroup "#1".' => 'Für Preisgruppe "#1" wurde keine gültige Nummer eingegeben.',
- 'No vendor has been selected yet.' => 'Es wurde noch kein Lieferant ausgewählt.',
- 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => 'Es wurde noch kein Lager angelegt, bzw. die dazugehörigen Lagerplätze sind noch nicht konfiguriert.',
+ 'No valid number entered for pricegroup "#1".' => 'Für Preisgruppe "#1" wurde keine gültige Nummer eingegeben.',
+ 'No vendor has been selected yet.' => 'Es wurde noch kein Lieferant ausgewählt.',
+ 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => 'Es wurde noch kein Lager angelegt, bzw. die dazugehörigen Lagerplätze sind noch nicht konfiguriert.',
'No.' => 'Position',
- 'Non-taxable Purchases' => 'Nicht zu versteuernde Einkäufe',
- 'Non-taxable Sales' => 'Nicht zu versteuernde Verkäufe',
+ 'Non-taxable Purchases' => 'Nicht zu versteuernde Einkäufe',
+ 'Non-taxable Sales' => 'Nicht zu versteuernde Verkäufe',
'None' => 'Kein',
- 'Not Discountable' => 'Nicht rabattierfähig',
+ 'Not Discountable' => 'Nicht rabattierfähig',
'Not delivered' => 'Nicht geliefert',
'Not done yet' => 'Noch nicht fertig',
- 'Not obsolete' => 'Gültig',
+ 'Not obsolete' => 'Gültig',
'Note' => 'Hinweis',
- 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => 'Achtung: Steuerschlüssel brauchen ein gültiges "Gültig ab"-Datum und werden andernfalls ignoriert.',
+ 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => 'Achtung: Steuerschlüssel brauchen ein gültiges "Gültig ab"-Datum und werden andernfalls ignoriert.',
'Notes' => 'Notizen',
'Notes (will appear on hard copy)' => 'Hinweise (erscheinen auf Ausdruck)',
'Nothing has been selected for removal.' => 'Es wurde nichts für eine Entnahme ausgewählt.',
'Nothing has been selected for transfer.' => 'Es wurde nichts zum Umlagern ausgewählt.',
- 'Nothing selected!' => 'Es wurde nichts ausgewählt!',
- 'Nothing to delete!' => 'Es konnte nichts gelöscht werden!',
+ 'Nothing selected!' => 'Es wurde nichts ausgewählt!',
+ 'Nothing to delete!' => 'Es konnte nichts gelöscht werden!',
'Nov' => 'Nov',
'November' => 'November',
'Now the user must select a single Buchungsgruppe for each part instead of three distinct accounts.' => 'Der Benutzer muss nun für jeden Artikel nur noch die Buchungsgruppe anstelle der drei einzelnen Konten auswählen.',
'Number missing in Row' => 'Nummer fehlt in Zeile',
'Number of bins' => 'Anzahl Lagerplätze',
'Number of copies' => 'Anzahl Kopien',
- 'Number of entries changed: #1' => 'Anzahl geänderter Einträge: #1',
+ 'Number of entries changed: #1' => 'Anzahl geänderter Einträge: #1',
'Number of new bins' => 'Anzahl neuer Lagerplätze',
'Number pages' => 'Seiten nummerieren',
'Number variables: \'PRECISION=n\' forces numbers to be shown with exactly n decimal places.' => 'Zahlenvariablen: Mit \'PRECISION=n\' erzwingt man, dass Zahlen mit n Nachkommastellen formatiert werden.',
'OB Transaction' => 'EB-Buchung',
'OBE-Export erfolgreich!' => 'OBE-Export erfolgreich!',
- 'Obsolete' => 'Ungültig',
+ 'Obsolete' => 'Ungültig',
'Oct' => 'Okt',
'October' => 'Oktober',
'Off' => 'Aus',
'Open in new window' => 'In neuem Fenster öffnen.',
'Open this Website' => 'Homepage in neuem Fenster öffnen',
'OpenDocument/OASIS' => 'OpenDocument/OASIS',
- 'Openings' => 'Öffnungszeiten',
+ 'Openings' => 'Öffnungszeiten',
'Optional comment' => 'Optionaler Kommentar',
'Options' => 'Optionen',
'Order' => 'Auftrag',
'Order Date missing!' => 'Auftragsdatum fehlt!',
'Order Number' => 'Auftragsnummer',
'Order Number missing!' => 'Auftragsnummer fehlt!',
- 'Order deleted!' => 'Auftrag gelöscht!',
+ 'Order deleted!' => 'Auftrag gelöscht!',
'Ordered' => 'Vom Kunde bestellt',
'Orientation' => 'Seitenformat',
'Orphaned' => 'Nie benutzt',
'Other values are ignored.' => 'Andere Eingaben werden ignoriert.',
'Others' => 'Andere',
'Otherwise all users will only have access to their own settings.' => 'Andernfalls haben alle Benutzer nur Zugriff auf ihre Einstellungen.',
- 'Otherwise the variable is only available for printing.' => 'Andernfalls steht die Variable nur beim Ausdruck zur Verfügung.',
+ 'Otherwise the variable is only available for printing.' => 'Andernfalls steht die Variable nur beim Ausdruck zur Verfügung.',
'Out of balance transaction!' => 'Buchung ist nicht ausgeglichen!',
'Out of balance!' => 'Summen stimmen nicht berein!',
'Output Number Format' => 'Zahlenformat (Ausgabe)',
'Outputformat' => 'Ausgabeformat',
- 'Overdue sales quotations and requests for quotations' => 'Überfällige Angebote und Preisanfragen',
+ 'Overdue sales quotations and requests for quotations' => 'Überfällige Angebote und Preisanfragen',
'Own Product' => 'eigenes Produkt',
'PAYMENT POSTED' => 'Rechung gebucht',
'PDF' => 'PDF',
'POSTED AS NEW' => 'Als neu gebucht',
'PRINTED' => 'Gedruckt',
'Packing List' => 'Packliste',
- 'Packing List Date missing!' => 'Datum für Packliste fehlt!',
+ 'Packing List Date missing!' => 'Datum für Packliste fehlt!',
'Packing List Number missing!' => 'Packlistennummer fehlt!',
'Packing Lists' => 'Lieferschein',
'Page #1/#2' => 'Seite #1/#2',
'Payment date missing!' => 'Tag der Zahlung fehlt!',
'Payment list as PDF' => 'Zahlungsliste als PDF',
'Payment posted!' => 'Zahlung gebucht!',
- 'Payment terms deleted!' => 'Zahlungskonditionen gelöscht!',
- 'Payments' => 'Zahlungsausgänge',
+ 'Payment terms deleted!' => 'Zahlungskonditionen gelöscht!',
+ 'Payments' => 'Zahlungsausgänge',
'Period' => 'Zeitraum',
'Period:' => 'Zeitraum:',
'Personal settings' => 'Meine Daten',
'Phone1' => 'Telefon 1 ',
'Phone2' => 'Telefon 2',
'Pick List' => 'Sammelliste',
- 'Please Check the bank information for each customer:' => 'Bitte überprüfen Sie die Bankinformationen der Kunden:',
- 'Please Check the bank information for each vendor:' => 'Bitte überprüfen Sie die Kontoinformationen der Lieferanten:',
+ 'Please Check the bank information for each customer:' => 'Bitte überprüfen Sie die Bankinformationen der Kunden:',
+ 'Please Check the bank information for each vendor:' => 'Bitte überprüfen Sie die Kontoinformationen der Lieferanten:',
'Please ask your administrator to create warehouses and bins.' => 'Bitten Sie Ihren Administrator, dass er Lager und Lagerplätze anlegt.',
- 'Please enter a license key.' => 'Bitte geben Sie einen Lizenzschlüssel an.',
- 'Please enter a number of licenses.' => 'Bitte geben Sie die Anzahl Lizenzschlüssel an.',
- 'Please enter the login for the new user.' => 'Bitte geben Sie das Login für den neuen Benutzer ein.',
+ 'Please enter a license key.' => 'Bitte geben Sie einen Lizenzschlüssel an.',
+ 'Please enter a number of licenses.' => 'Bitte geben Sie die Anzahl Lizenzschlüssel an.',
+ 'Please enter the login for the new user.' => 'Bitte geben Sie das Login für den neuen Benutzer ein.',
'Please enter the name of the database that will be used as the template for the new database:' => 'Bitte geben Sie den Namen der Datenbank an, die als Vorlage für die neue Datenbank benutzt wird:',
'Please enter the name of the dataset you want to restore the backup in.' => 'Bitte geben Sie den Namen der Datenbank ein, in der Sie die Sicherung wiederherstellen wollen.',
+ 'Please enter the sales tax identification number.' => 'Bitte geben Sie die Umsatzsteueridentifikationsnummer an.',
'Please enter the taxnumber in the administration menu user preferences' => 'Bitte bei den Einstellungen des aktuellen Benutzers im Administrationsmodul angeben.',
'Please enter values' => 'Bitte Werte eingeben',
'Please insert object dimensions below.' => 'Bitte geben Sie die Abmessungen unten ein',
- 'Please insert your language values below' => 'Bitte die Übersetzungen unten eintragen',
+ 'Please insert your language values below' => 'Bitte die Übersetzungen unten eintragen',
'Please insert your longdescription below' => 'Bitte den Langtext eingeben',
'Please install the below listed modules or ask your system administrator to.' => 'Bitte installieren Sie die unten aufgeführten Module, oder bitten Sie Ihren Administrator darum.',
- 'Please re-run the analysis for broken general ledger entries by clicking this button:' => 'Bitte wiederholen Sie die Analyse der Hauptbucheinträge, indem Sie auf diesen Button klicken:',
+ 'Please re-run the analysis for broken general ledger entries by clicking this button:' => 'Bitte wiederholen Sie die Analyse der Hauptbucheinträge, indem Sie auf diesen Button klicken:',
'Please read the file' => 'Bitte lesen Sie die Datei',
- 'Please select a customer from the list below.' => 'Bitte einen Endkunden aus der Liste auswählen',
+ 'Please select a customer from the list below.' => 'Bitte einen Endkunden aus der Liste auswählen',
'Please select a part from the list below.' => 'Bitte wählen Sie einen Artikel aus der Liste aus.',
- 'Please select a user' => 'Bitte wählen Sie einen Benutzer aus',
- 'Please select a vendor from the list below.' => 'Bitte einen Händler aus der Liste auswählen',
+ 'Please select a user' => 'Bitte wÃ\83â\82¬hlen Sie einen Benutzer aus',
+ 'Please select a vendor from the list below.' => 'Bitte einen Händler aus der Liste auswählen',
'Please select the chart of accounts this installation is using from the list below.' => 'Bitte wählen Sie den Kontenrahmen aus, der bei dieser Installation verwendet wird.',
'Please select the database you want to backup' => 'Bitte wählen Sie die zu sichernde Datenbank gefunden',
- 'Please select the destination bank account for the collections:' => 'Bitte wählen Sie das Bankkonto als Ziel für die Einzüge aus:',
- 'Please select the source bank account for the transfers:' => 'Bitte wählen Sie das Bankkonto als Quelle für die Überweisungen aus:',
+ 'Please select the destination bank account for the collections:' => 'Bitte wählen Sie das Bankkonto als Ziel für die Einzüge aus:',
+ 'Please select the source bank account for the transfers:' => 'Bitte wählen Sie das Bankkonto als Quelle für die Überweisungen aus:',
'Please seletct the dataset you want to delete:' => 'Bitte wählen Sie die zu löschende Datenbank aus:',
'Please specify a description for the warehouse designated for these goods.' => 'Bitte geben Sie den Namen des Ziellagers für die übernommenen Daten ein.',
'Plural' => 'Plural',
'Preisgruppe' => 'Preisgruppe',
'Preisklasse' => 'Preisgruppe',
'Prepare bank collection via SEPA XML' => 'Einzug via SEPA XML vorbereiten',
- 'Prepare bank transfer via SEPA XML' => 'Überweisung via SEPA XML vorbereiten',
+ 'Prepare bank transfer via SEPA XML' => 'Überweisung via SEPA XML vorbereiten',
'Prepayment' => 'Vorauszahlung',
'Preview' => 'Druckvorschau',
'Previous transdate text' => 'wurde gespeichert am',
'Price factor deleted!' => 'Preisfaktor gelöscht.',
'Price factor saved!' => 'Preisfaktor gespeichert.',
'Pricegroup' => 'Preisgruppe',
- 'Pricegroup deleted!' => 'Preisgruppe gelöscht!',
+ 'Pricegroup deleted!' => 'Preisgruppe gelöscht!',
'Pricegroup missing!' => 'Preisgruppe fehlt!',
'Pricegroup saved!' => 'Preisgruppe gespeichert!',
'Pricegroups' => 'Preisgruppen',
'Printer Command' => 'Druckbefehl',
'Printer Command missing!' => 'Druckbefehl fehlt',
'Printer Management' => 'Druckeradministration',
- 'Printers are created for a user database. Please select a user. The associated database will be edited.' => 'Drucker werden für eine Benutzerdatenbank erzeugt. Bitte wählen Sie einen Benutzer aus. Die Drucker werden in der verknüpften Datenbank angelegt.',
+ 'Printers are created for a user database. Please select a user. The associated database will be edited.' => 'Drucker werden fÃ\83Å\92r eine Benutzerdatenbank erzeugt. Bitte wÃ\83â\82¬hlen Sie einen Benutzer aus. Die Drucker werden in der verknÃ\83Å\92pften Datenbank angelegt.',
'Printing ... ' => 'Es wird gedruckt.',
'Prior to Lx-Office v2.4.0 the user could enter arbitrary strings as units for parts, services and in invoices, sales quotations etc.' => 'Vor Lx-Office 2.4.0 konnte der Benutzer bei Artikeln, Dienstleistungen und Rechnungen, Angeboten etc beliebige Einheiten angeben.',
'Prior to Lx-Office v2.4.0 the user had to chose the accounts for each part and service.' => 'Vor Lx-Office 2.4.0 musste der Benutzer die Konten bei jeder Ware und jeder Dienstleistung einzeln auswählen.',
'Private Phone' => 'Privates Tel.',
'Problem' => 'Problem',
'Produce Assembly' => 'Erzeugnis fertigen',
- 'Productivity' => 'Produktivität',
+ 'Productivity' => 'Produktivität',
'Profit Center' => 'Erfolgsbereich',
'Proforma Invoice' => 'Proformarechnung',
'Program' => 'Programm',
'Project Number missing!' => 'Projektnummer fehlt!',
'Project Numbers' => 'Projektnummern',
'Project Transactions' => 'Projektbuchungen',
- 'Project deleted!' => 'Projekt gelöscht!',
+ 'Project deleted!' => 'Projekt gelöscht!',
'Project not on file!' => 'Dieses Projekt ist nicht in der Datenbank!',
'Project saved!' => 'Projekt gespeichert!',
'Projects' => 'Projekte',
'Quotation Date missing!' => 'Angebotsdatum fehlt!',
'Quotation Number' => 'Angebotsnummer',
'Quotation Number missing!' => 'Angebotsnummer fehlt!',
- 'Quotation deleted!' => 'Angebot wurde gelöscht.',
+ 'Quotation deleted!' => 'Angebot wurde gelöscht.',
'Quotations' => 'Angebote',
'Quote chararacter' => 'Anführungszeichen',
'Quoted' => 'Angeboten',
'Receipt' => 'Zahlungseingang',
'Receipt posted!' => 'Beleg gebucht!',
'Receipt, payment, reconciliation' => 'Zahlungseingang, Zahlungsausgang, Kontenabgleich',
- 'Receipts' => 'Zahlungseingänge',
+ 'Receipts' => 'Zahlungseingänge',
'Receivables' => 'Forderungen',
'Rechnungsnummer' => 'Rechnungsnummer',
'Reconciliation' => 'Kontenabgleich',
'Record Vendor Invoice' => 'Eingangsrechnung eingeben',
'Record in' => 'Buchen auf',
'Recorded Tax' => 'Gespeicherte Steuern',
- 'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
+ 'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
'Reference' => 'Referenz',
'Reference missing!' => 'Referenz fehlt!',
'Release From Stock' => 'Lagerausgang',
'Remaining' => 'Rest',
- 'Remittance information prefix' => 'Verwendungszweckvorbelegung (Präfix)',
+ 'Remittance information prefix' => 'Verwendungszweckvorbelegung (Präfix)',
'Removal' => 'Entnahme',
'Removal from Warehouse' => 'Lagerentnahme',
'Removal from warehouse' => 'Entnahme aus Lager',
'Remove draft when posting' => 'Entwurf beim Buchen löschen',
'Remove from group' => 'Aus Gruppe entfernen',
'Removed spoolfiles!' => 'Druckdateien entfernt!',
- 'Removing marked entries from queue ...' => 'Markierte Einträge werden von der Warteschlange entfernt ...',
+ 'Removing marked entries from queue ...' => 'Markierte Einträge werden von der Warteschlange entfernt ...',
'Rename the group' => 'Gruppe umbenennen',
'Report Positions' => 'Berichte',
'Report about warehouse contents' => 'Lagerbestand anzeigen',
'Report about warehouse transactions' => 'Lagerbuchungen anzeigen',
'Report and misc. Preferences' => 'Sonstige Einstellungen',
- 'Report for' => 'Bericht für',
+ 'Report for' => 'Bericht für',
'Reports' => 'Berichte',
'Representative' => 'Vertreter',
'Reqdate' => 'Lieferdatum',
'Request for Quotation' => 'Anfrage',
'Request for Quotations' => 'Anfragen',
'Request quotation' => 'Preisanfrage',
- 'Requested execution date' => 'Gewünschtes Ausführungsdatum',
- 'Requested execution date from' => 'Gewünschtes Ausführungsdatum von',
- 'Requested execution date to' => 'Gewünschtes Ausführungsdatum bis',
+ 'Requested execution date' => 'Gewünschtes Ausführungsdatum',
+ 'Requested execution date from' => 'Gewünschtes Ausführungsdatum von',
+ 'Requested execution date to' => 'Gewünschtes Ausführungsdatum bis',
'Required by' => 'Lieferdatum',
'Restore Dataset' => 'Datenbank wiederherstellen',
- 'Revenue' => 'Erlöskonto',
- 'Revenue Account' => 'Erlöskonto',
+ 'Revenue' => 'Erlöskonto',
+ 'Revenue Account' => 'Erlöskonto',
'Revenues EU with UStId' => 'Erlöse EU m. UStId',
'Revenues EU without UStId' => 'Erlöse EU o. UStId',
'Review of Aging list' => 'Altersstrukturliste',
'SEPA XML download' => 'SEPA-XML-Download',
'SEPA creditor ID' => 'SEPA-Kreditoren-Identifikation',
'SEPA exports:' => 'SEPA-Exporte:',
- 'SEPA strings' => 'SEPA-Überweisungen',
+ 'SEPA strings' => 'SEPA-Überweisungen',
'Saldo Credit' => 'Saldo Haben',
'Saldo Debit' => 'Saldo Soll',
'Saldo neu' => 'Saldo neu',
'Sales Invoice' => 'Rechnung',
'Sales Invoices' => 'Ausgangsrechnungen',
'Sales Order' => 'Kundenauftrag',
- 'Sales Orders' => 'Aufträge',
+ 'Sales Orders' => 'Aufträge',
'Sales Report' => 'Verkaufsbericht',
- 'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
+ 'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
'Sales delivery order' => 'Lieferschein (Verkauf)',
'Sales invoice number' => 'Ausgangsrechnungsnummer',
'Sales invoices' => 'Verkaufsrechnungen',
'Sales price' => 'VK-Preis',
'Sales price total' => 'VK-Summe',
'Sales quotation' => 'Angebot',
- 'Salesman' => 'Verkäufer/in',
- 'Salesperson' => 'Verkäufer',
+ 'Salesman' => 'Verkäufer/in',
+ 'Salesperson' => 'Verkäufer',
'Same as the quote character' => 'Wie Anführungszeichen',
'Sat. Fax' => 'Sat. Fax',
'Sat. Phone' => 'Sat. Tel.',
'Satz %' => 'Satz %',
'Save' => 'Speichern',
'Save Draft' => 'Entwurf speichern',
- 'Save account first to insert taxkeys' => 'Einstellungen sind nach dem Speichern des Kontos verfügbar...',
+ 'Save account first to insert taxkeys' => 'Einstellungen sind nach dem Speichern des Kontos verfügbar...',
'Save and AP Transaction' => 'Speichern und Kreditorenbuchung erfassen',
'Save and AR Transaction' => 'Speichern und Debitorenbuchung erfassen',
- 'Save and Close' => 'Speichern und schließen',
+ 'Save and Close' => 'Speichern und schließen',
'Save and Invoice' => 'Speichern und Rechnung erfassen',
'Save and Order' => 'Speichern und Auftrag erfassen',
'Save and Quotation' => 'Speichern und Angebot',
'Search AP Aging' => 'Offene Verbindlichkeiten',
'Search AR Aging' => 'Offene Forderungen',
'Searchable' => 'Durchsuchbar',
- 'Select' => 'auswählen',
- 'Select a Customer' => 'Endkunde auswählen',
+ 'Select' => 'auswählen',
+ 'Select a Customer' => 'Endkunde auswählen',
'Select a customer' => 'Einen Kunden auswählen',
'Select a part' => 'Artikel auswählen',
'Select a part or assembly' => 'Artikel oder Erzeugnis auswählen',
- 'Select a period' => 'Bitte Zeitraum auswählen',
+ 'Select a period' => 'Bitte Zeitraum auswählen',
'Select a vendor' => 'Einen Lieferanten auswählen',
- 'Select all' => 'Alle auswählen',
- 'Select federal state...' => 'Bundesland auswählen...',
- 'Select from one of the items below' => 'Wählen Sie einen der untenstehenden Einträge',
- 'Select from one of the names below' => 'Wählen Sie einen der untenstehenden Namen',
- 'Select from one of the projects below' => 'Wählen Sie eines der untenstehenden Projekte',
- 'Select postscript or PDF!' => 'Postscript oder PDF auswählen!',
- 'Select tax office...' => 'Finanzamt auswählen...',
+ 'Select all' => 'Alle auswählen',
+ 'Select federal state...' => 'Bundesland auswählen...',
+ 'Select from one of the items below' => 'Wählen Sie einen der untenstehenden Einträge',
+ 'Select from one of the names below' => 'Wählen Sie einen der untenstehenden Namen',
+ 'Select from one of the projects below' => 'Wählen Sie eines der untenstehenden Projekte',
+ 'Select postscript or PDF!' => 'Postscript oder PDF auswählen!',
+ 'Select tax office...' => 'Finanzamt auswählen...',
'Select the chart of accounts in use' => 'Benutzten Kontenrahmen auswählen',
'Select the checkboxes that match users to the groups they should belong to.' => 'Wählen Sie diejenigen Checkboxen aus, die die Benutzer zu den gewüschten Gruppen zuordnen.',
'Select type of removal' => 'Grund der Entnahme auswählen',
'Services' => 'Dienstleistungen',
'Set Language Values' => 'Spracheinstellungen',
'Set eMail text' => 'eMail Text eingeben',
- 'Setup Menu' => 'Menü-Variante',
- 'Setup Templates' => 'Vorlagen auswählen',
+ 'Setup Menu' => 'Menü-Variante',
+ 'Setup Templates' => 'Vorlagen auswählen',
'Ship to' => 'Lieferadresse',
'Ship via' => 'Transportmittel',
'Shipping Address' => 'Lieferadresse',
'Shopartikel' => 'Shopartikel',
'Short' => 'Knapp',
'Show' => 'Zeigen',
- 'Show Salesman' => 'Verkäufer anzeigen',
+ 'Show Salesman' => 'Verkäufer anzeigen',
'Show TODO list' => 'Meine Aufgaben',
'Show by default' => 'Standardmäßig anzeigen',
'Show custom variable search inputs' => 'Suche in erweiterten Datenfeldern',
'Show details' => 'Detailsanzeige',
'Show follow ups...' => 'Zeige Wiedervorlagen...',
'Show old dunnings' => 'Alte Mahnungen anzeigen',
- 'Show overdue sales quotations and requests for quotations...' => 'Überfällige Angebote und Preisanfragen anzeigen...',
+ 'Show overdue sales quotations and requests for quotations...' => 'Überfällige Angebote und Preisanfragen anzeigen...',
'Show your TODO list after loggin in' => 'Aufgabenliste nach dem Anmelden anzeigen',
'Signature' => 'Unterschrift',
'Since bin is not enforced in the parts data, please specify a bin where goods without a specified bin will be put.' => 'Da Lagerplätze kein Pflichtfeld sind, geben Sie bitte einen Lagerplatz an, in dem Waren ohne spezifizierten Lagerplatz eingelagert werden sollen.',
- 'Skip' => 'Überspringen',
+ 'Skip' => 'Überspringen',
'Skonto' => 'Skonto',
'Skonto Terms' => 'Zahlungsziel Skonto',
'Sold' => 'Verkauft',
- 'Solution' => 'Lösung',
+ 'Solution' => 'Lösung',
'Source' => 'Beleg',
'Source BIC' => 'Quell-BIC',
'Source IBAN' => 'Quell-IBAN',
'Start Dunning Process' => 'Neue Mahnung',
'Start analysis' => 'Analyse beginnen',
'Start the correction assistant' => 'Korrekturassistenten starten',
- 'Startdate_coa' => 'Gültig ab',
- 'Starting Balance' => 'Eröffnungsbilanzwerte',
+ 'Startdate_coa' => 'Gültig ab',
+ 'Starting Balance' => 'Eröffnungsbilanzwerte',
'Statement' => 'Sammelrechnung',
'Statement Balance' => 'Sammelrechnungsbilanz',
'Statement sent to' => 'Sammelrechnung verschickt an',
'Storno (one letter abbreviation)' => 'S',
'Storno Invoice' => 'Stornorechnung',
'Storno Packing List' => 'Stornolieferschein',
- 'Street' => 'Straße',
+ 'Street' => 'Straße',
'Stylesheet' => 'Erscheinungsbild',
'Subject' => 'Betreff',
'Subject:' => 'Betreff:',
'Subtotal' => 'Zwischensumme',
- 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => 'Solche Einträge sind aber nicht DATEV-exportiertbar und müssen ebenfalls korrigiert werden.',
+ 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => 'Solche Einträge sind aber nicht DATEV-exportiertbar und müssen ebenfalls korrigiert werden.',
'Sum Credit' => 'Summe Haben',
'Sum Debit' => 'Summe Soll',
- 'Sum for' => 'Summe für',
+ 'Sum for' => 'Summe für',
'Sum per' => 'Summe per',
'Summen- und Saldenliste' => 'Summen- und Saldenliste',
'Superuser name' => 'Datenbankadministrator',
'Tax Period' => 'Voranmeldungszeitraum',
'Tax Position' => 'Position',
'Tax collected' => 'vereinnahmte Steuer',
- 'Tax deleted!' => 'Steuer gelöscht!',
+ 'Tax deleted!' => 'Steuer gelöscht!',
'Tax number' => 'Steuernummer',
'Tax paid' => 'Vorsteuer',
'Tax saved!' => 'Steuer gespeichert!',
'Taxdescription missing!' => 'Steuername fehlt!',
'Taxdescription_coa' => 'Steuer',
'Taxes' => 'Steuern',
- 'Taxkey' => 'Steuerschlüssel',
- 'Taxkey missing!' => 'Steuerschlüssel fehlt!',
- 'Taxkey_coa' => 'Steuerschlüssel',
+ 'Taxkey' => 'Steuerschlüssel',
+ 'Taxkey missing!' => 'Steuerschlüssel fehlt!',
+ 'Taxkey_coa' => 'Steuerschlüssel',
'Taxkeys and Taxreport Preferences' => 'Steuerautomatik und UStVA',
'Taxlink_coa' => 'Steuerautomatik',
'Taxnumber' => 'Steuernummer',
'Tel.' => 'Telefon',
'Telephone' => 'Telefon',
'Template' => 'Druckvorlage',
- 'Template Code' => 'Vorlagenkürzel',
- 'Template Code missing!' => 'Vorlagenkürzel fehlt!',
+ 'Template Code' => 'Vorlagenkürzel',
+ 'Template Code missing!' => 'Vorlagenkürzel fehlt!',
'Template database' => 'Datenbankvorlage',
'Templates' => 'Vorlagen',
'Terms missing in row ' => '+Tage fehlen in Zeile ',
'Text, text field and number variables: The default value will be used as-is.' => 'Textzeilen, Textfelder und Zahlenvariablen: Der Standardwert wird so wie er ist übernommen.',
'That export does not exist.' => 'Dieser Export existiert nicht.',
'The \'tag\' field must only consist of alphanumeric characters or the carachters - _ ( )' => 'Das Feld \'tag\' darf nur aus alphanumerischen Zeichen und den Zeichen - _ ( ) bestehen.',
- 'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
- 'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
- 'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
+ 'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
+ 'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
+ 'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
'The LDAP server "#1:#2" is unreachable. Please check config/authentication.pl.' => 'Der LDAP-Server "#1:#2" ist nicht erreichbar. Bitte überprüfen Sie die Angaben in config/authentication.pl.',
'The SEPA export has been created.' => 'Der SEPA-Export wurde erstellt',
- 'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
+ 'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
'The access rights have been saved.' => 'Die Zugriffsrechte wurden gespeichert.',
- 'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird übersprungen.',
- 'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefügt.',
+ 'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird Ã\83Å\92bersprungen.',
+ 'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefÃ\83Å\92gt.',
'The assembly has been created.' => 'Das Erzeugnis wurde hergestellt.',
'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => 'Der Korrekturassistent konnte kein Problem bei #1 feststellen. Eventuell wurde das Problem in der Zwischenzeit bereits behoben.',
'The authentication configuration file "config/authentication.pl" does not exist. This Lx-Office installation has probably not been updated correctly yet. Please contact your administrator.' => 'Die Konfigurationsdatei für die Authentifizierung "config/authentication.pl" wurde nicht gefunden. Diese Lx-Office-Installation wurde vermutlich noch nicht vollständig aktualisiert oder eingerichtet. Bitte wenden Sie sich an Ihren Administrator.',
'The authentication database is not reachable at the moment. Either it hasn\'t been set up yet or the database server might be down. Please contact your administrator.' => 'Die Authentifizierungsdatenbank kann momentan nicht erreicht werden. Entweder wurde sie noch nicht eingerichtet, oder der Datenbankserver antwortet nicht. Bitte wenden Sie sich an Ihren Administrator.',
'The available options depend on the varibale type:' => 'Die verfügbaren Optionen hängen vom Datenfeldtypen ab:',
'The backup you upload here has to be a file created with "pg_dump -o -Ft".' => 'Die von Ihnen hochzuladende Sicherungsdatei muss mit dem Programm und den Parametern "pg_dump -o -Ft" erstellt worden sein.',
- 'The bank information must not be empty.' => 'Die Bankinformationen müssen vollständig ausgefüllt werden.',
+ 'The bank information must not be empty.' => 'Die Bankinformationen müssen vollständig ausgefüllt werden.',
'The base unit does not exist or it is about to be deleted in row %d.' => 'Die Basiseinheit in Zeile %d existiert nicht oder soll gelöscht werden.',
'The base unit does not exist.' => 'Die Basiseinheit existiert nicht.',
'The base unit relations must not contain loops (e.g. by saying that unit A\'s base unit is B, B\'s base unit is C and C\'s base unit is A) in row %d.' => 'Die Beziehungen der Einheiten dürfen keine Schleifen beinhalten (z.B. wenn gesagt wird, dass Einheit As Basiseinheit B, Bs Basiseinheit C und Cs Basiseinheit A ist) in Zeile %d.',
'The creation of the authentication database failed:' => 'Das Anlegen der Authentifizierungsdatenbank schlug fehl:',
'The custom variable has been deleted.' => 'Das Datenfeld wurde gelöscht.',
'The custom variable has been saved.' => 'Das Datenfeld wurde gespeichert.',
- 'The database #1 has been successfully deleted.' => 'Die Datenbank #1 wurde erfolgreich gelöscht.',
+ 'The database #1 has been successfully deleted.' => 'Die Datenbank #1 wurde erfolgreich gelöscht.',
'The database for user management and authentication does not exist. You can create let Lx-Office create it with the following parameters:' => 'Die Datenbank zur Verwaltung der Benutzerdaten und zur Authentifizierung existiert nicht. Sie können Lx-Office diese Datenbank mit den folgenden Parametern anlegen lassen:',
'The database update/creation did not succeed. The file #1 contained the following error:' => 'Die Datenbankaktualisierung/erstellung schlug fehl. Die Datei #1 enthielt den folgenden Fehler:',
'The database upgrade for the introduction of Buchungsgruppen is now complete.' => 'Das Datenbankupgrade für die Einführung von Buchungsgruppen ist jetzt beendet.',
'The dataset has to exist before a restoration can be started.' => 'Die Datenbank muss vor der Wiederherstellung bereits angelegt worden sein.',
'The dataset name is missing.' => 'Der Datenbankname fehlt.',
'The default value depends on the variable type:' => 'Die Bedeutung des Standardwertes hängt vom Datenfeldtypen ab:',
- 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => 'Der Lieferschein wurde nicht als geliefert markiert. Der Lagerinhalt wurde nicht verändert.',
+ 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => 'Der Lieferschein wurde nicht als geliefert markiert. Der Lagerinhalt wurde nicht verändert.',
'The description is missing.' => 'Die Beschreibung fehlt.',
'The description is shown on the form. Chose something short and descriptive.' => 'Die Beschreibung wird in der jeweiligen Maske angezeigt. Sie sollte kurz und prägnant sein.',
'The directory "%s" could not be created:\n%s' => 'Das Verzeichnis "%s" konnte nicht erstellt werden:\n%s',
'The email address is missing.' => 'Die Emailadresse fehlt.',
'The factor is missing in row %d.' => 'Der Faktor fehlt in Zeile %d.',
'The factor is missing.' => 'Der Faktor fehlt.',
- 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => 'Zum Einen gab es einen Bug in Lx-Office, der dazu führte, dass bei Buchungen mit verschiedenen Steuerschlüssel auf ein Konto teilweise falsche Steuerschlüssel gespeichert wurden.',
+ 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => 'Zum Einen gab es einen Bug in Lx-Office, der dazu führte, dass bei Buchungen mit verschiedenen Steuerschlüssel auf ein Konto teilweise falsche Steuerschlüssel gespeichert wurden.',
'The follow-up date is missing.' => 'Das Wiedervorlagedatum fehlt.',
'The following Buchungsgruppen have already been created:' => 'Die folgenden Buchungsgruppen wurden bereits angelegt:',
- 'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
+ 'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
'The following drafts have been saved and can be loaded.' => 'Die folgenden Entwürfe wurden gespeichert und können geladen werden.',
- 'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
- 'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
+ 'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
+ 'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
'The following units are unknown.' => 'Die folgenden Einheiten sind unbekannt.',
'The following units exist already:' => 'Die folgenden Einheiten existieren bereits:',
'The following users have been migrated into the authentication database:' => 'Die folgenden Benutzer wurden in die Authentifizierungsdatenbank migriert:',
'The following warnings occured during an upgrade to the document templates:' => 'Die folgenden Warnungen traten während einer Aktualisierung der Dokumentenvorlagen auf:',
- 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => 'Die Formeln müssen in der folgenden Syntax eingegeben werden:<br>Bei normalen Artikeln:<br>Variablenname = Variable Einheit;<br>Variablenname2 = Variable2 Einheit2;<br>...<br>###<br>Variable + Variable2 * ( Variable - Variable2 )<br>Variablennamen und Einheiten dürfen nur aus alphanumerischen Zeichen bestehen.<br>Es muss jeweils die Gesamte Zeile eingegeben werden',
+ 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => 'Die Formeln müssen in der folgenden Syntax eingegeben werden:<br>Bei normalen Artikeln:<br>Variablenname = Variable Einheit;<br>Variablenname2 = Variable2 Einheit2;<br>...<br>###<br>Variable + Variable2 * ( Variable - Variable2 )<br>Variablennamen und Einheiten dürfen nur aus alphanumerischen Zeichen bestehen.<br>Es muss jeweils die Gesamte Zeile eingegeben werden',
'The greetings have been saved.' => 'Die Anreden wurden gespeichert',
'The group has been added.' => 'Die neue Gruppe wurde angelegt.',
'The group has been deleted.' => 'Die Gruppe wurde gelöscht.',
'The name is missing in row %d.' => 'Der Name fehlt in Zeile %d.',
'The name is missing.' => 'Der Name fehlt.',
'The name must only consist of letters, numbers and underscores and start with a letter.' => 'Der Name darf nur aus Buchstaben (keine Umlaute), Ziffern und Unterstrichen bestehen und muss mit einem Buchstaben beginnen.',
- 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => 'Die alte Datei mit den Benutzerdaten existiert in dieser Installation noch immer ("#1"). Wollen Sie diese Benutzer in die neue Authentifizierungsdatenbank migrieren lassen? Falls nicht, so werden Sie sich nicht mehr mit den Benutzerdaten aus der alten Mitgliedsdatei anmelden können.',
+ 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => 'Die alte Datei mit den Benutzerdaten existiert in dieser Installation noch immer ("#1"). Wollen Sie diese Benutzer in die neue Authentifizierungsdatenbank migrieren lassen? Falls nicht, so werden Sie sich nicht mehr mit den Benutzerdaten aus der alten Mitgliedsdatei anmelden können.',
'The option field is empty.' => 'Das Optionsfeld ist leer.',
'The parts for this delivery order have already been transferred in.' => 'Die Artikel dieses Lieferscheins wurden bereits eingelagert.',
'The parts for this delivery order have already been transferred out.' => 'Die Artikel dieses Lieferscheins wurden bereits ausgelagert.',
'The project has been saved.' => 'Das Projekt wurde gespeichert.',
'The restoration process has started. Here\'s the output of the "pg_restore" command:' => 'Der Wiederherstellungsprozess wurde gestartet. Hier ist die Ausgabe des "pg_restore"-Programmes:',
'The restoration process is complete. Please review "pg_restore"\'s output to find out if the restoration was successful.' => 'Die Wiederherstellung ist abgeschlossen. Bitte sehen Sie sich die Ausgabe von "pg_restore" an, um festzustellen, ob die Wiederherstellung erfolgreich war.',
- 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => 'Zum Anderen war es möglich, die Steuern unabhängig vom ausgewählten Steuerschlüssel selber einzugeben.',
+ 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => 'Zum Anderen war es möglich, die Steuern unabhängig vom ausgewählten Steuerschlüssel selber einzugeben.',
'The second way is to use Perl\'s CPAN module and let it download and install the module for you.' => 'Die zweite Variante besteht darin, Perls CPAN-Modul zu benutzen und es das Modul für Sie installieren zu lassen.',
- 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Die ausgewählte PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Deshalb müssen Sie Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
- 'The selected bank account does not exist anymore.' => 'Das ausgewählte Bankkonto existiert nicht mehr.',
+ 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Die ausgewählte PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Deshalb müssen Sie Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
+ 'The selected bank account does not exist anymore.' => 'Das ausgewählte Bankkonto existiert nicht mehr.',
'The selected bin does not exist.' => 'Der ausgewählte Lagerplatz existiert nicht.',
- 'The selected exports have been closed.' => 'Die ausgewählten Exporte wurden abgeschlossen.',
+ 'The selected exports have been closed.' => 'Die ausgewählten Exporte wurden abgeschlossen.',
'The selected warehouse does not exist.' => 'Das ausgewählte Lager existiert nicht.',
'The selected warehouse is empty.' => 'Das ausgewählte Lager ist leer.',
'The session is invalid or has expired.' => 'Sie sind von Lx-Office abgemeldet.',
'The warehouse could not be deleted because it has already been used.' => 'Das Lager konnte nicht gelöscht werden, da es bereits in Benutzung war.',
'The warehouse does not contain any bins.' => 'Das Lager enthält keine Lagerplätze.',
'The warehouse or the bin is missing.' => 'Das Lager oder der Lagerplatz fehlen.',
- 'The wrong taxkeys for AP and AR transactions have been fixed.' => 'Die Probleme mit falschen Steuerschlüssel bei Kreditoren- und Debitorenbuchungen wurden behoben.',
- 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => 'Die falschen Steuerschlüssel für Warenbestandsbuchungen bei Einkaufs- und Verkaufsrechnungen wurden behoben.',
- 'The wrong taxkeys have been fixed.' => 'Die Steuerschlüssel wurden nach Ihrer Auswahl korrigiert.',
- 'There are #1 more open invoices for this customer with other currencies.' => 'Es gibt #1 weitere offene Rechnungen für diesen Kunden, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 more open invoices from this vendor with other currencies.' => 'Es gibt #1 weitere offene Rechnungen von diesem Lieferanten, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 unfinished follow-ups of which #2 are due.' => 'Es gibt #1 Wiedervorlage(n), von denen #2 fällig ist/sind.',
+ 'The wrong taxkeys for AP and AR transactions have been fixed.' => 'Die Probleme mit falschen Steuerschlüssel bei Kreditoren- und Debitorenbuchungen wurden behoben.',
+ 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => 'Die falschen Steuerschlüssel für Warenbestandsbuchungen bei Einkaufs- und Verkaufsrechnungen wurden behoben.',
+ 'The wrong taxkeys have been fixed.' => 'Die Steuerschlüssel wurden nach Ihrer Auswahl korrigiert.',
+ 'There are #1 more open invoices for this customer with other currencies.' => 'Es gibt #1 weitere offene Rechnungen für diesen Kunden, die in anderen Währungen ausgestellt wurden.',
+ 'There are #1 more open invoices from this vendor with other currencies.' => 'Es gibt #1 weitere offene Rechnungen von diesem Lieferanten, die in anderen Währungen ausgestellt wurden.',
+ 'There are #1 unfinished follow-ups of which #2 are due.' => 'Es gibt #1 Wiedervorlage(n), von denen #2 fällig ist/sind.',
'There are bookings to the account 3803 after 01.01.2007. If you didn\'t change this account manually to 19% the bookings are probably incorrect.' => 'Das Konto 3803 wurde nach dem 01.01.2007 bebucht. Falls Sie dieses Konto nicht manuell auf 19% gestellt haben sind die Buchungen wahrscheinlich mit falscher Umsatzsteuer gebucht worden.',
'There are four tax zones.' => 'Es gibt vier Steuerzonen.',
'There are no items in stock.' => 'Dieser Artikel ist nicht eingelagert.',
'There are no items on your TODO list at the moment.' => 'Ihre Aufgabenliste enthält momentan keine Einträge.',
'There are still entries in the database for which no unit has been assigned.' => 'Es gibt noch Einträge in der Datenbank, für die keine Einheit zugeordnet ist.',
'There are usually three ways to install Perl modules.' => 'Es gibt normalerweise drei Arten, ein Perlmodul zu installieren.',
- 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => 'Es gibt mindestens eine Einkaufs- oder Verkaufsrechnung, für die Lx-Office einen Steuerschlüssel ungleich 0 verzeichnet hat, obwohl für Warenbestandsbuchugen bei Rechnungen nie Steuern gebucht werden.',
- 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => 'Es gibt mindestens eine Buchung, bei der ein logisch nicht passender Steuerschlüssel ausgewählt wurde.',
+ 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => 'Es gibt mindestens eine Einkaufs- oder Verkaufsrechnung, für die Lx-Office einen Steuerschlüssel ungleich 0 verzeichnet hat, obwohl für Warenbestandsbuchugen bei Rechnungen nie Steuern gebucht werden.',
+ 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => 'Es gibt mindestens eine Buchung, bei der ein logisch nicht passender Steuerschlüssel ausgewählt wurde.',
'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, #5, for the transfer of #6.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4, #5, nicht genügend eingelagert, um insgesamt #6 auszulagern.',
'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, for the transfer of #5.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4 nicht genügend eingelagert, um insgesamt #5 auszulagern.',
'There is not enough left of \'#1\' in bin \'#2\' for the removal of #3.' => 'In Lagerplatz \'#2\' ist nicht genug von \'#1\' vorhanden, um #3 zu entnehmen.',
'There is nothing to do in this step.' => 'In diesem Schritt gibt es nichts mehr zu tun.',
'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => 'Deswegen muss man den gleichen Artikel nicht mehr mehrmals anlegen, wenn er in verschiedenen Steuerzonen gehandelt werden soll.',
'These units can be based on other units so that Lx-Office can convert prices when the user switches from one unit to another.' => 'Diese Einheiten können auf anderen Einheiten basieren, sodass Lx-Office Preise umrechnen kann, wenn der Benutzer von einer Einheit zu einer anderen Wechselt.',
- 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => 'Dieser Block ist nur dann gültig, wenn das Konto KEIN Buchungskonto ist, und wenn ein gültiger Steuerschlüssel für das Konto existiert. Wird das Konto als Buchungskonto markiert, werden diese Einstellungen entfernt.',
- 'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
+ 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => 'Dieser Block ist nur dann gültig, wenn das Konto KEIN Buchungskonto ist, und wenn ein gültiger Steuerschlüssel für das Konto existiert. Wird das Konto als Buchungskonto markiert, werden diese Einstellungen entfernt.',
+ 'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
'This corresponds to Lx-Office\'s behavior prior to version 2.4.4.' => 'Dieses entspricht dem Verhalten von Lx-Office vor Version 2.4.4.',
- 'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
+ 'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
'This customer number is already in use.' => 'Diese Kundennummer wird bereits verwendet.',
'This group will be called "Full Access".' => 'Diese Gruppe wird "Vollzugriff" genannt.',
'This installation uses an unknown chart of accounts ("#1"). This database upgrade cannot create standard buchungsgruppen automatically.' => 'Diese Installation benutzt einen unbekannten Kontenrahmen ("#1"). Dieses Datenbankupgrade kann die Standardbuchungsgruppen nicht automatisch anlegen.',
'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => 'In diesem Schritt werden bestehende Datenbanken gesucht. Es werden noch keine Änderungen vorgenommen!',
- 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
- 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
- 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
+ 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
+ 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
+ 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
'This transaction has to be split into several transactions manually.' => 'Diese Buchung muss manuell in mehrere Buchungen aufgeteilt werden.',
'This update will change the nature the onhand of goods is tracked.' => 'Dieses update ändert die Art und Weise wie Lagermengen gezält werden.',
'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => 'Dieses Upgradescript versucht, bei allen bestehenden Artikeln neu erstellte Buchungsgruppen zuzuordnen.',
'To (email)' => 'An',
'To (time)' => 'Bis',
'To Date' => 'Bis',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Um einer Gruppe einen neuen Benutzer hinzuzufügen, ändern und speichern Sie am einfachsten einen bestehenden Benutzernamen. Unter dem neuen Namen wird dann ein Benutzer mit denselben Einstellungen angelegt.',
+ 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Um einer Gruppe einen neuen Benutzer hinzuzufügen, ändern und speichern Sie am einfachsten einen bestehenden Benutzernamen. Unter dem neuen Namen wird dann ein Benutzer mit denselben Einstellungen angelegt.',
'Top' => 'Oben',
'Top (CSS)' => 'Oben (mit CSS)',
'Top (CSS) new' => 'Oben (mit CSS, neu)',
'Top (Javascript)' => 'Oben (mit Javascript)',
'Top (XUL; only for Mozilla Firefox)' => 'Oben + links (XUL, nur Mozilla Firefox)',
'Top 100' => 'Top 100',
- 'Top 100 hinzufuegen' => 'Top 100 hinzufügen',
+ 'Top 100 hinzufuegen' => 'Top 100 hinzufügen',
'Top Level' => 'Hauptartikelbezeichnung',
'Total' => 'Summe',
- 'Total Fees' => 'Kumulierte Gebühren',
+ 'Total Fees' => 'Kumulierte Gebühren',
'Total stock value' => 'Gesamter Bestandswert',
'Totals' => 'Summen',
'Trade Discount' => 'Rabatt',
'Transaction %d cancelled.' => 'Buchung %d erfolgreich storniert.',
'Transaction Date missing!' => 'Buchungsdatum fehlt!',
'Transaction ID missing.' => 'Die Buchungs-ID fehlt.',
- 'Transaction deleted!' => 'Buchung gelöscht!',
+ 'Transaction deleted!' => 'Buchung gelöscht!',
'Transaction description' => 'Vorgangsbezeichnung',
'Transaction has already been cancelled!' => 'Diese Buchung wurde bereits storniert.',
'Transaction has been split on both the credit and the debit side' => 'Sowohl auf der Soll- als auch auf der Haben-Seite gesplittete Buchung',
'USTVA 2005' => 'USTVA 2005',
'USTVA 2006' => 'USTVA 2006',
'USTVA 2007' => 'USTVA 2007',
- 'USTVA-Hint: Method' => 'Wenn Sie Ist-Versteuert sind, wählen Sie die Einnahmen-/Überschuß-Rechnung aus. Sind Sie Soll-Versteuert und bilanzverpflichtet, dann wählen Sie Bilanz aus.',
- 'USTVA-Hint: Tax Authoritys' => 'Bitte das Bundesland UND die Stadt bzw. den Einzugsbereich Ihres zuständigen Finanzamts auswählen.',
+ 'USTVA-Hint: Method' => 'Wenn Sie Ist-Versteuert sind, wählen Sie die Einnahmen-/Überschuß-Rechnung aus. Sind Sie Soll-Versteuert und bilanzverpflichtet, dann wählen Sie Bilanz aus.',
+ 'USTVA-Hint: Tax Authoritys' => 'Bitte das Bundesland UND die Stadt bzw. den Einzugsbereich Ihres zuständigen Finanzamts auswählen.',
'USt-IdNr.' => 'USt-IdNr.',
'USt-Konto' => 'USt-Konto',
'UStVA' => 'UStVA',
'UStVa' => 'UStVa',
'UStVa Einstellungen' => 'UStVa Einstellungen',
'Unbalanced Ledger' => 'Bilanzfehler',
- 'Unchecked custom variables will not appear in orders and invoices.' => 'Unmarkierte Datenfelder werden für diesen Artikel nicht in Aufträgen und Rechnungen angezeigt.',
+ 'Unchecked custom variables will not appear in orders and invoices.' => 'Unmarkierte Datenfelder werden für diesen Artikel nicht in Aufträgen und Rechnungen angezeigt.',
'Unfinished follow-ups' => 'Nicht erledigte Wiedervorlagen',
'Unit' => 'Einheit',
'Unit missing.' => 'Die Einheit fehlt.',
- 'Unit of measure' => 'Maßeinheit',
+ 'Unit of measure' => 'Maßeinheit',
'Units marked for deletion will be deleted upon saving.' => 'Einheiten, die zum Löschen markiert sind, werden beim Speichern gelöscht.',
'Units that have already been used (e.g. for parts and services or in invoices or warehouse transactions) cannot be changed.' => 'Einheiten, die bereits in Benutzung sind (z.B. bei einer Warendefinition, einer Rechnung oder bei einer Lagerbuchung) können nachträglich nicht mehr verändert werden.',
'Unknown Category' => 'Unbekannte Kategorie',
- 'Unknown Link' => 'Unbekannte Verknüpfung',
+ 'Unknown Link' => 'Unbekannte Verknüpfung',
'Unknown chart of accounts' => 'Unbekannter Kontenrahmen',
'Unknown dependency \'%s\'.' => 'Unbekannte Abhängigkeit \'%s\'.',
'Unknown problem type.' => 'Unbekannter Problem-Typ',
'Update' => 'Erneuern',
'Update Dataset' => 'Datenbank aktualisieren',
'Update Prices' => 'Preise aktualisieren',
- 'Update SKR04: new tax account 3804 (19%)' => 'Update SKR04: neues Steuerkonto 3804 (19%) für innergemeinschaftlichen Erwerb',
+ 'Update SKR04: new tax account 3804 (19%)' => 'Update SKR04: neues Steuerkonto 3804 (19%) fÃ\83Å\92r innergemeinschaftlichen Erwerb',
'Update complete' => 'Update beendet.',
'Update prices' => 'Preise aktualisieren',
'Update?' => 'Aktualisieren?',
'User Config' => 'Einstellungen',
'User Login' => 'Als Benutzer anmelden',
'User data migration' => 'Benutzerdatenmigration',
- 'User deleted!' => 'Benutzer gelöscht!',
+ 'User deleted!' => 'Benutzer gelöscht!',
'User migration complete' => 'Benutzermigration abgeschlossen',
'User name' => 'Benutzername',
'User saved!' => 'Benutzer gespeichert!',
'Username' => 'Benutzername',
'Ust-IDNr' => 'USt-IdNr.',
- 'Valid from' => 'Gültig ab',
- 'Valid until' => 'gültig bis',
+ 'Valid from' => 'Gültig ab',
+ 'Valid until' => 'gültig bis',
'Value' => 'Wert',
'Variable' => 'Variable',
'Variable Description' => 'Datenfeldbezeichnung',
'Variable Name' => 'Datenfeldname (intern)',
'Vendor' => 'Lieferant',
'Vendor Invoice' => 'Einkaufsrechnung',
- 'Vendor Invoices' => 'Rechnungseingänge',
+ 'Vendor Invoices' => 'Rechnungseingänge',
'Vendor Name' => 'Lieferantenname',
'Vendor Number' => 'Lieferantennummer',
'Vendor Order Number' => 'Bestellnummer beim Lieferanten',
- 'Vendor deleted!' => 'Lieferant gelöscht!',
+ 'Vendor deleted!' => 'Lieferant gelöscht!',
'Vendor details' => 'Lieferantendetails',
'Vendor missing!' => 'Lieferant fehlt!',
'Vendor not on file or locked!' => 'Dieser Lieferant existiert nicht oder ist gesperrt.',
'Warehouse To' => 'nach Lager',
'Warehouse content' => 'Lagerbestand',
'Warehouse deleted.' => 'Lager gelöscht.',
- 'Warehouse management' => 'Lagerverwaltung/Bestandsveränderung',
+ 'Warehouse management' => 'Lagerverwaltung/Bestandsveränderung',
'Warehouse saved.' => 'Lager gespeichert.',
'Warehouses' => 'Lager',
'Warnings during template upgrade' => 'Warnungen bei Aktualisierung der Dokumentenvorlagen',
'Weight unit' => 'Gewichtseinheit',
'What <b>term</b> you are looking for?' => 'Nach welchem <b>Begriff</b> wollen Sie suchen?',
'What type of item is this?' => 'Was ist dieser Artikel?',
- 'With Extension Of Time' => 'mit Dauerfristverlängerung',
+ 'With Extension Of Time' => 'mit Dauerfristverlängerung',
'Workflow Delivery Order' => 'Workflow Lieferschein',
'Workflow purchase_order' => 'Workflow Lieferantenauftrag',
'Workflow request_quotation' => 'Workflow Preisanfrage',
'Workflow sales_quotation' => 'Workflow Angebot',
'Wrong Period' => 'Falscher Zeitraum',
'Wrong date format!' => 'Falsches Datumsformat!',
- 'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
- 'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
+ 'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
+ 'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
'YYYY' => 'JJJJ',
'Year' => 'Jahr',
- 'Year End' => 'Jahresende',
- 'Yearly' => 'jährlich',
- 'Yearly taxreport not yet implemented' => 'Jährlicher Steuerreport für dieses Ausgabeformat noch nicht implementiert',
+ 'Yearly' => 'jährlich',
+ 'Yearly taxreport not yet implemented' => 'Jährlicher Steuerreport für dieses Ausgabeformat noch nicht implementiert',
'Yes' => 'Ja',
'Yes, included by default' => 'Ja, standardmäßig an',
'Yes/No (Checkbox)' => 'Ja/Nein (Checkbox)',
'You are logged out!' => 'Auf Wiedersehen!',
'You can also create new units now.' => 'Sie können jetzt auch neue Einheiten anlegen.',
- 'You can also delete this transaction and re-enter it manually.' => 'Alternativ können Sie die Buchung auch mit löschen lassen und sie anschließend neu eingeben.',
- 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => 'Sie haben die Möglichkeit, die Buchung zu korrigieren, indem Sie in den Drop-Down-Boxen die richtigen Steuerschlüssel auswählen und anschließend auf den Button "Buchung korrigieren" drücken.',
+ 'You can also delete this transaction and re-enter it manually.' => 'Alternativ können Sie die Buchung auch mit löschen lassen und sie anschließend neu eingeben.',
+ 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => 'Sie haben die Möglichkeit, die Buchung zu korrigieren, indem Sie in den Drop-Down-Boxen die richtigen Steuerschlüssel auswählen und anschließend auf den Button "Buchung korrigieren" drücken.',
'You can create a missing dataset by going back and chosing "Create Dataset".' => 'Sie können eine fehlende Datenbank erstellen, indem Sie jetzt zuück gehen und den Punkt "Neue Datenbank anlegen" wählen.',
'You can create warehouses and bins via the menu "System -> Warehouses".' => 'Sie können Lager und Lagerplätze über das Menü "System -> Lager" anlegen.',
'You can declare different translations for singular and plural for each unit (e.g. "day" and "days).' => 'Bei den Übersetzungen können Sie unterschiedliche Varianten für singular und plural angeben (z.B. "day" und "days").',
- 'You can either create a new database or chose an existing database.' => 'Sie können entweder eine neue Datenbank erstellen oder eine existierende auswählen.',
+ 'You can either create a new database or chose an existing database.' => 'Sie können entweder eine neue Datenbank erstellen oder eine existierende auswählen.',
'You can only delete datasets that are not in use.' => 'Sie können nur Datenbanken löschen, die momentan nicht in Benutzung sind.',
- 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => 'Sie können im Langtext und allen Übersetzungen die folgenden Variablen benutzen, die vor der Ausgabe von Lx-Office automatisch ersetzt werden:',
- 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => 'Sie können den Preis für Preisgruppe "#1" um einen negativen Prozentwert anpassen.',
+ 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => 'Sie können im Langtext und allen Übersetzungen die folgenden Variablen benutzen, die vor der Ausgabe von Lx-Office automatisch ersetzt werden:',
+ 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => 'Sie können den Preis für Preisgruppe "#1" um einen negativen Prozentwert anpassen.',
'You cannot continue before all required modules are installed.' => 'Sie können nicht fortfahren, bevor alle benötigten Pakete installiert sind.',
'You cannot continue until all unknown units have been mapped to known ones.' => 'Sie können nicht fortfahren, bis alle unbekannten Einheiten in neue Einheiten umgewandelt wurden.',
- 'You cannot create an invoice for delivery orders for different customers.' => 'Sie können keine Rechnung zu Lieferscheinen für verschiedene Kunden erstellen.',
- 'You cannot create an invoice for delivery orders from different vendors.' => 'Sie können keine Rechnung aus Lieferscheinen von verschiedenen Lieferanten erstellen.',
+ 'You cannot create an invoice for delivery orders for different customers.' => 'Sie können keine Rechnung zu Lieferscheinen für verschiedene Kunden erstellen.',
+ 'You cannot create an invoice for delivery orders from different vendors.' => 'Sie können keine Rechnung aus Lieferscheinen von verschiedenen Lieferanten erstellen.',
'You did not enter a name!' => 'Sie haben keinen Namen eingegeben!',
'You do not have the permissions to access this function.' => 'Sie verfügen nicht über die notwendigen Rechte, um auf diese Funktion zuzugreifen.',
'You have entered or selected the following shipping address for this customer:' => 'Sie haben die folgende Lieferadresse eingegeben oder ausgewählt:',
'You have not added bank accounts yet.' => 'Sie haben noch keine Bankkonten angelegt.',
- 'You have not selected any delivery order.' => 'Sie haben keinen Lieferschein ausgewählt.',
- 'You have not selected any export.' => 'Sie haben keinen Export ausgewählt.',
- 'You have not selected any item.' => 'Sie haben keine noch nicht gebuchten Einträge ausgewählt.',
- 'You have selected none of the invoices.' => 'Sie haben keine der Rechnungen ausgewählt.',
+ 'You have not selected any delivery order.' => 'Sie haben keinen Lieferschein ausgewählt.',
+ 'You have not selected any export.' => 'Sie haben keinen Export ausgewählt.',
+ 'You have not selected any item.' => 'Sie haben keine noch nicht gebuchten Einträge ausgewählt.',
+ 'You have selected none of the invoices.' => 'Sie haben keine der Rechnungen ausgewählt.',
'You have to chose a dimension unit and a service unit which will then be assigned to those entries.' => 'Sie müssen eine Maß- und eine Dienstleistungseinheit auswählen, die diesen Waren und Dienstleistungen, denen noch keine Einheit zugeordnet ist, zugeordnet wird.',
'You have to chose which unit to save for each of them.' => 'Sie müssen für jeden Artikel die neue Einheit auswählen.',
'You have to create at least one group, grant it access to Lx-Office\'s functions and assign users to it.' => 'Sie müssen mindestens eine Benutzergruppe anlegen, ihr Zugriff auf die verschiedenen Funktionsbereiche von Lx-Office gewähren und Benutzer dieser Gruppe zuordnen.',
'You have to create new Buchungsgruppen for all the combinations of inventory, income and expense accounts that have been used already.' => 'Sie müssen neue Buchungsgruppen für alle Kombinationen aus Inventar-, Erlös- und Aufwandskonto, die bereits benutzt wurden.',
- 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to enter the SEPA creditor ID in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => 'Sie müssen zumindest die Kontonummer, die Bankleitzahl, die IBAN und den BIC angeben.',
- 'You have to specify a department.' => 'Sie müssen eine Abteilung wählen.',
- 'You have to specify an execution date for each antry.' => 'Sie müssen für jeden zu buchenden Eintrag ein Ausführungsdatum angeben.',
+ 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
+ 'You have to enter the SEPA creditor ID in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
+ 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => 'Sie müssen zumindest die Kontonummer, die Bankleitzahl, die IBAN und den BIC angeben.',
+ 'You have to specify a department.' => 'Sie müssen eine Abteilung wählen.',
+ 'You have to specify an execution date for each antry.' => 'Sie müssen für jeden zu buchenden Eintrag ein Ausführungsdatum angeben.',
'You must chose a user.' => 'Sie müssen einen Benutzer auswählen.',
- 'You should create a backup of the database before proceeding because the backup might not be reversible.' => 'Sie sollten eine Sicherungskopie der Datenbank erstellen, bevor Sie fortfahren, da die Aktualisierung unter Umständen nicht umkehrbar ist.',
+ 'You should create a backup of the database before proceeding because the backup might not be reversible.' => 'Sie sollten eine Sicherungskopie der Datenbank erstellen, bevor Sie fortfahren, da die Aktualisierung unter Umständen nicht umkehrbar ist.',
'You will now be forwarded to the administration panel.' => 'Sie werden nun zum Administrationsbereich weitergeleitet.',
'You\'re not editing a file.' => 'Sie bearbeiten momentan keine Datei.',
'You\'ve already chosen the following limitations:' => 'Sie haben bereits die folgenden Einschränkungen vorgenommen:',
- 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Ihre PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Sie müssen deshalb Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
+ 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Ihre PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Sie müssen deshalb Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
'Your TODO list' => 'Meine Aufgaben',
- 'Your browser does not currently support Javascript.' => 'Ihr Browser unterstützt im Moment kein Javascript!',
+ 'Your browser does not currently support Javascript.' => 'Ihr Browser unterstützt im Moment kein Javascript!',
'Your download does not exist anymore. Please re-run the DATEV export assistant.' => 'Ihr Download existiert nicht mehr. Bitte starten Sie den DATEV-Exportassistenten erneut.',
'Zeitpunkt' => 'Zeitpunkt',
'Zeitraum' => 'Zeitraum',
'[email]' => '[email]',
'account_description' => 'Beschreibung',
'accrual' => 'Bilanzierung (Soll-Versteuerung)',
- 'all entries' => 'alle Einträge',
+ 'all entries' => 'alle Einträge',
'ap_aging_list' => 'liste_offene_verbindlichkeiten',
'ar_aging_list' => 'liste_offene_forderungen',
'as at' => 'zum Stand',
'assembly_list' => 'erzeugnisliste',
- 'back' => 'zurück',
+ 'back' => 'zurück',
'bank_collection_payment_list_#1' => 'bankeinzugszahlungsliste_#1',
'bank_transfer_payment_list_#1' => 'ueberweisungs_zahlungsliste_#1',
'bankaccounts' => 'Bankkonten',
'bin_list' => 'Lagerliste',
'bis' => 'bis',
'button' => 'Kal.',
- 'cash' => 'E/Ü-Rechnung (Ist-Versteuerung)',
+ 'cash' => 'E/Ü-Rechnung (Ist-Versteuerung)',
'chargenumber #1' => 'Chargennummer #1',
'chart_of_accounts' => 'kontenuebersicht',
- 'choice' => 'auswählen',
- 'choice part' => 'Artikel auswählen',
+ 'choice' => 'auswählen',
+ 'choice part' => 'Artikel auswählen',
'click here to edit cvars' => 'Hier klicken, um erweiterte Datenfeldern einzublenden',
- 'close' => 'schließen',
+ 'close' => 'schließen',
'closed' => 'geschlossen',
'companylogo_subtitle' => 'Warenwirtschaft und Finanzbuchhaltung',
'config/authentication.pl: Key "DB_config" is missing.' => 'config/authentication.pl: Das Schlüsselwort "DB_config" fehlt.',
'customer' => 'Kunde',
'customer_list' => 'kundenliste',
'debug' => 'Debug',
- 'delete' => 'Löschen',
+ 'delete' => 'Löschen',
'deliverydate' => 'Lieferdatum',
'direct debit' => 'Lastschrift',
'disposed' => 'Entsorgung',
'eMail?' => 'eMail?',
'ea' => 'St.',
'emailed to' => 'gemailt an',
- 'executed' => 'ausgeführt',
+ 'executed' => 'ausgeführt',
'female' => 'weiblich',
'follow_up_list' => 'wiedervorlageliste',
'for' => 'für',
- 'for Period' => 'für den Zeitraum',
+ 'for Period' => 'für den Zeitraum',
'found' => 'Gefunden',
'from (time)' => 'von',
'general_ledger_list' => 'buchungsjournal',
'history search engine' => 'Historien Suchmaschine',
'invoice' => 'Rechnung',
'invoice_list' => 'debitorenbuchungsliste',
- 'lead deleted!' => 'Kundenquelle gelöscht',
+ 'lead deleted!' => 'Kundenquelle gelöscht',
'lead saved!' => 'Kundenquelle geichert',
'list' => 'auflisten',
'list_of_payments' => 'zahlungsausgaenge',
'list_of_receipts' => 'zahlungseingaenge',
'list_of_transactions' => 'buchungsliste',
'logout' => 'abmelden',
- 'male' => 'männlich',
+ 'male' => 'männlich',
'mark as paid' => 'als bezahlt markieren',
'missing' => 'Fehlbestand',
'month' => 'Monatliche Abgabe',
'no bestbefore' => 'keine Mindesthaltbarkeit',
'no chargenumber' => 'keine Chargennummer',
'none (pricegroup)' => 'keine',
- 'not executed' => 'nicht ausgeführt',
+ 'not executed' => 'nicht ausgeführt',
'not transferred in yet' => 'noch nicht eingelagert',
'not transferred out yet' => 'noch nicht ausgelagert',
- 'not yet executed' => 'Noch nicht ausgeführt',
+ 'not yet executed' => 'Noch nicht ausgeführt',
'number' => 'Nummer',
'oe.pl::search called with unknown type' => 'oe.pl::search mit unbekanntem Typ aufgerufen',
'open' => 'Offen',
'plural first char' => 'P',
'pos_bilanz' => 'Bilanz',
'pos_bwa' => 'BWA',
- 'pos_eur' => 'E/ÜR',
+ 'pos_eur' => 'E/ÜR',
'pos_ustva' => 'UStVA',
'posted!' => 'gebucht',
'print' => 'drucken',
'purchase_delivery_order_list' => 'lieferscheinliste_einkauf',
'purchase_order' => 'Auftrag',
'purchase_order_list' => 'lieferantenauftragsliste',
- 'quarter' => 'Vierteljährliche (quartalsweise) Abgabe',
+ 'quarter' => 'Vierteljährliche (quartalsweise) Abgabe',
'quotation_list' => 'angebotsliste',
'release_material' => 'Materialausgabebe',
'report_generator_dispatch_to is not defined.' => 'report_generator_dispatch_to ist nicht definiert.',
'report_generator_nextsub is not defined.' => 'report_generator_nextsub ist nicht definiert.',
'request_quotation' => 'Angebotsanforderung',
- 'reset' => 'zurücksetzen',
+ 'reset' => 'zurücksetzen',
'return_material' => 'Materialrückgabe',
'rfq_list' => 'anfragenliste',
'sales tax identification number' => 'USt-IdNr.',
'tax_percent' => 'Prozentsatz',
'tax_rate' => 'Prozent',
'tax_taxdescription' => 'Steuername',
- 'tax_taxkey' => 'Steuerschlüssel',
+ 'tax_taxkey' => 'Steuerschlüssel',
'taxnumber' => 'Automatikkonto',
'to (date)' => 'bis',
'to (time)' => 'bis',
'up' => 'hoch',
'use program settings' => 'benutze Programmeinstellungen',
'used' => 'Verbraucht',
- 'valid from' => 'Gültig ab',
+ 'valid from' => 'Gültig ab',
'vendor' => 'Lieferant',
'vendor_invoice_list' => 'kreditorenbuchungsliste',
'vendor_list' => 'lieferantenliste',
[HTML]
-order=& ä ö ü Ä Ö Ü ß " < >
-ä=ä
-ö=ö
-ü=ü
-Ä=Ä
-Ö=Ö
-Ü=Ü
-ß=ß
+order=& ä ö ü Ä Ö Ü ß " < >
+ä=ä
+ö=ö
+ü=ü
+Ä=Ä
+Ö=Ö
+Ü=Ü
+ß=ß
"="
&=&
<=<
\n=<br>
[Template/LaTeX]
-order=\\ <pagebreak> & \n \r " $ % _ # ^ { } < > £ ± \xe1 ² ³
+order=\\ <pagebreak> & \n \r " $ % _ # ^ { } < > £ ± \xe1 ² ³
\\=\\textbackslash\s
<pagebreak>=
"=''
}=\\}
<=$<$
>=$>$
-£=\\pounds\s
+£=\\pounds\s
\n=\\newline\s
\r=
-±=$\\pm$
+±=$\\pm$
\xe1=$\\bullet$
^=\\^\\\s
-²=$^2$
-³=$^3$
+²=$^2$
+³=$^3$
[Template/OpenDocument]
order=& < > " ' \x80 \n \r
\r=
[filenames]
-order=ä ö ü Ä Ö Ü ß
-ä=ae
-ö=oe
-ü=ue
-Ä=Ae
-Ö=Oe
-Ü=Ue
-ß=ss
+order=ä ö ü Ä Ö Ü ß
+ä=ae
+ö=oe
+ü=ue
+Ä=Ae
+Ö=Oe
+Ü=Ue
+ß=ss
#!/usr/bin/perl
-# -*- coding: iso-8859-15; -*-
-# vim: fenc=ISO-8859-15
+# -*- coding: utf-8; -*-
+# vim: fenc=UTF-8
# These are all the texts to build the translations files.
# The file has the form of 'english text' => 'foreign text',
$repl->eval('help');
$repl->print("trying to auto login as '$login'...");
$repl->print($repl->eval("lxinit '$login'"));
-$repl->print($repl->eval($autorun)) if $autorun;
+if ($autorun) {
+ my $result = $repl->eval($autorun);
+ $repl->print($result->message) if ref($result) eq 'Devel::REPL::Error';
+}
$repl->run;
package Devel::REPL;
+use utf8;
use CGI qw( -no_xhtml);
use SL::Auth;
use SL::Form;
$::sendmail = "| /usr/sbin/sendmail -t";
}
- $::lxdebug = LXDebug->new;
-
eval { require "config/lx-erp.conf"; };
eval { require "config/lx-erp-local.conf"; } if -f "config/lx-erp-local.conf";
+ $::lxdebug = LXDebug->new;
$::locale = Locale->new($::language);
$::cgi = CGI->new qw();
$::form = Form->new;
Spezielle Kommandos:
help - zeigt diese Hilfe an.
- lxinit 'login' - lädt das Lx-Office Environment für den User 'login'.
- reload - lädt modifizierte Module neu.
+ lxinit 'login' - lädt das Lx-Office Environment für den User 'login'.
+ reload - lädt modifizierte Module neu.
pp DATA - zeigt die Datenstruktur mit Data::Dumper an.
quit - beendet die Konsole
EOL
-# load 'module' - läd das angegebene Modul, d.h. bin/mozilla/module.pl und SL/Module.pm.
+# load 'module' - läd das angegebene Modul, d.h. bin/mozilla/module.pl und SL/Module.pm.
}
sub pp {
- $Data::Dumper::Indent = 2;
- $Data::Dumper::Maxdepth = 2;
+ local $Data::Dumper::Indent = 2;
+ local $Data::Dumper::Maxdepth = 2;
+ local $Data::Dumper::Sortkeys = 1;
Data::Dumper::Dumper(@_);
}
=head1 AUTHOR
- Sven Schöling <s.schoeling@linet-services.de>
+ Sven Schöling <s.schoeling@linet-services.de>
=cut
push @INC, "modules/fallback"; # Only use our own versions of modules if there's no system version.
}
+
+use strict;
+
+use utf8;
use English '-no_match_vars';
use DBI;
use SL::LXDebug;
-$lxdebug = LXDebug->new();
+our $lxdebug = LXDebug->new();
use SL::Auth;
use SL::Form;
my ($opt_user, $opt_apply, $opt_applied, $opt_format, $opt_test_utf8);
my ($opt_dbhost, $opt_dbport, $opt_dbname, $opt_dbuser, $opt_dbpassword);
-our (%myconfig, $form, $user, $auth);
+our (%myconfig, $form, $user, $auth, $locale, $controls);
sub show_help {
my $help_text = <<"END_HELP"
print "LIST VIEW\n\n" .
"number tag depth priority\n";
- $i = 0;
+ my $i = 0;
foreach (@sorted_controls) {
print "$i $_->{tag} $_->{depth} $_->{priority}\n";
$i++;
calc_rev_depends();
- $dot = "|dot -T${format} ";
+ my $dot = "|dot -T${format} ";
open OUT, "${dot}> \"${file_name}\"" || die;
print OUT
$user->create_schema_info_table($form, $dbh);
my $query = qq|SELECT tag FROM schema_info|;
- $sth = $dbh->prepare($query);
+ my $sth = $dbh->prepare($query);
$sth->execute() || $form->dberror($query);
- while (($tag) = $sth->fetchrow_array()) {
+ while (my ($tag) = $sth->fetchrow_array()) {
$controls->{$tag}->{applied} = 1 if defined $controls->{$tag};
}
$sth->finish();
$user->create_schema_info_table($form, $dbh);
my $query = qq|SELECT tag, login, itime FROM schema_info ORDER BY itime|;
- $sth = $dbh->prepare($query);
+ my $sth = $dbh->prepare($query);
$sth->execute() || $form->dberror($query);
while (my $ref = $sth->fetchrow_hashref()) {
push @results, $ref;
sub build_upgrade_order {
my $name = shift;
my $order = shift;
- my $tag = shift;
+ my $tags = shift;
my $control = $controls->{$name};
foreach my $dependency (@{ $control->{depends} }) {
next if $tags->{$dependency};
$tags->{$dependency} = 1;
- build_upgrade_order($dependency, $order, $tag);
+ build_upgrade_order($dependency, $order, $tags);
}
push @{ $order }, $name;
if ($opt_test_utf8) {
$form->error("--test-utf8 used but no database name given with --dbname.") if (!$opt_dbname);
- my $iconv_to_utf8 = Text::Iconv->new("ISO-8859-15", "UTF-8");
- my $iconv_from_utf8 = Text::Iconv->new("UTF-8", "ISO-8859-15");
-
- my $umlaut_upper = 'Ä';
- my $umlaut_upper_utf8 = $iconv_to_utf8->convert($umlaut_upper);
+ my $umlaut_upper = 'Ä';
my $dbconnect = "dbi:Pg:dbname=${opt_dbname}";
$dbconnect .= ";host=${opt_dbhost}" if ($opt_dbhost);
$dbconnect .= ";port=${opt_dbport}" if ($opt_dbport);
- my $dbh = DBI->connect($dbconnect, $opt_dbuser, $opt_dbpassword);
+ my $dbh = DBI->connect($dbconnect, $opt_dbuser, $opt_dbpassword, { pg_enable_utf8 => 1 });
$form->error("UTF-8 test: Database connect failed (" . $DBI::errstr . ")") if (!$dbh);
- my ($umlaut_lower_utf8) = $dbh->selectrow_array(qq|SELECT lower(?)|, undef, $umlaut_upper_utf8);
+ my ($umlaut_lower) = $dbh->selectrow_array(qq|SELECT lower(?)|, undef, $umlaut_upper);
$dbh->disconnect();
- my $umlaut_lower = $iconv_from_utf8->convert($umlaut_lower_utf8);
-
- if ($umlaut_lower eq 'ä') {
+ if ($umlaut_lower eq 'ä') {
print "UTF-8 test was successful.\n";
- } elsif ($umlaut_lower eq 'Ä') {
+ } elsif ($umlaut_lower eq 'Ä') {
print "UTF-8 test was NOT successful: Umlauts are not modified (this might be partially ok, but you should probably not use UTF-8 on this cluster).\n";
} else {
print "UTF-8 test was NOT successful: Umlauts are destroyed. Do not use UTF-8 on this cluster.\n";
# this version of locles processes not only all required .pl files
# but also all parse_html_templated files.
+use utf8;
use strict;
use Data::Dumper;
while ($line =~ m/\[\%[^\w]*(\w+)\.\w+\(/g) {
my $plugin = $1;
- $plugins{needed}->{$plugin} = 1 if (first { $_ eq $plugin } qw(HTML LxERP JavaScript MultiColumnIterator));
+ $plugins{needed}->{$plugin} = 1 if (first { $_ eq $plugin } qw(HTML LxERP JavaScript MultiColumnIterator L));
}
while ($line =~ m/(?: # Start von Variante 1: LxERP.t8('...'); ohne darumliegende [% ... %]-Tags
(LxERP\.t8)\( # LxERP.t8( ::Parameter $1::
- ([\'\"]) # Anfang des zu übersetzenden Strings ::Parameter $2::
- (.*?) # Der zu übersetzende String ::Parameter $3::
- (?<!\\)\2 # Ende des zu übersetzenden Strings
+ ([\'\"]) # Anfang des zu übersetzenden Strings ::Parameter $2::
+ (.*?) # Der zu übersetzende String ::Parameter $3::
+ (?<!\\)\2 # Ende des zu übersetzenden Strings
| # Start von Variante 2: [% '...' | $T8 %]
\[\% # Template-Start-Tag
- [\-~#]? # Whitespace-Unterdrückung
+ [\-~#]? # Whitespace-Unterdrückung
\s* # Optional beliebig viele Whitespace
- ([\'\"]) # Anfang des zu übersetzenden Strings ::Parameter $4::
- (.*?) # Der zu übersetzende String ::Parameter $5::
- (?<!\\)\4 # Ende des zu übersetzenden Strings
+ ([\'\"]) # Anfang des zu übersetzenden Strings ::Parameter $4::
+ (.*?) # Der zu übersetzende String ::Parameter $5::
+ (?<!\\)\4 # Ende des zu übersetzenden Strings
\s*\|\s* # Pipe-Zeichen mit optionalen Whitespace davor und danach
(\$T8) # Filteraufruf ::Parameter $6::
- .*? # Optionale Argumente für den Filter
+ .*? # Optionale Argumente für den Filter
\s* # Whitespaces
- [\-~#]? # Whitespace-Unterdrückung
+ [\-~#]? # Whitespace-Unterdrückung
\%\] # Template-Ende-Tag
)
/ix) {
}
while ($line =~ m/\[\% # Template-Start-Tag
- [\-~#]? # Whitespace-Unterdrückung
+ [\-~#]? # Whitespace-Unterdrückung
\s* # Optional beliebig viele Whitespace
(?: # Die erkannten Template-Direktiven
PROCESS
open my $fh, '>', $file or die "$! : $file";
+ $charset =~ s/\r?\n//g;
my $emacs_charset = lc $charset;
print $fh "#!/usr/bin/perl\n# -*- coding: $emacs_charset; -*-\n# vim: fenc=$charset\n\n";
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{graphicx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{graphicx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
<head>
<title>Bilan</title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<%company%>
<br><%address%>
-<p>BILAN DE VÉRIFICATION
+<p>BILAN DE VÉRIFICATION
<br><%period%>
</h2>
</tr>
<tr>
- <th align=left colspan=4>BENEFICES NON DISTRIBUÉS<br><hr align=left width=250 size=5 noshade></th>
+ <th align=left colspan=4>BENEFICES NON DISTRIBUÉS<br><hr align=left width=250 size=5 noshade></th>
</tr>
<%foreach equity_account%>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
<head>
-<title>Compte de Résultat</title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<title>Compte de Résultat</title>
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<%company%>
<br><%address%>
-<p>Compte de Résultat
+<p>Compte de Résultat
<br><%period%>
</h2>
</tr>
<tr>
- <th align=left colspan=2>DÉPENSES<br><hr width=300 size=5 align=left noshade></th>
+ <th align=left colspan=2>DÉPENSES<br><hr width=300 size=5 align=left noshade></th>
</tr>
<%foreach expense_account%>
<tr valign=top>
<td> </td>
- <th align=left>Total Dépenses</th>
+ <th align=left>Total Dépenses</th>
<td align=right><%total_expenses_this_period%><br><hr noshade size=2</td>
<td align=right><%total_expenses_last_period%><br><hr noshade size=2</td>
</tr>
<head>
<title>A2A <%invnumber%> <%name%></title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<td align=right>
<h4>
- Tél : <%tel%>
+ Tél : <%tel%>
<br>Fax : <%fax%>
</h4>
</td>
</tr>
<tr>
- <th align=right>Date d'échéance</th><td width=10> </td><td><%duedate%></td>
+ <th align=right>Date d'échéance</th><td width=10> </td><td><%duedate%></td>
</tr>
<tr>
- <th align=right>N° de facture</th><td> </td><td><%invnumber%></td></tr>
+ <th align=right>N° de facture</th><td> </td><td><%invnumber%></td></tr>
</tr>
<!--
</tr>
<!--
- d'autres variables pouvant être utilisées ici :
+ d'autres variables pouvant être utilisées ici :
contact, shiptocontact, shiptophone, shiptofax
-->
<td>
<table width="100%">
<tr bgcolor="000000">
-<!-- <th align=right><font color="ffffff">N°</font></th> -->
- <th align=left><font color="ffffff">N°</font></th>
+<!-- <th align=right><font color="ffffff">N°</font></th> -->
+ <th align=left><font color="ffffff">N°</font></th>
<th align=left><font color="ffffff">Description</font></th>
- <th><font color="ffffff">Qté</font></th>
+ <th><font color="ffffff">Qté</font></th>
<th> </th>
<th><font color="ffffff">Prix</font></th>
<th><font color="ffffff">Remise</font></th>
<tr valign=top>
<!-- <td align=right><%runningnumber%>.</td>
veuillez adapter le colspan si vous comptez inclure ce poste.
-ceci permettra de décaler le poste sous-total vers la gauche.
+ceci permettra de décaler le poste sous-total vers la gauche.
-->
<td><%number%></td>
<td><%description%></td>
<%end number%>
<!--
-vous pouvez également utiliser netprice à la place de sellprice
+vous pouvez également utiliser netprice à la place de sellprice
si vous ne voulez pas afficher la remise
netprice = sellprice - discount
-->
<%if paid%>
<tr>
- <th colspan=5 align=right>Déjà payé</th>
+ <th colspan=5 align=right>Déjà payé</th>
<td colspan=2 align=right>- <%paid%></td>
</tr>
<%end paid%>
</tr>
<tr>
- <td colspan=3>À régler dans <b><%terms%></b> jours au plus tard.</td>
- <th colspan=2 align=right>Solde à régler</th>
+ <td colspan=3>À régler dans <b><%terms%></b> jours au plus tard.</td>
+ <th colspan=2 align=right>Solde à régler</th>
<th colspan=2 align=right><%total%></th>
</tr>
<table width="100%">
<tr valign=top>
<%if notes%>
- <td>À noter :</td>
+ <td>À noter :</td>
<td><%notes%></td>
<%end notes%>
<td align=right>
- Tous prix indiqués en <b><%currency%></b>
+ Tous prix indiqués en <b><%currency%></b>
<br><%shippingpoint%>
</td>
</tr>
<td colspan=7>
<table width="60%">
<tr>
- <th align=left>Détail règlements</th>
+ <th align=left>Détail règlements</th>
</tr>
<tr>
<td colspan=4>
<!-- <%foreach tax%>
<tr>
- <th colspan=7 align=left><font size=-2><%taxdescription%> Numéro de TVA <%taxnumber%></font></th>
+ <th colspan=7 align=left><font size=-2><%taxdescription%> Numéro de TVA <%taxnumber%></font></th>
</tr>
<%end tax%> -->
<%if taxincluded%>
<tr>
- <th colspan=7 align=left><font size=-2>Les taxes affichés sont inclus dans le prix.</font></th>
+ <th colspan=7 align=left><font size=-2>Les taxes affichés sont inclus dans le prix.</font></th>
</tr>
<%end taxincluded%>
<!-- business number
<tr>
- <th colspan=7 align=left><font size=-2>Régistre de Commerce&nbsp;: <%businessnumber%></font></th>
+ <th colspan=7 align=left><font size=-2>Régistre de Commerce&nbsp;: <%businessnumber%></font></th>
</tr>
-->
<!-- information banquaire -->
<tr><td>
- <h6><center>N° TVA : Banque : N° de compte : Code SWIFT : </center>
+ <h6><center>N° TVA : Banque : N° de compte : Code SWIFT : </center>
</h6>
</td>
</tr>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage[frenchb]{babel}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{tabularx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
<%address%>}\hfill
\begin{tabular}[b]{rr@{}}
- Téléphone & <%tel%>\\
- Télécopieur & <%fax%>
+ Téléphone & <%tel%>\\
+ Télécopieur & <%fax%>
\end{tabular}
\rule[1.5ex]{\textwidth}{0.5pt}
\vspace*{-12pt}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
- & reporté de la page <%lastpage%> & & & & & <%sumcarriedforward%> \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
+ & reporté de la page <%lastpage%> & & & & & <%sumcarriedforward%> \\
<%end pagebreak%>
\hfill
\begin{tabular}[t]{l@{\hspace{0.3cm}}l}
\textbf{Date de facturation} & <%invdate%> \\
- \textbf{Numéro de facture} & <%invnumber%> \\
- \textbf{Numéro de client} & <%customer_id%>
+ \textbf{Numéro de facture} & <%invnumber%> \\
+ \textbf{Numéro de client} & <%customer_id%>
\end{tabular}
\vspace{1cm}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
<%foreach number%>
<%number%> & <%description%> & <%qty%> &
<%unit%> & <%sellprice%> & <%discount%> & <%linetotal%> \\
\vspace{0.3cm}
\hfill
- Tous les prix indiqués sont en \textbf{<%currency%>}.
+ Tous les prix indiqués sont en \textbf{<%currency%>}.
\vspace{12pt}
\renewcommand{\thefootnote}{\fnsymbol{footnote}}
\footnotetext[1]{\tiny
-Le paiement doit être acquitté au plus tard <%terms%> jours à partir de
-la date de facturation. Des intérêts seront perçus à raison de 1.5\% par
-mois après <%duedate%> jusqu'à ce que le paiement soit complet. Les
-éléments retournés seront sujets à un supplément de remmagasinnage de
-10\%. Une autorisation de renvoi doit être obtenue au préalable auprès de
-<%company%>. Les frais de transports et d'assurance sur les éléments
-retournés devront être couvert par le client de façon appropriée.
-<%company%> ne peut être tenue responsable des dommages survenus pendant
+Le paiement doit être acquitté au plus tard <%terms%> jours à partir de
+la date de facturation. Des intérêts seront perçus à raison de 1.5\% par
+mois après <%duedate%> jusqu'à ce que le paiement soit complet. Les
+éléments retournés seront sujets à un supplément de remmagasinnage de
+10\%. Une autorisation de renvoi doit être obtenue au préalable auprès de
+<%company%>. Les frais de transports et d'assurance sur les éléments
+retournés devront être couvert par le client de façon appropriée.
+<%company%> ne peut être tenue responsable des dommages survenus pendant
le transit.}
\end{document}
<head>
<title>A2A <%invnumber%> <%name%></title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
</tr>
<tr>
- <th align=right>Numéro de facture :</th><td></td><td><%invnumber%></td></tr>
+ <th align=right>Numéro de facture :</th><td></td><td><%invnumber%></td></tr>
</tr>
<tr>
<td>
<table width=100%>
<tr bgcolor=000000>
- <th align=left><font color=ffffff>N°</th>
+ <th align=left><font color=ffffff>N°</th>
<th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qté</th>
+ <th><font color=ffffff>Qté</th>
<th> </th>
</tr>
<table width=100%>
<tr valign=top>
<%if notes%>
- <td>À noter :</td>
+ <td>À noter :</td>
<td><pre><%notes%></pre></td>
<%end notes%>
- <td align=right><b>EXPÉDIÉ PAR :
+ <td align=right><b>EXPÉDIÉ PAR :
<%shippingpoint%></b>
</td>
</tr>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage[frenchb]{babel}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{tabularx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
<%address%>}\hfill
\begin{tabular}[b]{rr@{}}
- Téléphone & <%tel%>\\
- Télécopieur & <%fax%>
+ Téléphone & <%tel%>\\
+ Télécopieur & <%fax%>
\end{tabular}
\rule[1.5ex]{\textwidth}{0.5pt}
\vspace*{-12pt}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rll@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Bin} \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Bin} \\
<%end pagebreak%>
\hfill
\begin{tabular}[t]{l@{\hspace{0.3cm}}l}
\textbf{Date de facture} & <%invdate%> \\
- \textbf{Numéro de facture} & <%invnumber%> \\
- \textbf{Numéro de client} & <%customer_id%>
+ \textbf{Numéro de facture} & <%invnumber%> \\
+ \textbf{Numéro de client} & <%customer_id%>
\end{tabular}
\vspace{1cm}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rll@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Bin} \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Bin} \\
<%foreach number%>
<%number%> & <%description%> & <%qty%> &
<%unit%> & <%bin%> \\
\renewcommand{\thefootnote}{\fnsymbol{footnote}}
\footnotetext[1]{\tiny
-Les éléments retournés seront sujets à un supplément de remmagasinnage de
-10\%. Une autorisation de renvoi doit être obtenue au préalable auprès de
-<%company%>. Les frais de transports et d'assurance sur les éléments
-retournés devront être couvert par le client de façon appropriée.
-<%company%> ne peut être tenue responsable des dommages survenus pendant
+Les éléments retournés seront sujets à un supplément de remmagasinnage de
+10\%. Une autorisation de renvoi doit être obtenue au préalable auprès de
+<%company%>. Les frais de transports et d'assurance sur les éléments
+retournés devront être couvert par le client de façon appropriée.
+<%company%> ne peut être tenue responsable des dommages survenus pendant
le transit.}
\end{document}
<head>
<title>Commande <%ordnumber%> <%name%></title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<td align=right>
<h4>
- Tél : <%tel%>
+ Tél : <%tel%>
<br>Fax : <%fax%>
</h4>
</td>
</tr>
<tr>
- <th align=right>N° commande</th><td> </td><td><%ordnumber%></td></tr>
+ <th align=right>N° commande</th><td> </td><td><%ordnumber%></td></tr>
</tr>
<tr>
<td>
<table width=100%>
<tr bgcolor=000000>
- <th align=left><font color=ffffff>Commandé par</th>
+ <th align=left><font color=ffffff>Commandé par</th>
</tr>
<tr>
<table width=100%>
<tr bgcolor=000000>
<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>N°</th>
+ <th align=left><font color=ffffff>N°</th>
<th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qté</th>
+ <th><font color=ffffff>Qté</th>
<th> </th>
<th><font color=ffffff>Prix</th>
<th><font color=ffffff>Montant</th>
<%foreach number%>
<tr valign=top>
<!-- <td align=right><%runningnumber%>.</td>
-veuillez ajuster le colspan si vous voulez inclure ce poste pour décaler le sous-total vers la droite.
+veuillez ajuster le colspan si vous voulez inclure ce poste pour décaler le sous-total vers la droite.
-->
<td><%number%></td>
<td><%description%></td>
</tr>
<tr>
- <td colspan=2>À régler dans <b><%terms%></b> jours au plus tard</td>
+ <td colspan=2>À régler dans <b><%terms%></b> jours au plus tard</td>
<th colspan=2 align=right>Total</th>
<th colspan=2 align=right><%total%></th>
</tr>
<table width=100%>
<tr valign=top>
<%if notes%>
- <td>À noter :</td>
+ <td>À noter :</td>
<td><pre><%notes%></pre></td>
<%end notes%>
<td align=right>
- Tous prix indiqués en <b><%currency%></b>
+ Tous prix indiqués en <b><%currency%></b>
<br><%shippingpoint%>
</td>
</tr>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage[frenchb]{babel}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{tabularx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
<%address%>}\hfill
\begin{tabular}[b]{rr@{}}
- Téléphone & <%tel%>\\
- Télécopieur & <%fax%>
+ Téléphone & <%tel%>\\
+ Télécopieur & <%fax%>
\end{tabular}
\rule[1.5ex]{\textwidth}{0.5pt}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrr@{}}
\textbf{Number} & \textbf{Description} & \textbf{Qt'y} &
\textbf{Unit} & \textbf{Price} & \textbf{Amount} \\
- & reporté de la page <%lastpage%> & & & & <%sumcarriedforward%> \\
+ & reporté de la page <%lastpage%> & & & & <%sumcarriedforward%> \\
<%end pagebreak%>
<%if reqdate%>
\textbf{Livrable le} & <%reqdate%> \\
<%end reqdate%>
- \textbf{Numéro de commande} & <%ordnumber%>
+ \textbf{Numéro de commande} & <%ordnumber%>
\end{tabular}
\vspace{1cm}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrr@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Prix} & \textbf{Montant} \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Prix} & \textbf{Montant} \\
<%foreach number%>
<%number%> & <%description%> & <%qty%> &
<%unit%> & <%sellprice%> & <%linetotal%> \\
\vspace{0.3cm}
\hfill
- Tous les prix indiqués sont en \textbf{<%currency%>}.
+ Tous les prix indiqués sont en \textbf{<%currency%>}.
\vspace{12pt}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
<head>
<title>Commande <%ordnumber%> <%name%></title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<td align=right>
<h4>
- Tél : <%tel%>
+ Tél : <%tel%>
<br>Fax : <%fax%>
</h4>
</td>
</tr>
<tr>
- <th align=right>N° commande</th><td> </td><td><%ordnumber%></td></tr>
+ <th align=right>N° commande</th><td> </td><td><%ordnumber%></td></tr>
</tr>
<tr>
<td>
<table width="100%">
<tr bgcolor="000000">
- <th align=left><font color="ffffff">Commandé par</th>
+ <th align=left><font color="ffffff">Commandé par</th>
<th align=left><font color="ffffff">Adresse d'envoi</th>
</tr>
<td>
<table width="100%">
<tr bgcolor="000000">
-<!-- <th align=right><font color="ffffff">N°</th> -->
- <th align=left><font color="ffffff">N°</th>
+<!-- <th align=right><font color="ffffff">N°</th> -->
+ <th align=left><font color="ffffff">N°</th>
<th align=left><font color="ffffff">Description</th>
- <th><font color="ffffff">Qté</th>
+ <th><font color="ffffff">Qté</th>
<th> </th>
<th><font color="ffffff">Prix</th>
<th><font color="ffffff">Remise</th>
</tr>
<tr>
- <td colspan=3>À régler dans <b><%terms%></b> jours au plus tard</td>
+ <td colspan=3>À régler dans <b><%terms%></b> jours au plus tard</td>
<th colspan=2 align=right>Total</th>
<th colspan=2 align=right><%ordtotal%></th>
</tr>
<table width="100%">
<tr valign=top>
<%if notes%>
- <td>À noter :</td>
+ <td>À noter :</td>
<td><%notes%></td>
<%end notes%>
<td align=right>
- Tous prix indiqués en <b><%currency%></b>
+ Tous prix indiqués en <b><%currency%></b>
<br><%shippingpoint%>
</td>
</tr>
</tr>
<tr>
<td colspan=5>
- <h6><center>N° TVA : Banque : N° de compte : Code SWIFT : </center>
+ <h6><center>N° TVA : Banque : N° de compte : Code SWIFT : </center>
</h6>
</td>
</tr>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage[frenchb]{babel}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage{tabularx}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
<%address%>}\hfill
\begin{tabular}[b]{rr@{}}
- Téléphone & <%tel%>\\
- Télécopieur & <%fax%>
+ Téléphone & <%tel%>\\
+ Télécopieur & <%fax%>
\end{tabular}
\rule[1.5ex]{\textwidth}{0.5pt}
\vspace*{-12pt}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
- & reporté de la page <%lastpage%> & & & & & <%sumcarriedforward%> \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
+ & reporté de la page <%lastpage%> & & & & & <%sumcarriedforward%> \\
<%end pagebreak%>
<%if reqdate%>
\textbf{Livrable le} & <%reqdate%> \\
<%end reqdate%>
- \textbf{Numéro de commande} & <%ordnumber%>
+ \textbf{Numéro de commande} & <%ordnumber%>
\end{tabular}
\vspace{1cm}
\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
- \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
+ \textbf{Numéro} & \textbf{Description} & \textbf{Qté} &
+ \textbf{Unité} & \textbf{Prix} & \textbf{Remise} & \textbf{Montant} \\
<%foreach number%>
<%number%> & <%description%> & <%qty%> &
<%unit%> & <%sellprice%> & <%discount%> & <%linetotal%> \\
\vspace{0.3cm}
\hfill
- Tous les prix indiqués sont en \textbf{<%currency%>}.
+ Tous les prix indiqués sont en \textbf{<%currency%>}.
\vspace{12pt}
\renewcommand{\thefootnote}{\fnsymbol{footnote}}
\footnotetext[1]{\tiny
-Un supplément de 10% sera appliqué à toute commande spécifique et à tout
-produit adapté, amélioré ou mis-à-jour à la demande du client. Les
-éléments non-retournables sont indiqués ci-dessus.
+Un supplément de 10% sera appliqué à toute commande spécifique et à tout
+produit adapté, amélioré ou mis-à-jour à la demande du client. Les
+éléments non-retournables sont indiqués ci-dessus.
}
\end{document}
<head>
<title>Extrait de compte pour <%name%></title>
-<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=iso-8859-15">
+<meta HTTP-EQUIV="Content-Type" CONTENT="text/html; charset=utf-8">
</head>
<th></th>
<td align=right>
<h4>
- Tél : <%tel%>
+ Tél : <%tel%>
<br>Fax : <%fax%>
</h4>
</td>
<br><%country%>
<br>
<%if customerphone%>
- <br>Tél : <%customerphone%>
+ <br>Tél : <%customerphone%>
<%end customerphone%>
<%if customerfax%>
<br>Fax : <%customerfax%>
<td>
<table width=100%>
<tr>
- <th align=left>Facture n°</th>
+ <th align=left>Facture n°</th>
<th width=15%>Date</th>
<th width=15%>Echeance</th>
<th width=10%>Actuel</th>
<td align=right>
<table width=50%>
<tr>
- <th>Solde impayé</th>
+ <th>Solde impayé</th>
<th align=right><%total%></th>
</tr>
</table>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.8cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.8cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.8cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.8cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.7cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.7cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN">
<html>
<head>
- <meta content="text/html; charset=ISO-8859-1" http-equiv="content-type">
+ <meta content="text/html; charset=utf-8" http-equiv="content-type">
<title>Vorschau: UStVa</title>
<!--
Optik an Formulare angepasst: Hartmut Goebel <h.goebel@goebel-consult.de>
-Variablen hinzugefügt: Udo Spallek <udono@gmx.net>
-Text-Erklärung und unterschiedliche Zeilenfärbung ergänzt: Kai-Martin Knaak <kmk@familieknaak.de>
+Variablen hinzugefügt: Udo Spallek <udono@gmx.net>
+Text-Erklärung und unterschiedliche Zeilenfärbung ergänzt: Kai-Martin Knaak <kmk@familieknaak.de>
-->
<style>
table {
<h1>Vorschau Umsatzsteuer-Voranmeldung</h1>
<h2>Zeitraum vom <%fromdate%> bis <%todate%> </h2>
-<!-- Diese HTML-Formular ist nicht selbstrechnend.
-<p><small>Wenn ein (selbstrechnendes) Formular verwendet wird, genügt es, die
-gelb hinterlegten Felder auszufüllen. Die anderen Felder werden dann
+<!-- Diese HTML-Formular ist nicht selbstrechnend.
+<p><small>Wenn ein (selbstrechnendes) Formular verwendet wird, genügt es, die
+gelb hinterlegten Felder auszufüllen. Die anderen Felder werden dann
automatisch berechnet.</small></p>
-->
<td class="betrag ausfuellen" width="70"><%81%><br></td>
<td class="spalte"><span class="nodis">(Spalte 81 rechts)</span></td>
<td class="betrag"><%811%></td>
- </tr>
+ </tr>
<%end year2007%>
<tr>
<td class="betrag"><%53%></td>
</tr>
<tr>
- <td class="text">Lieferungen sicherungsbereigneter Gegenstände und
+ <td class="text">Lieferungen sicherungsbereigneter Gegenstände und
Umsätze, die unter das GrEStG fallen.</td>
<td class="spalte ausfuellen">73</td>
<td class="betrag ausfuellen"><%73%></td>
<td class="betrag ausfuellen"><%62%></td>
</tr>
<tr>
- <td class="text" colspan="3">Vorsteuerbeträge aus Leistungen im Sinne
+ <td class="text" colspan="3">Vorsteuerbeträge aus Leistungen im Sinne
des §13b Abs. 1 UStG</td>
<td class="spalte ausfuellen">67</td>
<td class="betrag ausfuellen"><%67%></td>
</tr>
<tr>
- <td class="text2" colspan="3">Vorsteuerbeträge, die nach allgemeinen
+ <td class="text2" colspan="3">Vorsteuerbeträge, die nach allgemeinen
Durchschnittsästzen berechnet sind </td>
<td class="spalte ausfuellen">63</td>
<td class="betrag ausfuellen"><%63%></td>
</tr>
<tr>
<td class="text" colspan="3">Anrechnung (Abzug) der festgesetzten Sondervorauszahlung
- für Dauerfristverlngerung (nur in der letzten Voranmeldung des
+ für Dauerfristverlängerung (nur in der letzten Voranmeldung des
Besteuerungszeitraums, ausfüllen)</td>
<td class="spalte ausfuellen">39</td>
<td class="betrag ausfuellen"><%39%></td>
\documentclass[twoside]{scrartcl}
\usepackage{a4,german}
\usepackage[frame]{xy}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\usepackage[german]{babel}
\usepackage{graphicx}
\usepackage{tabularx}
\usepackage{times, german}
\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getätigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\voffset}{-0.8cm} %hier wird die HÃ\83¶henverschiebung getÃ\83â\82¬tigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÃ\83â\82¬rts
\setlength{\topmargin}{0cm}
\setlength{\headheight}{0cm}
\setlength{\headsep}{0cm}
-<?xml version="1.0" encoding="ISO-8859-1" ?>
+<?xml version="1.0" encoding="UTF-8" ?>
<!-- Diese Datei ist mit Lx-Office <%version%> generiert -->
<WinstonAusgang>
<Formular Typ="UST"></Formular>
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.4cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
\documentclass[twoside]{scrartcl}
\usepackage[frame]{xy}
\usepackage{tabularx}
-\usepackage[latin1]{inputenc}
+\usepackage[utf8]{inputenc}
\setlength{\voffset}{0.5cm}
\setlength{\hoffset}{-2.0cm}
\setlength{\topmargin}{0cm}
[%- USE T8 %]
[% USE HTML %]
-
+[% USE LxERP %]
+[% USE L %]
<input name="id" type="hidden" id="cvid" value="[% HTML.escape(id) %]">
<input name="business_save" type="hidden" value="[% HTML.escape(selectbusiness) %]">
<input name="title_save" type="hidden" value="[% HTML.escape(title) %]">
<input type="hidden" name="db" id="db" value="[% HTML.escape(db) %]">
<br>
- <input class="submit" type="submit" name="action" accesskey="s" value="[% 'Save' | $T8 %]">
- <input class="submit" type="submit" name="action" accesskey="s" value="[% 'Save and Close' | $T8 %]">
+ <input class="submit" type="submit" name="action" accesskey="s" value="[% 'Save' | $T8 %]" onclick="return check_taxzone_and_ustid()">
+ <input class="submit" type="submit" name="action" accesskey="s" value="[% 'Save and Close' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- IF is_customer %]
- <input class="submit" type="submit" name="action" value="[% 'Save and AR Transaction' | $T8 %]">
+ <input class="submit" type="submit" name="action" value="[% 'Save and AR Transaction' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- ELSE %]
- <input class="submit" type="submit" name="action" value="[% 'Save and AP Transaction' | $T8 %]">
+ <input class="submit" type="submit" name="action" value="[% 'Save and AP Transaction' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- END %]
- <input class="submit" type="submit" name="action" value="[% 'Save and Invoice' | $T8 %]">
- <input class="submit" type="submit" name="action" value="[% 'Save and Order' | $T8 %]">
+ <input class="submit" type="submit" name="action" value="[% 'Save and Invoice' | $T8 %]" onclick="return check_taxzone_and_ustid()">
+ <input class="submit" type="submit" name="action" value="[% 'Save and Order' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- IF is_customer %]
- <input class="submit" type="submit" name="action" value="[% 'Save and Quotation' | $T8 %]">
+ <input class="submit" type="submit" name="action" value="[% 'Save and Quotation' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- ELSE %]
- <input class="submit" type="submit" name="action" value="[% 'Save and RFQ' | $T8 %]">
+ <input class="submit" type="submit" name="action" value="[% 'Save and RFQ' | $T8 %]" onclick="return check_taxzone_and_ustid()">
[%- END %]
[%- IF id AND is_orphaned %]
- <input class="submit" type="submit" name="action" value="[% 'Delete' | $T8 %]">
+ [% L.submit_tag('action', LxERP.t8('Delete'), id => 'action_delete', confirm => LxERP.t8('Do you really want to delete this object?')) %]
[%- END %]
[%- IF id %]
<input type="button" class="submit" onclick="set_history_window([% HTML.escape(id) %]);" name="history" id="history" value="[% 'history' | $T8 %]">
maintab.setselectedClassTarget("link"); //"link" or "linkparent"
maintab.init();
+ function check_taxzone_and_ustid() {
+ if (($('#taxzone_id').attr('value') == '1') && ($('#ustid').attr('value') == '')) {
+ alert('[% LxERP.t8('Please enter the sales tax identification number.') %]');
+ return false;
+ }
+ return true;
+ }
+
-->
</script>
</body>
[%- USE T8 %]
[% USE HTML %][% USE LxERP %]
+[% USE L %]
+[% L.javascript_tag('jquery') %]
<body>
<div class="listtop">[% title %]</div>
<td><input name="taxnumber" size="20" value="[% HTML.escape(taxnumber) %]"></td>
<!-- Anm.: R&B 15.11.2008 VAT Reg No ist Ust-ID in GB, aber generell sollte es laut Richardson die sales tax id sein -->
<th align="right">[% 'sales tax identification number' | $T8 %]</th>
- <td><input name="ustid" maxlength="14" size="20" value="[% HTML.escape(ustid) %]"></td>
+ <td><input name="ustid" id="ustid" maxlength="14" size="20" value="[% HTML.escape(ustid) %]"></td>
[%- IF is_customer %]
<th align="right">[% 'our vendor number at customer' | $T8 %]</th>
<td><input name="c_vendor_id" size="10" value="[% HTML.escape(c_vendor_id) %]"></td>
<td>
[%- INCLUDE generic/multibox.html
name = 'taxzone_id',
+ id = 'taxzone_id',
DATA = ALL_TAXZONES,
- show_empty = 1,
+ show_empty = 0,
id_key = 'id',
label_key = 'description',
-%]
</div>
- <script type="text/javascript" src="js/jquery.js"></script>
<script type="text/javascript">
<!--
function set_gender(gender) {
-[% USE HTML %]<body onload="on_load();">
+[% USE HTML %]
+[% USE L %]
+[% L.javascript_tag('jquery') %]
+<body onload="on_load();">
<script type="text/javascript">
<!--
function on_load() {
- var row = document.getElementsByName("row")[0].value;
- var stock = document.getElementsByName("stock")[0].value;
- var in_out = document.getElementsByName("in_out")[0].value;
-
- window.opener.document.getElementsByName("stock_" + in_out + "_" + row)[0].value = stock;
+ var row = $('#row').attr('value');
+ window.opener.document.getElementsByName("stock_" + $('#in_out').attr('value') + "_" + row)[0].value = $('#stock').attr('value');
+ $(window.opener.document.getElementById("stock_in_out_qty_display_" + row)).html($('#qty_display').attr('value'));
window.close();
}
</script>
<form name="data">
- <input type="hidden" name="row" value="[% HTML.escape(row) %]">
- <input type="hidden" name="stock" value="[% HTML.escape(stock) %]">
- <input type="hidden" name="in_out" value="[% HTML.escape(in_out) %]">
+ <input type="hidden" name="row" id="row" value="[% HTML.escape(row) %]">
+ <input type="hidden" name="stock" id="stock" value="[% HTML.escape(stock) %]">
+ <input type="hidden" name="in_out" id="in_out" value="[% HTML.escape(in_out) %]">
+ <input type="hidden" name="qty_display" id="qty_display" value="[% HTML.escape(qty_display) %]">
</form>
</body>
</td>
</tr>
[%- END %]
- [%- UNLESS is_service %]
<tr>
<th align="right" nowrap>[% 'On Hand' | $T8 %]</th>
<th align="left" nowrap class="plus[% IF onhand > 0 %]1[% ELSE %]0[% END %]"> [% LxERP.format_amount(onhand) %]</th>
<th align="right" nowrap><label for="not_discountable">[% 'Not Discountable' | $T8 %]</label></th>
<td><input class="checkbox" type="checkbox" name="not_discountable" id="not_discountable" value="1" [% IF not_discountable %]checked[% END %]></td>
</tr>
- [%- END %]
[%- IF id %]
<tr>
<th align="right" nowrap="true"><label for="obsolete">[% 'Obsolete' | $T8 %]</label></th>
<tr>
<th align="right" nowrap>[% 'Group' | $T8 %]</th>
<td><input name="partsgroup" size="20"></td>
- [%- UNLESS is_service %]
<th align="right" nowrap>[% 'Serial Number' | $T8 %]</th> <td><input name="serialnumber" size="20"></td>
- [%- END %]
</tr>
[%- UNLESS is_service %]
<td colspan="3">
<input name="itemstatus" id="itemstatus_active" class="radio" type="radio" value="active" checked>
<label for="itemstatus_active">[% 'Active' | $T8 %]</label>
- [%- UNLESS is_service %]
<input name="itemstatus" id="itemstatus_onhand" class="radio" type="radio" value="onhand">
<label for="itemstatus_onhand">[% 'On Hand' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_short" class="radio" type="radio" value="short">
<label for="itemstatus_short">[% 'Short' | $T8 %]</label>
- [%- END %]
<input name="itemstatus" id="itemstatus_obsolete" class="radio" type="radio" value="obsolete">
<label for="itemstatus_obsolete">[% 'Obsolete' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_orphaned" class="radio" type="radio" value="orphaned">
<input name="l_description" id="l_description" class="checkbox" type="checkbox" value="Y" checked>
<label for="l_description">[% 'Part Description' | $T8 %]</label>
</td>
- [%- UNLESS is_service %]
<td>
<input name="l_serialnumber" id="l_serialnumber" class="checkbox" type="checkbox" value="Y">
<label for="l_serialnumber">[% 'Serial Number' | $T8 %]</label>
</td>
- [%- END %]
<td>
<input name="l_unit" id="l_unit" class="checkbox" type="checkbox" value="Y" checked>
<label for="l_unit">[% 'Unit of measure' | $T8 %]</label>
<td align="right">[% 'Separator chararacter' | $T8 %]</td>
<td>
<select name="report_generator_csv_options_sep_char" style="width: 300px">
- <option value=";" selected>;</option>
- <option value=",">,</option>
+ <option value=";">;</option>
+ <option value="," selected>,</option>
<option value=":">:</option>
<option value="TAB">TAB ([% 'The tabulator character' | $T8 %])</option>
</select>
<th align="right" nowrap>[% 'Part Description' | $T8 %]</th>
<td>
<input name="description" size="30">
- <input type="button" onclick="part_selection_window('partnumber', 'description', 'parts_id', 0, 'Form', 'no_services:')" value="?">
+ <input type="button" onclick="part_selection_window('partnumber', 'description', 'parts_id', 0, 'Form', '')" value="?">
</td>
</tr>
<th align="right" nowrap>[% 'Part Description' | $T8 %]</th>
<td>
<input name="description" size="30" value="[% HTML.escape(description) %]">
- <input type="button" onclick="part_selection_window('partnumber', 'description', 'parts_id', 0, 'Form', 'no_services:click_button=update_button')" value="?">
+ <input type="button" onclick="part_selection_window('partnumber', 'description', 'parts_id', 0, 'Form', 'click_button=update_button')" value="?">
</td>
</tr>
*_finanzamt.ini
xvfb_display
console_history
+.texmf-var