/doc/online/*/*.html
pod2html*
/doc/build/dobudish*
+/spool/*
+++ /dev/null
-#!/bin/bash
-
-echo reset lx-office-erp/admin-password-conf | debconf-communicate
-echo fset lx-office-erp/admin-password seen false | debconf-communicate
-echo fset lx-office-erp/admin-password seen false | debconf-communicate
-echo reset lx-office-erp/admin-password | debconf-communicate
-echo reset lx-office-erp/admin-password2 | debconf-communicate
-echo reset lx-office-erp/lx-office-erp-user-postgresql-password | debconf-communicate
-echo reset lx-office-erp/lx-office-erp-user-postgresql-password2 | debconf-communicate
-echo fset lx-office-erp/lx-office-erp-user-postgresql-password seen false | debconf-communicate
-echo fset lx-office-erp/lx-office-erp-user-postgresql-password2 seen false | debconf-communicate
-echo fset lx-office-erp/password-empty seen false | debconf-communicate
-echo fset lx-office-erp/password-mismatch seen false | debconf-communicate
-debconf-show lx-office-erp
-
+++ /dev/null
-/etc/lx-office-erp/lx-office-erp.apache2.conf
-/etc/lx-office-erp/lx-office-erp.cherokee
-/etc/lx-office-erp/lx-office-erp.cherokee.handler
-/etc/lx-office-erp/lx_office.conf.default
+++ /dev/null
-#!/bin/sh
-
-set -e
-#set -x
-
-
-# Source debconf library
-. /usr/share/debconf/confmodule
-db_version 2.0
-
-echo "! config $STATE !" >> /tmp/lxo-erp.log
-
-STATE=1
-LASTSTATE=4
-while [ "$STATE" != 0 ] && [ "$STATE" -le "$LASTSTATE" ]; do
- echo "! config $STATE !" >> /tmp/lxo-erp.log
- case "$STATE" in
- 1)
- db_set lx-office-erp/admin-password-conf true || true
- db_input high lx-office-erp/admin-password-conf || true
- db_go || true
- ;;
- 2)
- db_get lx-office-erp/admin-password-conf
- if [ "$RET" = "true" ]; then
- db_input high lx-office-erp/admin-password || true
- db_go || true
- db_input high lx-office-erp/admin-password2 || true
- db_go || true
-
- fi
- ;;
- 3)
- db_get lx-office-erp/admin-password-conf
- if [ "$RET" = "true" ]; then
- db_get lx-office-erp/admin-password || true
- PASSPHRASE="$RET"
- db_get lx-office-erp/admin-password2 || true
- if [ "$RET" != "$PASSPHRASE" ]; then
- db_input high lx-office-erp/password-mismatch
- db_reset lx-office-erp/admin-password || true
- db_reset lx-office-erp/admin-password2 || true
- db_fset lx-office-erp/admin-password seen false || true
- db_fset lx-office-erp/admin-password2 seen false || true
- STATE=1
- fi
- fi
- ;;
- 4)
- db_input high lx-office-erp/lx-office-erp-user-postgresql-password || true
- db_go || true
- db_get lx-office-erp/lx-office-erp-user-postgresql-password || true
- POSTGRESQLPWD="$RET"
- if [ "#$POSTGRESQLPWD" != "#" ]; then
- db_input high lx-office-erp/lx-office-erp-user-postgresql-password2 || true
- db_go || true
- db_get lx-office-erp/lx-office-erp-user-postgresql-password2 || true
- if [ "$RET" != "$POSTGRESQLPWD" ]; then
- db_input high lx-office-erp/password-mismatch
- db_reset lx-office-erp/lx-office-erp-user-postgresql-password || true
- db_reset lx-office-erp/lx-office-erp-user-postgresql-password2 || true
- db_fset lx-office-erp/lx-office-erp-user-postgresql-password seen false || true
- db_fset lx-office-erp/lx-office-erp-user-postgresql-password2 seen false || true
- STATE=3
- fi
- else
- db_input high lx-office-erp/password-empty || true
- db_go || true
- db_reset lx-office-erp/lx-office-erp-user-postgresql-password || true
- db_fset lx-office-erp/lx-office-erp-user-postgresql-password seen false || true
- STATE=3
- fi
-
- ;;
-
- esac
-
- if db_go; then
- STATE=$(($STATE + 1))
- else
- STATE=$(($STATE - 1))
- fi
-done
+++ /dev/null
-Package: lx-office-erp
-Version: 0
-Architecture: all
-Section: universe/web
-Priority: optional
-Installed-Size: 0
-Maintainer: Holger Lindemann <hli@lx-system.de>, Adrian Weibel <adrian_weibel@web.de>
-Depends: patch, apache2 | lighttpd, libapache2-mod-fcgid | lighttpd, postgresql-8.3 | postgresql-8.4, libdbi-perl, libdbd-pg-perl, libpg-perl, libarchive-zip-perl, libyaml-perl, libio-stringy-perl, libtemplate-perl, libpdf-api2-perl, libcgi-ajax-perl, liblist-moreutils-perl, libxml-writer-perl, libtext-csv-xs-perl | libtext-csv-perl, liburi-perl, libdatetime-perl, libtext-iconv-perl, libclass-accessor-perl, libemail-address-perl, libparent-perl, librose-object-perl, librose-db-perl, librose-db-object-perl, libsort-naturally-perl | perl, libparams-validate-perl, libfcgi-perl, libconfig-std-perl
-Suggests: tetex-base | texlive-latex-base, tetex-bin | texlive-base-bin , tetex-extra | texlive-latex-extra, xpdf | evince | okular
-Homepage: http://www.lx-office.org
-Description: Extended double entry accounting system for the german market.
- Lx-Office is derived from sql-ledger and rewritten
- and extended to meet german requirements in ERP software.
- It is multi user capable and the administrator can grant and revoke
- rights to access different modules. You can manage vendors and customers
- as well as goods and attendences. Invoices and orders as well as other
- documents can be sent direcly by email. German taxes are sent to Finanzamt
- via Winston and taxbird (Elster) out of the program. The data stored in
- datasets can
- be accessed by a group of users and it is possible to sent it in DATEV
- data format to a tax consultant. Most of the documents are printable in
- html or pdf format.
- Further information about Lx-Office is available at http://www.lx-office.org .
- Revision:
-
+++ /dev/null
-Package: lx-office-erp
-Version: 0
-Architecture: all
-Section: universe/web
-Priority: optional
-Installed-Size: 0
-Maintainer: Holger Lindemann <hli@lx-system.de>, Adrian Weibel <adrian_weibel@web.de>
-Depends: patch, apache2 | apache | lighttpd, postgresql-8.3 | postgresql-8.4, libdbi-perl, libdbd-pg-perl, libpg-perl, libarchive-zip-perl, libyaml-perl, libio-stringy-perl, libtemplate-perl, libpdf-api2-perl, libcgi-ajax-perl, liblist-moreutils-perl, libxml-writer-perl, libtext-csv-xs-perl | libtext-csv-perl, liburi-perl, libdatetime-perl, libtext-iconv-perl, libclass-accessor-perl,libemail-address-perl,libparent-perl, libbit-vector-perl, libsub-exporter-perl, libclone-perl, libclass-factory-util-perl
-Suggests: tetex-base | texlive-latex-base, tetex-bin | texlive-base-bin , tetex-extra | texlive-latex-extra, xpdf | evince | okular, libfcgi-perl, libapache2-mod-fastcgi
-Homepage: http://www.lx-office.org
-Description: Extended double entry accounting system for the german market.
- Lx-Office is derived from sql-ledger and rewritten
- and extended to meet german requirements in ERP software.
- It is multi user capable and the administrator can grant and revoke
- rights to access different modules. You can manage vendors and customers
- as well as goods and attendences. Invoices and orders as well as other
- documents can be sent direcly by email. German taxes are sent to Finanzamt
- via Winston and taxbird (Elster) out of the program. The data stored in
- datasets can
- be accessed by a group of users and it is possible to sent it in DATEV
- data format to a tax consultant. Most of the documents are printable in
- html or pdf format.
- Further information about Lx-Office is available at http://www.lx-office.org .
- Revision:
-
+++ /dev/null
-744dc5f915bfe5d9f9bbfd4ad5ab8de5 usr/share/lx-office-erp/Programm.png
-7a1aed2b5b9056e24d0049c6e0bfdd14 usr/share/lx-office-erp/indentbg.gif
-cdcdc3208c6f081d64e43f7734dbc463 usr/share/lx-office-erp/dhtmlsuite/menu-bar-right-arrow.png
-3d05967de03f574e4b52d23a0d5c51fe usr/share/lx-office-erp/dhtmlsuite/menu-bar-right-arrow.gif
-54b374d0c04712faa3b00dccc1d679eb usr/share/lx-office-erp/dhtmlsuite/menu_strip_separator.gif
-56c62009b22f05b6f76ba86b9189803a usr/share/lx-office-erp/dhtmlsuite/menu-bar-gradient.jpg
-be50d99b2c395e783e947767010cac13 usr/share/lx-office-erp/dhtmlsuite/menu_strip_down_arrow.gif
-a8bd6496230f63e98547200d91301070 usr/share/lx-office-erp/dhtmlsuite/menu_strip_down_arrow.png
-e1f6f80c7603ea1a58e80be0c8b04da2 usr/share/lx-office-erp/dhtmlsuite/menu_strip_bg.jpg
-35d290eb41b43646e9e7cd5db9f32985 usr/share/lx-office-erp/shade.gif
-431cd7e7e252b29dcac1c32f72132b02 usr/share/lx-office-erp/Reports.png
-171eff99c416253e04f001e47c77fa6c usr/share/lx-office-erp/fade.png
-8418e5272d7d2f9876d177439fb8daac usr/share/lx-office-erp/right.gif
-bf3b09dc6d7d7fd6f6bc40968eb3b977 usr/share/lx-office-erp/Dunning Process.png
-caf6881a1aa7fe341c09754bd1d44f49 usr/share/lx-office-erp/expand3.gif
-4fb87c8aa407db50afda42e9e54c55e6 usr/share/lx-office-erp/shadeactive.gif
-5c1d89255437f420aa05e32603891734 usr/share/lx-office-erp/lx-office-erp.png
-08b7a2cae446229a0182620ff0b6b28c usr/share/lx-office-erp/Warehouse.png
-10316a253603cbbbebdd1e0ddeb5b48d usr/share/lx-office-erp/CRM.png
-17411648c2c5ed047946e832d0978db0 usr/share/lx-office-erp/tux.png
-900c5489979c44dc727f68efbb1a52fd usr/share/lx-office-erp/indentbg2.gif
-3322b278551e6ff572cc0f15314931f9 usr/share/lx-office-erp/px_3.gif
-06061d71db6c95dcc382c76fe0d2b889 usr/share/lx-office-erp/bg_css_menu.png
-d6da9249e10c8076fe6249d1a611385e usr/share/lx-office-erp/General Ledger.png
-aef9ee9a9910c2062c8fca9c74e97a58 usr/share/lx-office-erp/error.png
-8d6d626e2184df1b7f7c1fedb15163e2 usr/share/lx-office-erp/fade_short.png
-163240a91a9de01a9ad8e431b17c2195 usr/share/lx-office-erp/fade2.png
-7011b3b48afe66f5810d294743f9e36d usr/share/lx-office-erp/rechnung_anlegen.png
-a52b69aa493d9f1176e54aa4ef169586 usr/share/lx-office-erp/Master Data.png
-6c2c87b14636d2c53a7ca90bceb89e3b usr/share/lx-office-erp/ok.png
-126ab3e778181195f08e2c5c94339278 usr/share/lx-office-erp/transparent16x16.gif
-f92531b9e7576643faec7a7baa2a8f2d usr/share/lx-office-erp/AR.png
-44edda71d5306a419b583833979199ff usr/share/lx-office-erp/icons/32x32/Programm.png
-e3f4ecfcc9a57f2ec7f03041f0bece00 usr/share/lx-office-erp/icons/32x32/AR--Add Quotation.png
-5f2c593011299256d7e9ee70366356b3 usr/share/lx-office-erp/icons/32x32/Master Data--Add License.png
-c5bff6f49a7ecedd5ce9679ca6277ac4 usr/share/lx-office-erp/icons/32x32/Reports--Balance Sheet.png
-0bf14838fc4041374a1478a5f84006dd usr/share/lx-office-erp/icons/32x32/General Ledger--Reports--Journal.png
-e92151516841b1076d4cad083563baa9 usr/share/lx-office-erp/icons/32x32/CRM--Admin--Benutzer.png
-fdeb048794afda153e1c88785e4aa189 usr/share/lx-office-erp/icons/32x32/General Ledger--Add AR Transaction.png
-007b61954a4d4b60dff80d118cbb5e7f usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Projects.png
-d862241951047edf5de3855ce5ad2506 usr/share/lx-office-erp/icons/32x32/Reports.png
-897959e1c72cde745915367906bd3155 usr/share/lx-office-erp/icons/32x32/Master Data--Add Project.png
-fbad31126913b28fc7b14928dab81acc usr/share/lx-office-erp/icons/32x32/CRM--Admin--Gruppen.png
-90033d0b06e416246602a030915e0366 usr/share/lx-office-erp/icons/32x32/AR--Add Sales Invoice.png
-547e252508cc391be536e59b7c51e881 usr/share/lx-office-erp/icons/32x32/CRM--Wissens-DB.png
-1d6e379b4f820f6f8b15bd7e25f22b3b usr/share/lx-office-erp/icons/32x32/Cash--Reconciliation.png
-0a3332e0ac3df931da8be3d7f51e6c41 usr/share/lx-office-erp/icons/32x32/AR--Add Sales Order.png
-4bdbd8fddcd65816e3644ddb8c090bab usr/share/lx-office-erp/icons/32x32/Cash--Payment.png
-ca4a4bd4cac9f61a133225734747f84c usr/share/lx-office-erp/icons/32x32/Master Data--Reports.png
-e7c82074df6d86f0cf4fc7bac3ca202e usr/share/lx-office-erp/icons/32x32/CRM--Admin.png
-d2bd078e94fc809bd9448c9192738f47 usr/share/lx-office-erp/icons/32x32/CRM--Wiedervorlage.png
-2749d37f98570353f870b56ecece5139 usr/share/lx-office-erp/icons/32x32/Neues Fenster.png
-dfa42b6128df6acf81affc7f4c46ed60 usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Customers.png
-d486630936647f1795871560ebc62b4b usr/share/lx-office-erp/icons/32x32/AR--Add Dunning.png
-f83f5802dd3d5f0a22a4754afa7a69f0 usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Parts.png
-30607d317670c342616803d8a5c30310 usr/share/lx-office-erp/icons/32x32/AR--Reports--Invoices.png
-250b1de38066e30ca26b48b76de154fc usr/share/lx-office-erp/icons/32x32/Batch Printing--RFQs.png
-56835224e4846d375cb1c9af48083bd6 usr/share/lx-office-erp/icons/32x32/Master Data--Add Customer.png
-a4acc7ac6d922af114f3c781ca3f408c usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Services.png
-ca4a4bd4cac9f61a133225734747f84c usr/share/lx-office-erp/icons/32x32/Cash--Reports.png
-6f16c1323667ac32307692e2b70b143f usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Vendors.png
-fdb20929a79632b27dc65d926173998c usr/share/lx-office-erp/icons/32x32/Master Data--Add Service.png
-919a0e8cba9a49f00257cd357b956781 usr/share/lx-office-erp/icons/32x32/CRM--eMail.png
-6f16c1323667ac32307692e2b70b143f usr/share/lx-office-erp/icons/32x32/CRM--Lieferant.png
-1f37994119a0a397d9d3c35f6d546d1f usr/share/lx-office-erp/icons/32x32/AP--Reports--RFQs.png
-a42f5f6822162c906bcfc70b814dc749 usr/share/lx-office-erp/icons/32x32/Master Data--Add Part.png
-c85fcf3196db35287a82132edbd2ada0 usr/share/lx-office-erp/icons/32x32/Batch Printing--Quotations.png
-b937fe89cbf077dc9ef675fe6a7fa6ed usr/share/lx-office-erp/icons/32x32/CRM.png
-9a29a6d85c2e1082d525a68b0156dedd usr/share/lx-office-erp/icons/32x32/General Ledger--DATEV - Export Assistent.png
-f3f9b210e17847d46f6341a0a0dd1269 usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Projecttransactions.png
-58a822964e7438978eea74ce91bfa136 usr/share/lx-office-erp/icons/32x32/Programm--Preferences.png
-5b7cdfad6347af8e19386ceab0a7e29e usr/share/lx-office-erp/icons/32x32/Batch Printing--Packing Lists.png
-575dd383569738e457724e795580962b usr/share/lx-office-erp/icons/32x32/CRM--Service.png
-5828e4164008cd66666693032c6940be usr/share/lx-office-erp/icons/32x32/CRM--Admin--Dokumentvorlage.png
-92f6fa9dc9f675d73eb9d42df0f19c45 usr/share/lx-office-erp/icons/32x32/AP--Reports--Purchase Orders.png
-9d3a6858d15f61f7000a92bf1c8bf4f7 usr/share/lx-office-erp/icons/32x32/Warehouse--Produce Assembly.png
-c62c78191bd80aa6c4fdedb6ae98b976 usr/share/lx-office-erp/icons/32x32/CRM--Admin--Etiketten.png
-73a60ecf58c208546330d81ebc271b22 usr/share/lx-office-erp/icons/32x32/Reports--Chart of Accounts.png
-cf3768705ad99ba07decc8eee8a76fc2 usr/share/lx-office-erp/icons/32x32/General Ledger.png
-7c07613d7c092daab6425aff664ec2a8 usr/share/lx-office-erp/icons/32x32/Thumbs.db
-02deb849309b3e0e700f0dc80c09764f usr/share/lx-office-erp/icons/32x32/AR--Reports--Dunnings.png
-561154d4f29d2adfd67ad5ce8b1398cf usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Assemblies.png
-79b3b3b7d9377d6db25c6c8d5412305c usr/share/lx-office-erp/icons/32x32/General Ledger--Add Transaction.png
-c0870876b37e66bf625f45f42fe306bb usr/share/lx-office-erp/icons/32x32/Reports--Income Statement.png
-ab1dbb74a847daa2d2a235201fb8d0d8 usr/share/lx-office-erp/icons/32x32/Batch Printing--Sales Invoices.png
-2655bb3178c7e7832c957cddf85b6d36 usr/share/lx-office-erp/icons/32x32/Master Data--Add Vendor.png
-9682be8894eacea8fd0eefe7ccd78093 usr/share/lx-office-erp/icons/32x32/CRM--Admin--Status.png
-0e805a409e5dff39cf77a356e26da0a2 usr/share/lx-office-erp/icons/32x32/CRM--Hilfe.png
-5b14e8ea6013ac197d7cb9a3c4dbfb02 usr/share/lx-office-erp/icons/32x32/General Ledger--Reports--AR Aging.png
-d20e88ef3c1b7f6a6178f56df86b6fe2 usr/share/lx-office-erp/icons/32x32/Master Data.png
-05fd3778e6ae82f4e46eb16ebd76c306 usr/share/lx-office-erp/icons/32x32/Batch Printing--Purchase Orders.png
-ca4a4bd4cac9f61a133225734747f84c usr/share/lx-office-erp/icons/32x32/AR--Reports.png
-ee7dbe10f7e663defc8106774b7698a8 usr/share/lx-office-erp/icons/32x32/Master Data--Add Assembly.png
-e0c9cadeaad0862db9db1b682bee8c93 usr/share/lx-office-erp/icons/32x32/CRM--Schnellsuche.png
-479074ec7fde4920bba8ad0e9f13144a usr/share/lx-office-erp/icons/32x32/AR--Reports--Quotations.png
-a7467a65f47fbde69bcdc9760d819e1b usr/share/lx-office-erp/icons/32x32/CRM--Admin--Mitteilungen.png
-7b0eadd4b9d123dc426170e3be354b84 usr/share/lx-office-erp/icons/32x32/AR.png
-c912f21df10d3aba698e3f9528501693 usr/share/lx-office-erp/icons/32x32/AR--Reports--Sales Orders.png
-cae5ba382765e2aa6f4d7e9c4d71284f usr/share/lx-office-erp/icons/32x32/Batch Printing--Sales Orders.png
-793c2be129c06ecedb88a296ad2bf6e7 usr/share/lx-office-erp/icons/32x32/Cash--Receipt.png
-9b7d68c369fe1244827ba68a5aefb639 usr/share/lx-office-erp/icons/32x32/Programm--Logout.png
-f25554a9a816d052ca330eed727aef0a usr/share/lx-office-erp/icons/32x32/General Ledger--Add AP Transaction.png
-6915b6eb317030df14035507393e5381 usr/share/lx-office-erp/icons/32x32/Master Data--Reports--Licenses.png
-9780e07a8307a759ffacb4d0eb78886c usr/share/lx-office-erp/icons/32x32/Cash--Reports--Receipts.png
-b4be55985e5bfa03aeb116747adc8dcb usr/share/lx-office-erp/icons/32x32/System.png
-bd1641b5542fce64e3385dbf79a6082f usr/share/lx-office-erp/icons/32x32/Cash.png
-80ef52bcc3271553603a5b379aba1c69 usr/share/lx-office-erp/icons/32x32/Batch Printing--Receipts.png
-56769cedd00cefc7ad213acf7155c350 usr/share/lx-office-erp/icons/32x32/CRM--Termine.png
-038cc00d7a293addf9818f44453e0a03 usr/share/lx-office-erp/icons/32x32/Batch Printing.png
-2589c8c09a40900388e2daffd21be43d usr/share/lx-office-erp/icons/32x32/Cash--Reports--Payments.png
-465a2e1fa1124940028e4a6cd5b4217c usr/share/lx-office-erp/icons/32x32/CRM--Auftragschance.png
-c16952645537935cc70be2aaa26b3f02 usr/share/lx-office-erp/icons/32x32/General Ledger--Reports--AP Aging.png
-ca4a4bd4cac9f61a133225734747f84c usr/share/lx-office-erp/icons/32x32/General Ledger--Reports.png
-8de1ca53ab8dbab19b65f8b5ea2f7ab5 usr/share/lx-office-erp/icons/32x32/AP--Add RFQ.png
-bf8bc5f5205fbcb4ed234486628b7391 usr/share/lx-office-erp/icons/32x32/Reports--UStVa.png
-dfa42b6128df6acf81affc7f4c46ed60 usr/share/lx-office-erp/icons/32x32/CRM--Kunden.png
-ca4a4bd4cac9f61a133225734747f84c usr/share/lx-office-erp/icons/32x32/AP--Reports.png
-250b80beb6cdf0f134da533883c8ab9f usr/share/lx-office-erp/icons/32x32/Programm--Version.png
-7968eb1682cb4037a1232128e75cb95a usr/share/lx-office-erp/icons/32x32/CRM--Notizen.png
-e483a634eca75c9b845b32089132f578 usr/share/lx-office-erp/icons/32x32/AP.png
-3d33073038e513a956d693575e4afbf1 usr/share/lx-office-erp/icons/32x32/AP--Add Purchase Order.png
-2929d6e9e4e3b0cd048c4934a8ea2c6f usr/share/lx-office-erp/icons/32x32/CRM--Personen.png
-ebeeefc0deb2e19a746a9697295cc21c usr/share/lx-office-erp/icons/16x16/Programm.png
-91d821352f82175c10e3fbc3c6139d78 usr/share/lx-office-erp/icons/16x16/AR--Add Quotation.png
-f7420c0cd698205ea69c7ae60fd7a5c1 usr/share/lx-office-erp/icons/16x16/Master Data--Add License.png
-368c2e80c614c2c4e742da0deb07e2eb usr/share/lx-office-erp/icons/16x16/Reports--Balance Sheet.png
-57a11ce62c648e7ef4ebdc18444725f8 usr/share/lx-office-erp/icons/16x16/General Ledger--Reports--Journal.png
-3b970e1a7ffa1c714062e202c0025cdd usr/share/lx-office-erp/icons/16x16/CRM--Admin--Benutzer.png
-1fb5e84f325e8f7c8b14d8853c4ad434 usr/share/lx-office-erp/icons/16x16/General Ledger--Add AR Transaction.png
-dd492440a0befd3f0f6b582136229f87 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Projects.png
-3f1e718bef4330c6e4e556dca5048104 usr/share/lx-office-erp/icons/16x16/Reports.png
-6a2c9f7a762a9a8b375a172d7b7f029c usr/share/lx-office-erp/icons/16x16/Master Data--Add Project.png
-f5b75de0188d79ddc414cf17602df810 usr/share/lx-office-erp/icons/16x16/CRM--Admin--Gruppen.png
-adb1bd89124e65508a560f14cd5765f6 usr/share/lx-office-erp/icons/16x16/AR--Add Sales Invoice.png
-12dc7fec052ef883b84edb9a639a2c5b usr/share/lx-office-erp/icons/16x16/CRM--Wissens-DB.png
-18601a83a559f2b9700eeeb5fa71e48b usr/share/lx-office-erp/icons/16x16/Cash--Reconciliation.png
-2cc22c0cc24123c493bc4ea01841f4d1 usr/share/lx-office-erp/icons/16x16/AR--Add Sales Order.png
-c8a8582417978c22f639e54eadf0cd41 usr/share/lx-office-erp/icons/16x16/Cash--Payment.png
-409a88df597fbfbc8ac9adc8b3b64df0 usr/share/lx-office-erp/icons/16x16/Master Data--Reports.png
-06ec7fdba2d46cad030297f6d5a4d034 usr/share/lx-office-erp/icons/16x16/CRM--Admin.png
-2d99a775236e51ed8cc6abaced27d254 usr/share/lx-office-erp/icons/16x16/CRM--Wiedervorlage.png
-917b4103c1c7c36ae23b75adc969db70 usr/share/lx-office-erp/icons/16x16/Neues Fenster.png
-cf5a255d3dc7071720f2b716ae9696d8 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Customers.png
-566527cda42568b446a8862fe133bb1d usr/share/lx-office-erp/icons/16x16/AR--Add Dunning.png
-1a85c7f4fe06030942864f57f764111d usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Parts.png
-0c99296ec4fa2545dc7279c878ce87c8 usr/share/lx-office-erp/icons/16x16/AR--Reports--Invoices.png
-2841822666c8522d0e2f3f6e423631ce usr/share/lx-office-erp/icons/16x16/Batch Printing--RFQs.png
-c721bab1a2736eb8d5bd6c7c009ef15e usr/share/lx-office-erp/icons/16x16/Master Data--Add Customer.png
-5e365bde30c40e6059a233f2b24b3cd8 usr/share/lx-office-erp/icons/16x16/MDI-Text-Editor-16x16.png
-f06110408550f6a97df800aa83b75060 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Services.png
-409a88df597fbfbc8ac9adc8b3b64df0 usr/share/lx-office-erp/icons/16x16/Cash--Reports.png
-94081ce4440853be7e549c477b441812 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Vendors.png
-797cfb07508ff7cae93f52018856356d usr/share/lx-office-erp/icons/16x16/Master Data--Update Prices.png
-c8383fc28904dd930159b18dfe6c007a usr/share/lx-office-erp/icons/16x16/Master Data--Add Service.png
-20512ebf88a92989170c48c67bce1a8e usr/share/lx-office-erp/icons/16x16/CRM--eMail.png
-94081ce4440853be7e549c477b441812 usr/share/lx-office-erp/icons/16x16/CRM--Lieferant.png
-399048f884a45d411aaf9e368733d6a1 usr/share/lx-office-erp/icons/16x16/AP--Reports--RFQs.png
-47b3a4af63b40128a48457b2de42f232 usr/share/lx-office-erp/icons/16x16/Master Data--Add Part.png
-e8e1c055538d5c2d413f02d1a7aaffb6 usr/share/lx-office-erp/icons/16x16/Batch Printing--Quotations.png
-0794bab3cc8307ffd6251e9df676c9ca usr/share/lx-office-erp/icons/16x16/CRM.png
-a80ab9d63affe961b8b7c9e20f9d53e4 usr/share/lx-office-erp/icons/16x16/General Ledger--DATEV - Export Assistent.png
-e36635ae81d6e6b291749f6d74c8abbb usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Projecttransactions.png
-3965e970d1ca2d1b4e7e96cea651182e usr/share/lx-office-erp/icons/16x16/AR--Add Credit Note.png
-ce85162eca54866a324e18f47815eae7 usr/share/lx-office-erp/icons/16x16/Programm--Preferences.png
-387c39f7d46c1cca9b63dcd59bd7dfa9 usr/share/lx-office-erp/icons/16x16/Batch Printing--Packing Lists.png
-381624c235b74679a8db8313a8b9a99e usr/share/lx-office-erp/icons/16x16/CRM--Service.png
-259ce89eb763ad58a31980880dfceb85 usr/share/lx-office-erp/icons/16x16/CRM--Admin--Dokumentvorlage.png
-60d4d6af42e326dee9a2755465dfca24 usr/share/lx-office-erp/icons/16x16/AP--Reports--Purchase Orders.png
-faf0b1402b71bd1b166d0444b2b787ac usr/share/lx-office-erp/icons/16x16/Warehouse--Produce Assembly.png
-e9c35471d477ea26a7dee5bddde48196 usr/share/lx-office-erp/icons/16x16/CRM--Admin--Etiketten.png
-03204380dad5c3211b2ad34ae6433e81 usr/share/lx-office-erp/icons/16x16/Reports--Chart of Accounts.png
-52d07b2550afc065eda1625cc25e494c usr/share/lx-office-erp/icons/16x16/General Ledger.png
-63ec52b1e000f954665588f61134638e usr/share/lx-office-erp/icons/16x16/Thumbs.db
-1f8781e31602f6f21cfb2568ecd7bf5a usr/share/lx-office-erp/icons/16x16/AR--Reports--Dunnings.png
-66c10cecb3a8fe8f1350ea9c3f02e024 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Assemblies.png
-7a3b337b4b0a1c2024b20e6c3f0509d3 usr/share/lx-office-erp/icons/16x16/General Ledger--Add Transaction.png
-4c038862c2525d29363ce752d3b3da3b usr/share/lx-office-erp/icons/16x16/Reports--Income Statement.png
-5bb09a41f4447b64620ac3459f7c5f7c usr/share/lx-office-erp/icons/16x16/Batch Printing--Sales Invoices.png
-d2f4c798df5e6b98b0673517f8fb25eb usr/share/lx-office-erp/icons/16x16/Master Data--Add Vendor.png
-0e425cdf81079c135a7cd91c69879a47 usr/share/lx-office-erp/icons/16x16/CRM--Admin--Status.png
-8f88833d48ccbac11fe039c4a52076cb usr/share/lx-office-erp/icons/16x16/CRM--Hilfe.png
-4d0c471ff594828645a937a715af490d usr/share/lx-office-erp/icons/16x16/General Ledger--Reports--AR Aging.png
-4d6936a9521add87698aa9881f4d2295 usr/share/lx-office-erp/icons/16x16/Master Data.png
-459bd729fed676f0d16842d54ce6e968 usr/share/lx-office-erp/icons/16x16/Batch Printing--Purchase Orders.png
-409a88df597fbfbc8ac9adc8b3b64df0 usr/share/lx-office-erp/icons/16x16/AR--Reports.png
-78d4a77d4f8bffdb54400bfbfbd13e10 usr/share/lx-office-erp/icons/16x16/Master Data--Add Assembly.png
-70e9dea8142230df9030b5c4971e91e0 usr/share/lx-office-erp/icons/16x16/CRM--Schnellsuche.png
-837cb4933fbf8ae7f67c836277d8d991 usr/share/lx-office-erp/icons/16x16/AR--Reports--Quotations.png
-26bdb410961a4aaafdcbb2d07dcbcd1d usr/share/lx-office-erp/icons/16x16/CRM--Admin--Mitteilungen.png
-8b08d3ee5e8d372599fdbba4f4184179 usr/share/lx-office-erp/icons/16x16/AR.png
-9e643444bf6093e438eaf9932837a74c usr/share/lx-office-erp/icons/16x16/AR--Reports--Sales Orders.png
-02db7c1762fea4b548f2ed8e56e1c55e usr/share/lx-office-erp/icons/16x16/Batch Printing--Sales Orders.png
-2ce5056e1e267790b0a2edf2715a50b0 usr/share/lx-office-erp/icons/16x16/Cash--Receipt.png
-5c43339e4fd43789f4312f6b7c6ece1b usr/share/lx-office-erp/icons/16x16/Programm--Logout.png
-2fa3465ce450e0374b84f24e6d636c09 usr/share/lx-office-erp/icons/16x16/General Ledger--Add AP Transaction.png
-c572bd5305dd67b72001078fcc9d2ab6 usr/share/lx-office-erp/icons/16x16/Master Data--Reports--Licenses.png
-2b9a7a230497a8bf2bcac70464014ec3 usr/share/lx-office-erp/icons/16x16/Cash--Reports--Receipts.png
-088c5993c20fb1342e0b103a83a84cef usr/share/lx-office-erp/icons/16x16/System.png
-4585fac7d2a989f2ff8220b36da9ade0 usr/share/lx-office-erp/icons/16x16/Cash.png
-9138487691e12601610992758db040b2 usr/share/lx-office-erp/icons/16x16/Batch Printing--Receipts.png
-53c6ac50a7bb26fd07a2c89f5bd9dfdc usr/share/lx-office-erp/icons/16x16/CRM--Termine.png
-58341061731c1e54e46300228c4d504f usr/share/lx-office-erp/icons/16x16/Batch Printing.png
-17459a20696e2afde6483ddddc1e27ac usr/share/lx-office-erp/icons/16x16/Cash--Reports--Payments.png
-3f650fa2d2a78fa20b549eedc79d3fd8 usr/share/lx-office-erp/icons/16x16/CRM--Auftragschance.png
-1ba51e34e7983b04dfd5476bf351ea84 usr/share/lx-office-erp/icons/16x16/General Ledger--Reports--AP Aging.png
-409a88df597fbfbc8ac9adc8b3b64df0 usr/share/lx-office-erp/icons/16x16/General Ledger--Reports.png
-c36304fc49a788a91c9e48fc68eb46b3 usr/share/lx-office-erp/icons/16x16/AP--Add RFQ.png
-667e85ea7d8ce1069d0b7574bcf3de7c usr/share/lx-office-erp/icons/16x16/Reports--UStVa.png
-cf5a255d3dc7071720f2b716ae9696d8 usr/share/lx-office-erp/icons/16x16/CRM--Kunden.png
-409a88df597fbfbc8ac9adc8b3b64df0 usr/share/lx-office-erp/icons/16x16/AP--Reports.png
-2883746eccaee234281b337703caec9a usr/share/lx-office-erp/icons/16x16/Programm--Version.png
-8b8f42a4f510a2e4835fc8aab2b7dd87 usr/share/lx-office-erp/icons/16x16/CRM--Notizen.png
-3517dbeaade7bf2c0b06cfbb3703353c usr/share/lx-office-erp/icons/16x16/AP.png
-9c85cfadd1d17d7b93c0e6dcdfe39867 usr/share/lx-office-erp/icons/16x16/AP--Add Purchase Order.png
-77cbcded052fbd0a5eaa8b1fc8671cdd usr/share/lx-office-erp/icons/16x16/CRM--Personen.png
-ab5f5e25d7c478b944f5d898b50b0ae3 usr/share/lx-office-erp/icons/24x24/Programm.png
-7e17c1f352107f25c5ae97b44b024621 usr/share/lx-office-erp/icons/24x24/AR--Add Quotation.png
-350fcd24e0d01bb31552f688f934c3a0 usr/share/lx-office-erp/icons/24x24/Master Data--Add License.png
-0113086ac5a74a262fc856f0da9f9fbc usr/share/lx-office-erp/icons/24x24/Reports--Balance Sheet.png
-24c0447c1eeb47a38c60151d63bb9888 usr/share/lx-office-erp/icons/24x24/General Ledger--Reports--Journal.png
-92fb4ee49eac66fea5892c9fb24ea15b usr/share/lx-office-erp/icons/24x24/CRM--Admin--Benutzer.png
-c385da815ae2551aeda99182aab4a0eb usr/share/lx-office-erp/icons/24x24/General Ledger--Add AR Transaction.png
-1ed6d46af237856ea9704aeb7fdff329 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Projects.png
-b46f5d4c99d5942524476d7d9b98ec3e usr/share/lx-office-erp/icons/24x24/Reports.png
-cd8f1a91453388698da8519b98fffb75 usr/share/lx-office-erp/icons/24x24/Master Data--Add Project.png
-e73929ab20a014638f137add96033b17 usr/share/lx-office-erp/icons/24x24/CRM--Admin--Gruppen.png
-d0dc937a2fc134f37b7e3f5b8b8eb01b usr/share/lx-office-erp/icons/24x24/AR--Add Sales Invoice.png
-4e4dd375a8848217bb435f1ba7350109 usr/share/lx-office-erp/icons/24x24/CRM--Wissens-DB.png
-1f368d7a7eb518e4457620b0eca001e5 usr/share/lx-office-erp/icons/24x24/Cash--Reconciliation.png
-1e6a71a82191f4a5592d0d559f49772c usr/share/lx-office-erp/icons/24x24/AR--Add Sales Order.png
-c2a42dd13472d91ecc678f8fcb5caa1b usr/share/lx-office-erp/icons/24x24/Cash--Payment.png
-c5e906f14c7805886a38c5219dc599ab usr/share/lx-office-erp/icons/24x24/Master Data--Reports.png
-f242bf5321d262cca9018c505c40b25f usr/share/lx-office-erp/icons/24x24/CRM--Admin.png
-14b7545c20b0ce8af2434b05f2020c7e usr/share/lx-office-erp/icons/24x24/CRM--Wiedervorlage.png
-de5299a2ce8fa70ae05335885588a24a usr/share/lx-office-erp/icons/24x24/Neues Fenster.png
-19761a6c2bbd98f7b8e36e004c6581aa usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Customers.png
-8e75734012fa4e61f889ee21760f8603 usr/share/lx-office-erp/icons/24x24/AR--Add Dunning.png
-76afbdc0852625c5920b4ee8dda1bd26 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Parts.png
-a0852e3d50d15dd9b02fe4c7bffe2dd3 usr/share/lx-office-erp/icons/24x24/AR--Reports--Invoices.png
-e38828d8222a684072634681b1d00e1d usr/share/lx-office-erp/icons/24x24/Batch Printing--RFQs.png
-f0fad322f7a0c6518ff7a5a6e09dee47 usr/share/lx-office-erp/icons/24x24/Master Data--Add Customer.png
-194f9c13f655e554f5ce00534ded5f57 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Services.png
-c5e906f14c7805886a38c5219dc599ab usr/share/lx-office-erp/icons/24x24/Cash--Reports.png
-eca7b5359905915fce043ac077eeee35 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Vendors.png
-4f6943dce1e85f85de9434f269a5ce90 usr/share/lx-office-erp/icons/24x24/Master Data--Add Service.png
-8e1d4db4dd939e55d72aaef706cb5896 usr/share/lx-office-erp/icons/24x24/CRM--eMail.png
-eca7b5359905915fce043ac077eeee35 usr/share/lx-office-erp/icons/24x24/CRM--Lieferant.png
-5370e684e87941230237946a4aadc561 usr/share/lx-office-erp/icons/24x24/AP--Reports--RFQs.png
-24099f7d183ffc92fad5610e857a70cd usr/share/lx-office-erp/icons/24x24/Master Data--Add Part.png
-5d1855ae2ded709fde8e7bbeca9d9f69 usr/share/lx-office-erp/icons/24x24/Batch Printing--Quotations.png
-acd4daa299dbb99a9c5317c7bc5910ad usr/share/lx-office-erp/icons/24x24/CRM.png
-7b0f2e5ad9112b9453f402301b1c396a usr/share/lx-office-erp/icons/24x24/General Ledger--DATEV - Export Assistent.png
-e144f29fc44f6f2b535efe90b92a57a9 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Projecttransactions.png
-7c2011aa10a707eaf10d27209aba807c usr/share/lx-office-erp/icons/24x24/Programm--Preferences.png
-346212b282089a7939e1c072b7fbc532 usr/share/lx-office-erp/icons/24x24/Batch Printing--Packing Lists.png
-9300d1083358b22dd6b8dbe8e504d332 usr/share/lx-office-erp/icons/24x24/CRM--Service.png
-4f6f68c41c5c243fff37f8ffeb4c5936 usr/share/lx-office-erp/icons/24x24/CRM--Admin--Dokumentvorlage.png
-8064a1a0126ff365002a764a969d2cc9 usr/share/lx-office-erp/icons/24x24/AP--Reports--Purchase Orders.png
-a833b10480bd65134bbbc7f6ea885693 usr/share/lx-office-erp/icons/24x24/CRM--Admin--Etiketten.png
-7e52a96bf70a54e57fd99bef3a63f4cc usr/share/lx-office-erp/icons/24x24/Reports--Chart of Accounts.png
-13028def040c4f560043788c90cec87b usr/share/lx-office-erp/icons/24x24/General Ledger.png
-ef7706c9e5b2f14876c142ec68b4002e usr/share/lx-office-erp/icons/24x24/Thumbs.db
-c7fe84c58e1c5240878ff3e6fa889651 usr/share/lx-office-erp/icons/24x24/AR--Reports--Dunnings.png
-0c298b03c10c717bf17377a19d258ecb usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Assemblies.png
-23d6d7836ab54d0e22e72cd0454818c6 usr/share/lx-office-erp/icons/24x24/General Ledger--Add Transaction.png
-7bbadc6d7924865ff98623b354fbef84 usr/share/lx-office-erp/icons/24x24/Reports--Income Statement.png
-d6c2636b82c97d1ce32692e89f2a4cd5 usr/share/lx-office-erp/icons/24x24/Batch Printing--Sales Invoices.png
-81637a860b1d7c9b486854dbbff9af09 usr/share/lx-office-erp/icons/24x24/Master Data--Add Vendor.png
-2b79c5f793fa4ca4ee95b7cb3fa74bcc usr/share/lx-office-erp/icons/24x24/CRM--Admin--Status.png
-4b391c712fb46054feda0e3702d3d717 usr/share/lx-office-erp/icons/24x24/CRM--Hilfe.png
-ffb70cf64d1bf1b3ab497a3fb3016467 usr/share/lx-office-erp/icons/24x24/General Ledger--Reports--AR Aging.png
-87802fee0e3405973612acb493738845 usr/share/lx-office-erp/icons/24x24/Master Data.png
-aed7d7676d3b2acc505c17ca4e0c74cd usr/share/lx-office-erp/icons/24x24/Batch Printing--Purchase Orders.png
-c5e906f14c7805886a38c5219dc599ab usr/share/lx-office-erp/icons/24x24/AR--Reports.png
-6d5c6cf82868339156b6e7ee2dccbd96 usr/share/lx-office-erp/icons/24x24/Master Data--Add Assembly.png
-61f86e397ed66cc0cd5d8462469e7eff usr/share/lx-office-erp/icons/24x24/CRM--Schnellsuche.png
-72579480c41f437522841959288ab965 usr/share/lx-office-erp/icons/24x24/AR--Reports--Quotations.png
-c8620fa835651607884ca573b5d17b9a usr/share/lx-office-erp/icons/24x24/CRM--Admin--Mitteilungen.png
-d219afa97a5ea0e7530149042269edce usr/share/lx-office-erp/icons/24x24/AR.png
-ce1be1465cf96bc9690d9c686ff76b17 usr/share/lx-office-erp/icons/24x24/AR--Reports--Sales Orders.png
-9ee0143a4b3ed2f49634902b7f7aa7ac usr/share/lx-office-erp/icons/24x24/Batch Printing--Sales Orders.png
-136e60581b9dcb1354a72e550328b941 usr/share/lx-office-erp/icons/24x24/Cash--Receipt.png
-0a8ee5d762d30c73ba8ed3206bbe2b07 usr/share/lx-office-erp/icons/24x24/Programm--Logout.png
-b02ebbdf5437173e557d866b211ce986 usr/share/lx-office-erp/icons/24x24/General Ledger--Add AP Transaction.png
-739d54d645bcb6601b27d8438ab41be0 usr/share/lx-office-erp/icons/24x24/Master Data--Reports--Licenses.png
-0cbda06cdbf59f0eb0c5d686daabb66f usr/share/lx-office-erp/icons/24x24/Cash--Reports--Receipts.png
-ca3b77589ff05584282757873c280fbc usr/share/lx-office-erp/icons/24x24/System.png
-67ef1f5f06df7812126ca80369720038 usr/share/lx-office-erp/icons/24x24/Cash.png
-f08b9263595b5cfe56fb780e343662d2 usr/share/lx-office-erp/icons/24x24/Batch Printing--Receipts.png
-f873661523ebeb202db2448a69f0c765 usr/share/lx-office-erp/icons/24x24/CRM--Termine.png
-a161218a54493da844734c1a631204d9 usr/share/lx-office-erp/icons/24x24/Batch Printing.png
-ff4418bf5623f966755bbd9944c9f8fe usr/share/lx-office-erp/icons/24x24/Cash--Reports--Payments.png
-33b0b9ef817bf7239bff0948334a415d usr/share/lx-office-erp/icons/24x24/CRM--Auftragschance.png
-927b44c769f47e79dbbd6829ce6b4b40 usr/share/lx-office-erp/icons/24x24/General Ledger--Reports--AP Aging.png
-c5e906f14c7805886a38c5219dc599ab usr/share/lx-office-erp/icons/24x24/General Ledger--Reports.png
-95e956d3d92fc85822e0b0ef1cfc4150 usr/share/lx-office-erp/icons/24x24/AP--Add RFQ.png
-023bb58f3900a308886a68532a571498 usr/share/lx-office-erp/icons/24x24/Reports--UStVa.png
-19761a6c2bbd98f7b8e36e004c6581aa usr/share/lx-office-erp/icons/24x24/CRM--Kunden.png
-c5e906f14c7805886a38c5219dc599ab usr/share/lx-office-erp/icons/24x24/AP--Reports.png
-b5f2eb2f564e6dfa22d049e90e30ba11 usr/share/lx-office-erp/icons/24x24/Programm--Version.png
-7b85ab794914350ea9e0a3cf2e874f6b usr/share/lx-office-erp/icons/24x24/CRM--Notizen.png
-8a2ed10c461c88866dcd1cd10059574f usr/share/lx-office-erp/icons/24x24/AP.png
-b4b4a0983f1a1d72ed5e2218e00214ff usr/share/lx-office-erp/icons/24x24/AP--Add Purchase Order.png
-a08489b9df92579aa9ddc8288bc02b68 usr/share/lx-office-erp/icons/24x24/CRM--Personen.png
-e131bcbfb38d24e2637f57b6aa105072 usr/share/lx-office-erp/weblogo.gif
-97d8e127afb3a2d53d7cf8d7211b9263 usr/share/lx-office-erp/System.png
-bf3b09dc6d7d7fd6f6bc40968eb3b977 usr/share/lx-office-erp/Cash.png
-00704c3c47eca020b33f77af60b62808 usr/share/lx-office-erp/Batch Printing.png
-972ec1b6930c732e957b687d63b7dcf8 usr/share/lx-office-erp/bench_computer.png
-ab0803a40ef7f85b8374e432ebb8fb4f usr/share/lx-office-erp/Productivity.png
-79d19cf0ebc0cb09f17cca132b3d446c usr/share/lx-office-erp/bg_titel.gif
-8014f96cab751796c09b2e9a7fe00959 usr/share/lx-office-erp/unterpunkt2.png
-5f6d63dfd8b445437fd0166818d309a0 usr/share/lx-office-erp/down.png
-4d46f1bfd6e90b688b7ac7300dc2edc0 usr/share/lx-office-erp/up.png
-003926f0d0c5a9a1fc10c9e7287578d0 usr/share/lx-office-erp/AP.png
-58867e9b96eeabaa05d97b2896aa6ef7 usr/share/lx-office-erp/Backup.png
-293091b9d5478e61692060a4a0271ffb usr/share/lx-office-erp/unterpunkt.png
-4e77f44e118035db3f53d88e0f12cf18 usr/share/lx-office-erp/tux.gif
-a892257115f52b40d621a4a3f395d12a usr/share/doc/lx-office-erp/INSTALL/Apache_002dKonfiguration.html
-b409ad6ff0d69ed854af48b8eba41ba5 usr/share/doc/lx-office-erp/INSTALL/Installation-des-Programmpaketes.html
-62bbc3fafa44f53bff920c1828f18185 usr/share/doc/lx-office-erp/INSTALL/Lx_002dOffice-ERP-verwenden.html
-cdc37674083be9900dfc3528902b8b40 usr/share/doc/lx-office-erp/INSTALL/Gruppenmitgliedschaften-verwalten.html
-99783c46b92a2399ec5abcb2b5c0d563 usr/share/doc/lx-office-erp/INSTALL/OpenDocument_002dVorlagen.html
-a04ec58a4ebd8efb7cc02ee9022e7b40 usr/share/doc/lx-office-erp/INSTALL/Migration-alter-Installationen.html
-2c5d4d06ef6de431a387890bd5c5b14d usr/share/doc/lx-office-erp/INSTALL/Ben_00c3_00b6tigte-Software-und-Pakete.html
-f710ac5c14f8966df364d5b92ef03df6 usr/share/doc/lx-office-erp/INSTALL/Anlegen-der-Authentifizierungsdatenbank.html
-7ec38e2d512302da742905fc4295f2e7 usr/share/doc/lx-office-erp/INSTALL/Zeichens_00c3_00a4tze_002fdie-Verwendung-von-UTF_002d8.html
-f53b77360b809097488d9dae78061014 usr/share/doc/lx-office-erp/INSTALL/Erweiterung-f_00c3_00bcr-servergespeicherte-Prozeduren.html
-a0b6ee9f454ec7cbc67f80d84886f5ac usr/share/doc/lx-office-erp/INSTALL/Aktuelle-Hinweise.html
-65487d66784473cfeb7201a033fa79e7 usr/share/doc/lx-office-erp/INSTALL/Zusammenh_00c3_00a4nge.html
-ef3e822c7f85dec750acc1122ad74d24 usr/share/doc/lx-office-erp/INSTALL/Administratorpasswort.html
-750dfa7e37a11b4b67d63d638d26dad9 usr/share/doc/lx-office-erp/INSTALL/Benutzer-anlegen.html
-d06499f9fc28fc184ff29ea4468fc877 usr/share/doc/lx-office-erp/INSTALL/Passwort_00c3_00bcberpr_00c3_00bcfung.html
-0e6012dd807994ae4354ff223c4dcb0c usr/share/doc/lx-office-erp/INSTALL/Gruppen-anlegen.html
-322cd6ade20b24b0b09593ba8bfb7b8b usr/share/doc/lx-office-erp/INSTALL/Benutzerauthentifizierung-und-Administratorpasswort.html
-ab3a1d961bcf8da51d82d83455375649 usr/share/doc/lx-office-erp/INSTALL/Datenbankbenutzer-anlegen.html
-086ca75259f51098ed1d34a48d5059aa usr/share/doc/lx-office-erp/INSTALL/Benutzer_002d-und-Gruppenverwaltung.html
-ba67fdf891676004f8e92aae4732c4b5 usr/share/doc/lx-office-erp/INSTALL/Authentifizierungsdatenbank.html
-e9ab46cfa2d0faad77154c62c8ee86e5 usr/share/doc/lx-office-erp/INSTALL/Grundlagen-zur-Benutzerauthentifizierung.html
-4b1faa62bb88867832de90c141828f5e usr/share/doc/lx-office-erp/INSTALL/index.html
-d89815a6d239c1b6dd4dc9d54beaf642 usr/share/doc/lx-office-erp/INSTALL/Name-des-Session_002dCookies.html
-7659323a7aeec9c17be134291d22f919 usr/share/doc/lx-office-erp/INSTALL/Anpassung-der-PostgreSQL_002dKonfiguration.html
-4a96fbfd04473a7c6ff068486a53c082 usr/share/doc/lx-office-erp/INSTALL/_00c3_0084nderungen-an-Konfigurationsdateien.html
-32083a3cbd2c9df514eff88e22a68129 usr/share/doc/lx-office-erp/INSTALL/Datenbanken-anlegen.html
-bdba6bc2ac48c206819e3723c7380e4e usr/share/doc/lx-office-erp/dbschema.dia
-f87260dd9e87cfcc5a32f138471863cb usr/share/doc/lx-office-erp/INSTALL.txt
-151211334c30505e8afab114ea977787 usr/share/doc/lx-office-erp/changelog
-6915345205af7f5a3349b98276343785 usr/share/doc/lx-office-erp/UPGRADE
-8cf02252e4510bdf248090e9a96ca758 usr/share/doc/lx-office-erp/programmierstilrichtlinien.txt
-c4cdab6e52961d0a8069e94eae391252 usr/share/doc/lx-office-erp/INSTALL.texi
-335438e320bafc18912595906ba9114f usr/share/doc/lx-office-erp/dokumentenvorlagen-und-variablen.html
-60443d1d49538a26bf2600483f23baae usr/share/doc/lx-office-erp/copyright
-86645b7b54eb6ff6678f8f3f721be663 usr/share/doc/lx-office-erp/Makefile
-c1a48a7b173932f91da2c80677e1ca1e usr/share/doc/lx-office-erp/skr04-update-3804/konto3804.png
-21ba3bc301405b0bf092a6fa09c9a8af usr/share/doc/lx-office-erp/skr04-update-3804/steuerliste.png
-b8f9e24a950e276f9b576ea16034db5b usr/share/doc/lx-office-erp/skr04-update-3804/steuer3804.png
-01ea7506cc98121b3ec3d9f31eda6ea6 usr/share/doc/lx-office-erp/skr04-update-3804/steuer3803.png
-f0f393eeaaddd7ca1325f2fee99dbd59 usr/share/doc/lx-office-erp/skr04-update-3804/konto4315.png
-f31aa69ae9160dd1322a52d3ba21a3a2 usr/share/doc/lx-office-erp/skr04-update-3804/skr04_3804_hinzufuegen.html
-354f85388d1adbb4281bdcc91e612383 usr/share/doc/lx-office-erp/modules/README.PDF-Table
-ec2e09cade5471f24099a969c8f91338 usr/share/doc/lx-office-erp/modules/LICENSE.Email-Address
-9582b9f7b367601d6f014cf66c3844b2 usr/share/doc/lx-office-erp/modules/LICENSE.dhtmlsuite-for-applications
-7788e8aa8c34eafcfa16a5a59e85ae0b usr/share/doc/lx-office-erp/modules/README.CGI-Ajax
-2fe52603c8364ed46a0fdc3efdf156f3 usr/share/doc/lx-office-erp/modules/LICENSE.List-MoreUtils
-f921793d03cc6d63ec4b15e9be8fd3f8 usr/share/doc/lx-office-erp/modules/LICENSE.PDF-Table
-a89fc6431f978476bd49e3f7a26a1a1e usr/share/doc/lx-office-erp/modules/LICENSE.CGI-Ajax
-c7672feffcafb089c20821b2276ccaf3 usr/share/doc/lx-office-erp/modules/README.YAML
-7740ce8a260dc0ccfc600c5b01e87041 usr/share/doc/lx-office-erp/sql-upgrade-dateien.txt
-5298f68ceccefc2ee06362b2c77705aa usr/share/doc/lx-office-erp/ustva.html
-ecc3710fb5b46d90e27a4c29154cc891 usr/share/doc/lx-office-erp/COPYING
-35778203116c92bdba0d836ec28b5bf1 usr/share/man/man1/lx-office-erp.1.gz
-7e5f1bfb9590e0a79b45f4ca1c343cd9 usr/bin/lx-office-erp
-99b60155bb18b8ffc94eace2a8925d4e usr/lib/lx-office-erp/lxo-import/ups.html
-6f49919699281bb767afe41d30d0e933 usr/lib/lx-office-erp/lxo-import/s.sh
-6c93520fde1af450a937baf1a17c45f5 usr/lib/lx-office-erp/lxo-import/addressB.php
-7865a71e72124e8daddca56957b061de usr/lib/lx-office-erp/lxo-import/shiptoB.php
-721ea64e56badb729f4e0b44f4ceac2a usr/lib/lx-office-erp/lxo-import/blz.php
-de37563cd5249c885e912cc91fdd7e4a usr/lib/lx-office-erp/lxo-import/customer.bsp
-7e24fcb27e9cf921611cb0923855432e usr/lib/lx-office-erp/lxo-import/parts_import.php
-087322f5cfe085eba89d80d741883033 usr/lib/lx-office-erp/lxo-import/import_lib.php
-57615f6532956820f37dee04cc993742 usr/lib/lx-office-erp/lxo-import/customer_contact.bsp
-282508c409eec8f6911471e14c773fb5 usr/lib/lx-office-erp/lxo-import/contactB.php
-cf20cd97f144462bd2f167c84d0b0710 usr/lib/lx-office-erp/lxo-import/customer_shipto.bsp
-cb5b20a02da1879ebb5c29402f07abc3 usr/lib/lx-office-erp/lxo-import/partsB.php
-f29997adb6552954732927baea6c12e6 usr/lib/lx-office-erp/lxo-import/db.php
-1edf047951c0a4ec71bd34e05a2217fb usr/lib/lx-office-erp/favicon.ico
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/config/.htaccess
-a2321562ff365b4df7e7d7aa00fc4610 usr/lib/lx-office-erp/config/authentication.pl.default
-678a7b7a482a4d0830cf0f13794f34a1 usr/lib/lx-office-erp/menu.default
-dda1a2e851b8f2c45fa3544da1aeba07 usr/lib/lx-office-erp/SL/RecordLinks.pm
-4ed700947325724ce06aa2febdcb0103 usr/lib/lx-office-erp/SL/Form.pm
-34d9d4711710946ed099932419b5f1e8 usr/lib/lx-office-erp/SL/Common.pm
-bd7b1d862b55a1f5b06960f1309e50e6 usr/lib/lx-office-erp/SL/AP.pm
-c02965bb16a13dccb94897e3c68b4df5 usr/lib/lx-office-erp/SL/SEPA.pm
-319ace7a063c56a59fe110a4a684f016 usr/lib/lx-office-erp/SL/Taxkeys.pm
-a1619398295b2c15411c84ba8190aa78 usr/lib/lx-office-erp/SL/ReportGenerator.pm
-1d2c8a9176c74266c05cd1b46aa8d885 usr/lib/lx-office-erp/SL/BankAccount.pm
-ad6cc0940d99f3881174c77eb323e378 usr/lib/lx-office-erp/SL/USTVA.pm
-7b17f9594bfa03e1bb2b736c64b48a4b usr/lib/lx-office-erp/SL/DATEV.pm
-563fc1351e527628b18c0086ac129ba7 usr/lib/lx-office-erp/SL/Notes.pm
-305de826f33f837c28846ee6c2bced25 usr/lib/lx-office-erp/SL/MIME.pm
-eecf48cb0a06111ae1059d0918365e9e usr/lib/lx-office-erp/SL/Template/Plugin/T8.pm
-f55f244c93b1d34ea55085093f894559 usr/lib/lx-office-erp/SL/Template/Plugin/MultiColumnIterator.pm
-cbc00f64ca24b2188b62d9df4c889547 usr/lib/lx-office-erp/SL/Template/Plugin/LxERP.pm
-6b781ddfd8bf9c5e39c37840d8ecced9 usr/lib/lx-office-erp/SL/Template/Plugin/JavaScript.pm
-10558aceab8b9508422c25846992a635 usr/lib/lx-office-erp/SL/DBUpgrade2.pm
-38f44744ad4f42b5b4750eb74a726109 usr/lib/lx-office-erp/SL/Auth.pm
-21791522bafb3881bb78b5553a807dfa usr/lib/lx-office-erp/SL/FU.pm
-7be8a541365387fbe165bcc66c9f69db usr/lib/lx-office-erp/SL/LICENSES.pm
-891e156235889a46b665e01a3f6596b2 usr/lib/lx-office-erp/SL/IS.pm
-fec074768c0e4950321d264344151e84 usr/lib/lx-office-erp/SL/Locale.pm
-5ff8b820a8d826ac0270fed75c894f7f usr/lib/lx-office-erp/SL/Iconv.pm
-b5bb89795b3c8f29e4f3cf96b756ae7c usr/lib/lx-office-erp/SL/Menu.pm
-416d411e49b1083b2b4375bc056e69bd usr/lib/lx-office-erp/SL/RP.pm
-655a26324af254412190f504ad1ad3f0 usr/lib/lx-office-erp/SL/Projects.pm
-8b38d49e180681926da960013871ce5d usr/lib/lx-office-erp/SL/DN.pm
-6b88d0caec7a80904fabafefc4247e42 usr/lib/lx-office-erp/SL/GenericTranslations.pm
-0b93542722c53e7744115841f3dbdbf4 usr/lib/lx-office-erp/SL/CVar.pm
-e73664a015046486d06d38760d006f0d usr/lib/lx-office-erp/SL/DBUtils.pm
-52a4599207e300deea1d0e9ec9c0a542 usr/lib/lx-office-erp/SL/IO.pm
-969fbb39ed53eaf38a171f836b45faba usr/lib/lx-office-erp/SL/TODO.pm
-4c39a1df554d21edfc3a0aa7a02a14ab usr/lib/lx-office-erp/SL/CA.pm
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/SL/.htaccess
-e532448488ca49d1b862ea0e17347e8e usr/lib/lx-office-erp/SL/SEPA/XML.pm
-622f2bc712f091e37de5455d22f513bd usr/lib/lx-office-erp/SL/SEPA/XML/Transaction.pm
-2a1d1e36fcc8d17bc69a3eef658ba934 usr/lib/lx-office-erp/SL/PE.pm
-77cab5e9b36228d2b3c4e3621a97c2c5 usr/lib/lx-office-erp/SL/MoreCommon.pm
-9e9c6b3bb67ed64112654fc08e9dd04f usr/lib/lx-office-erp/SL/Template.pm
-7324581e07526386dde54fb368115439 usr/lib/lx-office-erp/SL/Chart.pm
-bb69f4e16fea8c6526a1dcf8d8df881e usr/lib/lx-office-erp/SL/OE.pm
-b339f5d336776a9d387b88c7889fa4b0 usr/lib/lx-office-erp/SL/DO.pm
-3301b1f0fd0d03d52919ac5acca9ff97 usr/lib/lx-office-erp/SL/AM.pm
-ecc192bb20577299b64ddc31f06f94b1 usr/lib/lx-office-erp/SL/IC.pm
-5339f53e3e1d24d1bb8eda34d72d9a3f usr/lib/lx-office-erp/SL/Watchdog.pm
-107577aad9bbe89d899eac78fef7b499 usr/lib/lx-office-erp/SL/ARAP.pm
-476ab2c945ea190a0509c399c68f927c usr/lib/lx-office-erp/SL/Inifile.pm
-cd00d7017fbfa133ec65fa5b3c1ae0b4 usr/lib/lx-office-erp/SL/RC.pm
-986bf68973d5a069a42ff5732fe6fcc3 usr/lib/lx-office-erp/SL/CT.pm
-df9e930440e507707a106871f6856bdf usr/lib/lx-office-erp/SL/CP.pm
-c085178853fa1ed3a26534c8e390ba3a usr/lib/lx-office-erp/SL/IR.pm
-1c282e25061483edcc00857baa6a60d6 usr/lib/lx-office-erp/SL/Drafts.pm
-5c17c5e6c663c612e85f736ec7fe1014 usr/lib/lx-office-erp/SL/Auth/LDAP.pm
-16a2c10ac4845a20181d14b5916334eb usr/lib/lx-office-erp/SL/Auth/DB.pm
-4bb7cdc01af4df4315412e4b68b58935 usr/lib/lx-office-erp/SL/LXDebug.pm
-0225f7ec9c5f581acbe98fee7d20011b usr/lib/lx-office-erp/SL/InstallationCheck.pm
-d854cf15b18ad436fd2bb6f7c58c5a5a usr/lib/lx-office-erp/SL/WH.pm
-cb87b70e54ef11a3f25d2d6ded919564 usr/lib/lx-office-erp/SL/User.pm
-5a3b33b7cb57423aa2d866c003b95b90 usr/lib/lx-office-erp/SL/AR.pm
-9833cc4b8bc4357d4a7e2ff5ffb3f63c usr/lib/lx-office-erp/SL/BP.pm
-b8b8d9884fac60ed9f701ca768070178 usr/lib/lx-office-erp/SL/Num2text.pm
-35707a8f1fb2bb9b4b952c1aa59295a2 usr/lib/lx-office-erp/SL/DATEV/KNEFile.pm
-b11652b07baafd4bcf04fa77a8a048ce usr/lib/lx-office-erp/SL/Mailer.pm
-9d22269a8fb7b4bf7f9334ca8a8af006 usr/lib/lx-office-erp/SL/GL.pm
-7697331d5c3fd4c147e2cf2c66f4049a usr/lib/lx-office-erp/SL/AccTransCorrections.pm
-2b0cf384e0cf0c3af779794d2498154b usr/lib/lx-office-erp/t/002goodperl.t
-6ad89d30f6b407604794112bcce4e49f usr/lib/lx-office-erp/t/003safesys.t
-d6835f03ffef405e412915cdd15f674a usr/lib/lx-office-erp/t/006spellcheck.t
-16766a0413a00f20b97d1f8b9d61f625 usr/lib/lx-office-erp/t/old/backend/README.backend
-0c38b717fb057687a2249a4060ebc66b usr/lib/lx-office-erp/t/old/frontend/README.frontend
-5a13aa7b7c9fa8a2556ac0b7c039e01f usr/lib/lx-office-erp/t/old/selenium/TestCreateTestbed.t
-2ee09880a57a2f2ba5e9626ec46fae77 usr/lib/lx-office-erp/t/old/selenium/incomming/ustva-Inland-linet.html
-62bc1c09ac8c1f42e764b4813191edc1 usr/lib/lx-office-erp/t/old/selenium/TestMasterData.t
-f0a1728d672cd43480212c5b1308fa3d usr/lib/lx-office-erp/t/old/selenium/TestAllTests.t
-5aecf83ea6541acdccbd078d38e7f5c8 usr/lib/lx-office-erp/t/old/selenium/README
-44ba2df847b32eab37cffefcd8a91d0e usr/lib/lx-office-erp/t/old/selenium/TestPayments.t
-30e08b5ab66dfeb5780a199f04010caa usr/lib/lx-office-erp/t/old/selenium/cleanup.pl
-fbf988ac4b0706a1ada7df14fce01949 usr/lib/lx-office-erp/t/old/selenium/TestAdmin.t
-ddf58ad3749e50566f87dac58630ed9e usr/lib/lx-office-erp/t/old/selenium/AllTests.t
-cac956c352a734e2627cc022a87d35a0 usr/lib/lx-office-erp/t/old/selenium/TestSystem.t
-1e020a49d541b68fa25dfbebb84c01d3 usr/lib/lx-office-erp/t/old/selenium/TestSelling.t
-087c2dc4ce314c8f435b3d2b117fe16e usr/lib/lx-office-erp/t/old/selenium/TestAccounting.t
-8a45e5686f32196933821037bab4562b usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S996DeletePaymentConditions.t
-e2b54ee14d1bdd951d61c95fccc8e64e usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S997DeleteLanguages.t
-490b68836bb860ca54cd41a33e8e1e1e usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S994DeleteAccount.t
-01b666334513bc7bf88d7fc428f9e371 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S998DeletePriceBrackets.t
-03439c55dfa23e2b65f64f1166266ad2 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S995DeleteCustomerVendorTypes.t
-aab6037b1fcbde6d96f93b392e2fa39a usr/lib/lx-office-erp/t/old/selenium/testscripts/system/end/S992DeleteProductGroups.t
-40f0384fea408036c394c64c12bb7bde usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S004ShowLanguages.t
-4a68050d7708ca471a077bfc7af581a4 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S008ShowCustomerVendorTypes.t
-5eae47b83bf7d7778c5a66b3f11f747c usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S013TestAccount.t
-7c9f3a9b15f74b99a760a836113d98de usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S006ShowPaymentConditions.t
-62b0cfa49a3eb32355f2a7db069ae652 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S005AddPaymentConditions.t
-71a36bbdb026c2915c4fb91a4773f006 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S001CreateProductGroups.t
-af33e9e89d6349385921d1176100a282 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S007AddCustomerVendorTypes.t
-e791d57aa4e447762c472b2edf9466ee usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S003AddLanguage.t
-5e0208e9305b780385d2de9fe6cd2ac0 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S010AddShowDeleteServiceMeasure.t
-a675994edddcebbfb476cc3228f45bff usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S009AddShowDeleteMeasure.t
-8556f1867282641a1fa2b4b7a9dbbf0b usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S012ShowAccount.t
-3601aa7ba36149f0415e11aa491af840 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S002CreatePriceBrackets.t
-564b477d29bce77b73165d692644ba16 usr/lib/lx-office-erp/t/old/selenium/testscripts/system/begin/S011CreateAccount.t
-9cd0ffc18a7de1a1b62e73a603efe6b4 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/end/M996DeleteProject.t
-0f5d90cbc3a43fb10095a0d1585a9039 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/end/M997DeleteService.t
-03c1892c5323201f36e410642ab4d4d6 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/end/M998DeleteProduct.t
-0d68bfe305c5959b7370493d4875378b usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/end/M995DeleteGoods.t
-acb36fbda54ee284e4df3e3d71412709 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M001CreateCustomer.t
-e60cf6e9a5c868d6c894e110a60ab305 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M002CreateVendor.t
-e8de20408e8c3417e57a55a11aba983e usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M005AddProduct.t
-952dc23dcc2dad94f8626afb9cd5eee9 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M004AddService.t
-6be7d276847b1bbb626fee8ead56e0d1 usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M003CreateGoods.t
-26303b453b0fb0240ad44c656e1b4fca usr/lib/lx-office-erp/t/old/selenium/testscripts/masterdata/begin/M006AddProject.t
-f875ae8140b98291a3614e579f8f75ce usr/lib/lx-office-erp/t/old/selenium/testscripts/administration/end/A998DeleteTestUser.t
-6557b19759ed1a243a0003f6c7c19e52 usr/lib/lx-office-erp/t/old/selenium/testscripts/administration/end/A999DeleteTestDatabase.t
-6711697622c4039c9d6566994b2db882 usr/lib/lx-office-erp/t/old/selenium/testscripts/administration/begin/A003UpdateDatabase.t
-b9e9134bb0c2ec71b6b0f2375c0dec14 usr/lib/lx-office-erp/t/old/selenium/testscripts/administration/begin/A001CreateTestDatabase.t
-36c2f398136f785c935021400da7c2b4 usr/lib/lx-office-erp/t/old/selenium/testscripts/administration/begin/A002CreateTestUser.t
-3d163625c83460a89a1db2002133c67b usr/lib/lx-office-erp/t/old/selenium/testscripts/selling/begin/S003CreateInvoice.t
-ebe490e2ee15e0c6f26f1a89ae693fd9 usr/lib/lx-office-erp/t/old/selenium/testscripts/selling/begin/S002CreateCharge.t
-d08fcedaa2796f0d4514873644b0d75f usr/lib/lx-office-erp/t/old/selenium/testscripts/selling/begin/S001CreateOffers.t
-b0b4bb34c671fdf6fc3112aabdadf06b usr/lib/lx-office-erp/t/old/selenium/testscripts/README
-31ffd38d028c3e0b4af97f4890bdc49b usr/lib/lx-office-erp/t/old/selenium/testscripts/purchase/begin/P001CreateQuoteRequest.t
-0a9d6d23944c5eb5c58c77a7f56cd43d usr/lib/lx-office-erp/t/old/selenium/testscripts/base/000Login.t
-8f583b26e8b62e160664e79b20b513f8 usr/lib/lx-office-erp/t/old/selenium/testscripts/base/999Logout.t
-c44e2d75c24dd648a8c267a57d88b743 usr/lib/lx-office-erp/t/old/selenium/TestReports.t
-0bcac0276665bc083b59e17697ad4081 usr/lib/lx-office-erp/t/old/selenium/TestPurchase.t
-a2a0ce86266954af457926b1f5f13047 usr/lib/lx-office-erp/t/old/selenium/TestPrinting.t
-f90b76aaa7258587615145b0c8cdbd70 usr/lib/lx-office-erp/t/old/selenium/TestProgramm.t
-11a54915b751da423c1e4b3bb613bcc6 usr/lib/lx-office-erp/t/old/README
-9062484cc1cd7182315c2b4472b33d43 usr/lib/lx-office-erp/t/old/README.de
-0c21096b8dbcb286d9ee30163027ba17 usr/lib/lx-office-erp/t/old/lxtest.conf.default
-d0db42ee3141ac4d0713dc0d7e7bb4cb usr/lib/lx-office-erp/t/old/lx-office.t
-5aecf83ea6541acdccbd078d38e7f5c8 usr/lib/lx-office-erp/t/old/demolx/README
-30e08b5ab66dfeb5780a199f04010caa usr/lib/lx-office-erp/t/old/demolx/cleanup.pl
-23437f9bc299f7d3d4ce4fbb51848bfa usr/lib/lx-office-erp/t/old/demolx/AllTests.t
-f5f1dfcee14d3d082ba76c5e3da80459 usr/lib/lx-office-erp/t/old/demolx/testscripts/K999DeleteTestDatabase.t
-b4b635f9370559264b6878673d34bc6b usr/lib/lx-office-erp/t/old/demolx/testscripts/K998DeleteTestUser.t
-b0b4bb34c671fdf6fc3112aabdadf06b usr/lib/lx-office-erp/t/old/demolx/testscripts/README
-cfe77c9b77f089c3e000bc3f2cb61de7 usr/lib/lx-office-erp/t/old/demolx/testscripts/001CreateTestDatabase.t
-d558fd5f9f8558bcc1a39018bc068251 usr/lib/lx-office-erp/t/old/demolx/testscripts/002CreateTestUser.t
-bee6d5633952a8abbdf077f568eb32d8 usr/lib/lx-office-erp/t/old/demolx/testscripts/005UpdateDatabase.t
-bf57a0c9414d32375bfaae512ab80a73 usr/lib/lx-office-erp/t/011pod.t
-b92d89ff9093ae5b7c33e9894736dafb usr/lib/lx-office-erp/t/001compile.t
-18f3a0ab996236dce41175ac8d146216 usr/lib/lx-office-erp/t/Support/Systemexec.pm
-c9af394a2d4f4ab88fc008566bc1281f usr/lib/lx-office-erp/t/Support/Files.pm
-7ab9f1033bdf178c2d9ad62e0c578375 usr/lib/lx-office-erp/t/Support/Templates.pm
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/t/.htaccess
-2f9f3852afc04132a8a7faefc30df08f usr/lib/lx-office-erp/t/004template.t
-95f3402b3396da4aac01544ede1a2cf0 usr/lib/lx-office-erp/t/README
-b80df2fdfe8a6d814f9a11b9db2843bd usr/lib/lx-office-erp/t/005no_tabs.t
-0b46917b1226a6be588425f5d4f4dbf8 usr/lib/lx-office-erp/t/test.sh
-6bc40c947908961f59c3374cb6ff71fd usr/lib/lx-office-erp/menu.ini
-fbb9a606492ab6b49727ac6540907c46 usr/lib/lx-office-erp/sql/Pg-upgrade2/follow_ups.sql
-1eb2aec59b5ab92977ebabd5941b9ec8 usr/lib/lx-office-erp/sql/Pg-upgrade2/warehouse.pl
-216465b513dbac6566bf1833f856d4b1 usr/lib/lx-office-erp/sql/Pg-upgrade2/COA_Account_Settings002.sql
-5c123aca23453578090e85453e81acc7 usr/lib/lx-office-erp/sql/Pg-upgrade2/units_translations_and_singular_plural_distinction.sql
-7a80169061862b03535b978b8db92c5d usr/lib/lx-office-erp/sql/Pg-upgrade2/dunning_dunning_id.sql
-0cb63bf2782ca85f41f12f743b3f05bb usr/lib/lx-office-erp/sql/Pg-upgrade2/status_history.sql
-43ba086fd54328755f6b2ce12a81a27a usr/lib/lx-office-erp/sql/Pg-upgrade2/release_2_4_3.sql
-714e7af77056fc13d1de7d075cae0bb2 usr/lib/lx-office-erp/sql/Pg-upgrade2/customer_vendor_taxzone_id.sql
-a9004de882e83eb8d6e0d767ca8be18a usr/lib/lx-office-erp/sql/Pg-upgrade2/tax_id_if_taxkey_is_0.sql
-bb97d0f2c7ab712a727889aee4dabf4c usr/lib/lx-office-erp/sql/Pg-upgrade2/fix_datepaid.sql
-d76df6653d3cd32834fc3afc0f7b8075 usr/lib/lx-office-erp/sql/Pg-upgrade2/acc_trans_without_oid.sql
-1c55e13b99daa60d4c7373a5fe31eddc usr/lib/lx-office-erp/sql/Pg-upgrade2/generic_translations.sql
-f1553d57c94eca2dd1f35a03c3961b5c usr/lib/lx-office-erp/sql/Pg-upgrade2/USTVA_at.pl
-c252936690d15515032cbafbe943e519 usr/lib/lx-office-erp/sql/Pg-upgrade2/fix_taxdescription.sql
-cccb81576e10a3ab6754b3bbf367e995 usr/lib/lx-office-erp/sql/Pg-upgrade2/release_2_6_1.sql
-788ead7294c34239c1b70b4a1d5d5514 usr/lib/lx-office-erp/sql/Pg-upgrade2/warehouse2.sql
-7ea19316ebe770d0b7fae6c424943e52 usr/lib/lx-office-erp/sql/Pg-upgrade2/USTVA_abstraction.pl
-f6709746edc7756f8dc22dfad1e259b0 usr/lib/lx-office-erp/sql/Pg-upgrade2/tax_description_without_percentage_skr04.sql
-e690e0246933c32c83337b319e3932b6 usr/lib/lx-office-erp/sql/Pg-upgrade2/tax_primary_key_taxkeys_foreign_keys.sql
-36dbc71491c77aca038bd1cb383d2077 usr/lib/lx-office-erp/sql/Pg-upgrade2/COA_Account_Settings001.sql
-c036107aa6104cd1743a202f128af59e usr/lib/lx-office-erp/sql/Pg-upgrade2/dunning_invoices_for_fees.sql
-265470377edd8004c22d5e96b2d7e912 usr/lib/lx-office-erp/sql/Pg-upgrade2/transaction_description.sql
-cb3840e05a1e31be5aa5869c977ccf18 usr/lib/lx-office-erp/sql/Pg-upgrade2/language_output_formatting.sql
-22db8b2f40af02556ffa3fbed8402ae9 usr/lib/lx-office-erp/sql/Pg-upgrade2/parts_has_sernumber.sql
-9084daff8a78cc011cf03f4c6da77fd0 usr/lib/lx-office-erp/sql/Pg-upgrade2/parts_ean.sql
-cb1c09136d6f76678256ed99691b2706 usr/lib/lx-office-erp/sql/Pg-upgrade2/marge_initial.sql
-ac4339fb2208429bac9d1e33e8c16adf usr/lib/lx-office-erp/sql/Pg-upgrade2/delivery_orders.sql
-909cee8798656ece2b9b9be1bf9df1c4 usr/lib/lx-office-erp/sql/Pg-upgrade2/buchungsgruppen_sortkey.sql
-59bcf6aaeaff0cbaf7f78ace368820e8 usr/lib/lx-office-erp/sql/Pg-upgrade2/units_no_type_distinction.sql
-bf6b7a76e5a1e02bb7dc1120aa6a8137 usr/lib/lx-office-erp/sql/Pg-upgrade2/SKR04-3804-addition.pl
-cff5927a8ae97aa9808c45b06c3c8512 usr/lib/lx-office-erp/sql/Pg-upgrade2/trigger_assembly_update_lastcost.sql
-8f06ce8c186d8ce74e6a513e6f02e481 usr/lib/lx-office-erp/sql/Pg-upgrade2/rename_buchungsgruppen_accounts_16_19_percent.sql
-1f51d767f12bd75ac7eabb02e06097e8 usr/lib/lx-office-erp/sql/Pg-upgrade2/transaction_description_not_null.sql
-44380e72877b9e7be6845af18733de76 usr/lib/lx-office-erp/sql/Pg-upgrade2/warehouse3.sql
-50458fe8a70cb2fe1c6a9cdad513b0f3 usr/lib/lx-office-erp/sql/Pg-upgrade2/oe_employee_id_foreignkey.sql
-383d86ebc4f9b7b1c9437607879d6d01 usr/lib/lx-office-erp/sql/Pg-upgrade2/oe_is_salesman.sql
-4b3413d634f0b3da8290878c1f062062 usr/lib/lx-office-erp/sql/Pg-upgrade2/release_2_4_1.sql
-483fac5859a6159a3b205e4a564c9fb8 usr/lib/lx-office-erp/sql/Pg-upgrade2/lastschrift.sql
-2d52463889b781241ce2383d7f4ddd90 usr/lib/lx-office-erp/sql/Pg-upgrade2/ustva_setup_2007.sql
-89b59132f030a9601884ed14b2768f94 usr/lib/lx-office-erp/sql/Pg-upgrade2/change_makemodel_vendor_id.sql
-e0ad554e3a3db2e0ed9b553ee04b1c2e usr/lib/lx-office-erp/sql/Pg-upgrade2/dunning_config_interest_rate.sql
-f12da88b4dfa22416d5b4c091959c654 usr/lib/lx-office-erp/sql/Pg-upgrade2/payment_terms_translation.sql
-aef3b175f4c5d7444ae59ebfc6c035af usr/lib/lx-office-erp/sql/Pg-upgrade2/release_2_6_0.sql
-9d27bb91a94d0e4de3729fa234fc53de usr/lib/lx-office-erp/sql/Pg-upgrade2/chart_names.sql
-80ca8c0158479710c1cc65a8ba701790 usr/lib/lx-office-erp/sql/Pg-upgrade2/ustva_setup_2007_update_chart_taxkeys_tax_add_missing_tax_accounts.sql
-cb1a77b9bc77fdfb4e80a620239fc504 usr/lib/lx-office-erp/sql/Pg-upgrade2/units_sortkey.sql
-b26a186477010c45810d572850c767b1 usr/lib/lx-office-erp/sql/Pg-upgrade2/price_factors.sql
-6d19dd70777062965fe7732d439e92b6 usr/lib/lx-office-erp/sql/Pg-upgrade2/dunning_invoices_per_dunning_level.sql
-d5f250d8ff01dc804b1fdf3137513112 usr/lib/lx-office-erp/sql/Pg-upgrade2/fix_acc_trans_ap_taxkey_bug.pl
-9bdefefc3d8a2b1acbb1a8c82f1bb896 usr/lib/lx-office-erp/sql/Pg-upgrade2/employee_no_limits.sql
-c4362a60b64aabf636c789013e27788a usr/lib/lx-office-erp/sql/Pg-upgrade2/history_erp.sql
-3cb68073ccc394db3da83699f9f56aeb usr/lib/lx-office-erp/sql/Pg-upgrade2/README
-1d44e5414d0709b7e904228977bd0797 usr/lib/lx-office-erp/sql/Pg-upgrade2/warehouse_add_bestbefore.sql
-6d72849b542c78329605daa8c335e75c usr/lib/lx-office-erp/sql/Pg-upgrade2/cp_greeting_migration.pl
-0cbda38071d6b77e27f9c05482a2f777 usr/lib/lx-office-erp/sql/Pg-upgrade2/project_flag_active.sql
-35cf59bdbaf452dce4ebc8fb2af092dc usr/lib/lx-office-erp/sql/Pg-upgrade2/bank_accounts.sql
-8eaa63822e1caf2e686500470be1bf30 usr/lib/lx-office-erp/sql/Pg-upgrade2/globalprojectnumber_ap_ar_oe.pl
-4717a272ad80afd35a78dc327d3b67ae usr/lib/lx-office-erp/sql/Pg-upgrade2/ar_storno.sql
-3ceb706c294cc63f04941cdb53e295d0 usr/lib/lx-office-erp/sql/Pg-upgrade2/sepa.sql
-74b0684e9e1be984988ddd1ac320b13f usr/lib/lx-office-erp/sql/Pg-upgrade2/ar_add_donumber.sql
-9722efa5aa263aacc3ad5c62b49f3699 usr/lib/lx-office-erp/sql/Pg-upgrade2/transfer_type_shipped.sql
-f22197595cef655b39ba8600a549a395 usr/lib/lx-office-erp/sql/Pg-upgrade2/auth_enable_sales_all_edit.pl
-62fb5342825541cecd684933fa099472 usr/lib/lx-office-erp/sql/Pg-upgrade2/record_links.sql
-5a7b80e3683a605e0b005bb386eda9f0 usr/lib/lx-office-erp/sql/Pg-upgrade2/payment_terms_sortkey.sql
-31f1a8e0b14fa4f1afee9475b20d9f18 usr/lib/lx-office-erp/sql/Pg-upgrade2/delivery_orders_fields_for_invoices.sql
-612ee13007da7b1f45b62adc660fd79e usr/lib/lx-office-erp/sql/Pg-upgrade2/ustva_setup_2007_update_chart_taxkeys_tax.sql
-43b5562d2abf0e761329d612d21a9e6c usr/lib/lx-office-erp/sql/Pg-upgrade2/drafts.sql
-ac3275ae3d42b29ebe7b4d989d2fd919 usr/lib/lx-office-erp/sql/Pg-upgrade2/release_2_4_2.sql
-f0523c0bdb07608bac6274598c9faaab usr/lib/lx-office-erp/sql/Pg-upgrade2/PgCommaAggregateFunction.sql
-6980821520049552fa8424e0bb881806 usr/lib/lx-office-erp/sql/Pg-upgrade2/rundungsfehler_korrigieren_BUG1328.pl
-f415011a41ab8f62d2b3a33eccfa9163 usr/lib/lx-office-erp/sql/Pg-upgrade2/tax_description_without_percentage.sql
-5c9fad6d5e54ea62923a9d8bf74831ce usr/lib/lx-office-erp/sql/Pg-upgrade2/ap_ar_orddate_quodate.sql
-816a3f7765193944643faf6cdd7f6129 usr/lib/lx-office-erp/sql/Pg-upgrade2/chart_category_to_sgn.sql
-2205a10b6808d029e2e77d341cdf4126 usr/lib/lx-office-erp/sql/Pg-upgrade2/drop_sic_code.sql
-5f5a971928d0b5002a79c2054f48e208 usr/lib/lx-office-erp/sql/Pg-upgrade2/cb_ob_transaction.sql
-b734463838d4e6322aacf21a7acf3d5a usr/lib/lx-office-erp/sql/Pg-upgrade2/chart_names2.sql
-082f8056163525cc683570e9ddd25d8c usr/lib/lx-office-erp/sql/Pg-upgrade2/history_erp_snumbers.sql
-688812297bccc35098294c0ea1ab4f25 usr/lib/lx-office-erp/sql/Pg-upgrade2/custom_variables_valid.sql
-7f47ae7506eb4a045a5c3b06d67dd259 usr/lib/lx-office-erp/sql/Pg-upgrade2/update_date_paid.sql
-a0188774cea78b5b43a140cedefa8aa2 usr/lib/lx-office-erp/sql/Pg-upgrade2/customer_vendor_ustid_length.sql
-9803da4e1a7f31a1d76bd3da11dc4489 usr/lib/lx-office-erp/sql/Pg-upgrade2/gl_storno.sql
-c64806750e9547c6f7b7237b0a158b5c usr/lib/lx-office-erp/sql/Pg-upgrade2/oe_delivered.sql
-7ca69a9ab7b75eaa4917e6f9789fbf8e usr/lib/lx-office-erp/sql/Pg-upgrade2/ap_storno.sql
-44882b716f5ca889d8013c04889c8d0d usr/lib/lx-office-erp/sql/Pg-upgrade2/ar_ap_storno_id.sql
-5f7ac7eb66873ffc5f5bcca5db13dbd8 usr/lib/lx-office-erp/sql/Pg-upgrade2/custom_variables.sql
-75418105802b8257ce68297931a5625f usr/lib/lx-office-erp/sql/Pg-upgrade2/add_more_constraints_fibu_projekt_xplace.pl
-b1bce16fe243d4146c9e6ef562223992 usr/lib/lx-office-erp/sql/Pg-upgrade2/invalid_taxkeys.sql
-fa3988eea3ccca24ac6ffd3a38c3118a usr/lib/lx-office-erp/sql/Pg-upgrade2/invalid_taxkeys_2.sql
-f72af9b7d2ede4a1b1446284694201da usr/lib/lx-office-erp/sql/Pg-upgrade2/tax_report_table_name.sql
-61ad5f58718b9ab8034f4ade235e8301 usr/lib/lx-office-erp/sql/Pg-upgrade2/todo_user_config.sql
-ef956f88bf358a6a77c6a93a465528ce usr/lib/lx-office-erp/sql/Pg-upgrade2/custom_variables_parts_services_assemblies.sql
-86e77612544ad078e86b8c5e9cde86ea usr/lib/lx-office-erp/sql/finanzamt.sql
-bb409a54d1fa004fe6ff225ed904a05a usr/lib/lx-office-erp/sql/auth_db.sql
-edafdcc78605fc9dcf994dd93417287d usr/lib/lx-office-erp/sql/lx-office.sql
-fac123a1e30fb04511bda78f3fa75e75 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.32-2.2.0.33.sql
-3117ddc83cbb18db61020273d1bb3be5 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0-2.2.0.1.sql
-82885d54ff3cc0bd4b14a625115e3396 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.20-2.2.0.21.pl
-9510d8fff87a50db7dd72df2e1b864fc usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.27-2.2.0.28.pl
-a3d35537d5f20441be2c2ec574da6ec6 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.17-2.2.0.18.sql
-89220d34792e942fa845c6872127da78 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.10-2.2.0.11.sql
-8cb69964838c4c50899f08dced13970e usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.4-2.2.0.5.sql
-796355758f3f0d2f1ef47700661a2253 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.8-2.2.0.9.sql
-b2a9e309574dce2267b955227ad8457b usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.38-2.4.0.0.sql
-06b08401cb53edbaa5d6c60db3aa6c77 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.15-2.2.0.16.sql
-2827867f99d1138941d4b390279ed0c0 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.1-2.2.0.2.sql
-53f58b574abd24c173e00a1f0a2ab9d4 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.18-2.2.0.19.sql
-70bec8477038a220ee822caacf38d3fa usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.30-2.2.0.31.sql
-90e8fd4b029071ae8c00580ffb5843e2 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.19-2.2.0.20.pl
-6c3f5c724dbb0008e368c0d2aa800dcd usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.37-2.2.0.38.pl
-5a7861f32577f8d551738ebf93b912f8 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.28-2.2.0.29.pl
-2959686bb659bf0793d08a7479312b76 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.11-2.2.0.12.sql
-c656005b8ce51ae346e0b68ed3ab5fd9 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.12-2.2.0.13.sql
-9a7d02f9624bb1343b1d22f57fbbff28 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.25-2.2.0.26.pl
-9d12e7ee120dd78076912396bade1327 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-1.0.0-2.1.0.sql
-8d2cee8987c296af7f10679a8d8ce82f usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.33-2.2.0.34.pl
-1f30af12cb246712f5238e0d014caf5e usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.16-2.2.0.17.sql
-2ceeac9167837ff375a6403eeec04afc usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.14-2.2.0.15.sql
-2caeceef43ee0caa3c934feb7e5c5859 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.1.0-2.1.1.sql
-f03d74cc03b65505ac1f081921913618 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.22-2.2.0.23.sql
-680c2dd5df5bd2334ec31698aa23ea9c usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.26-2.2.0.27.sql
-368aabf70679f7f1d86bacef00557f2f usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.5-2.2.0.6.sql
-dada80e199a42a4c1ae50bb2f089108c usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.1.1-2.2.0.sql
-d8e5a92cc962f490de06e97e1870060e usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.29-2.2.0.30.sql
-27399bb7df65adc392b09b6a2016a844 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.13-2.2.0.14.sql
-916c75d09fc036669f4c4529246ff13b usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.31-2.2.0.32.pl
-394911162b463390e072490ee7f8e1b9 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.21-2.2.0.22.sql
-2832b6c2858398e97ee4462a241e01fc usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.7-2.2.0.8.sql
-95db12d415f34c1d5ae82b521b34c8d7 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.34-2.2.0.35.sql
-911fe018930c89d02c1acca02de99298 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.24-2.2.0.25.sql
-7a80f70751fc89d0aeff680d09d6f4ca usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.6-2.2.0.7.sql
-3d8d249015f3377922904ebfa9dd249f usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.3-2.2.0.4.sql
-622ba2cf5638e6c40337b8a4208b0098 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.35-2.2.0.36.sql
-2b929a60fb2a9e853dcf03553c67a81a usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.36-2.2.0.37.pl
-8e84a0850aecbe0e8df9c884be3e676d usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.9-2.2.0.10.sql
-2052a1ebd578cd0d503d8f24f09e1c89 usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.2-2.2.0.3.sql
-58305f1dd07d34c01403740964e9f79b usr/lib/lx-office-erp/sql/Pg-upgrade/Pg-upgrade-2.2.0.23-2.2.0.24.sql
-1d73ed324d26c9dca2f720981ecc0bbd usr/lib/lx-office-erp/sql/Germany-DATEV-SKR04EU-chart.sql
-13241126b54e9fecca4fe30d024469c6 usr/lib/lx-office-erp/sql/Swiss-German-chart.sql
-d434fab087b8022a2e24e92b00b8ce87 usr/lib/lx-office-erp/sql/liste.sql
-f0776a1ab30f0d44244ca8d80641e03e usr/lib/lx-office-erp/sql/update100-200.sql
-a7a31c6cedca0911a9f5e33373c313e3 usr/lib/lx-office-erp/sql/Austria-chart.sql
-f53db10b813edfaea8234a89a93bfb31 usr/lib/lx-office-erp/sql/Germany-DATEV-SKR03EU-chart.sql
-1ffc26c2d9a10390c2aee8bfb1eec436 usr/lib/lx-office-erp/sql/datevautomatik.sql
-7f0e2ed539414b7d3c5a56b9b7454860 usr/lib/lx-office-erp/sql/Leerer-Kontenrahmen-chart.sql
-629823e65a0e7ea3dc9e122e33be4e7f usr/lib/lx-office-erp/sql/updateLedger-200.sql
-151da31e613e814dde06ebfe7aa2e6b1 usr/lib/lx-office-erp/sql/update10x-200.sql
-b94bd91f4aa2984ca8a0588f06b8698b usr/lib/lx-office-erp/sql/France-chart.sql
-82d21f3924835197cbf49a365396afb6 usr/lib/lx-office-erp/sql/update.sh
-f21f2f51f6c4ed3057f570ab653bb9f2 usr/lib/lx-office-erp/am.pl
-52e638f4ae5991b16a0137a1e96b8c65 usr/lib/lx-office-erp/modules/fallback/List/MoreUtils.pm
-17f5de86df8bedc9c29ead1eecdd3e44 usr/lib/lx-office-erp/modules/fallback/Email/Address.pm
-fb6f995b9dc0a9bb5738674294e527a7 usr/lib/lx-office-erp/modules/override/YAML/Types.pm
-2fa453eebffc6dea03eb25a24993d8e5 usr/lib/lx-office-erp/modules/override/YAML/Marshall.pm
-37734fc431377cc62672a0a01987c05a usr/lib/lx-office-erp/modules/override/YAML/Node.pm
-55bb89032fa8f8067f6527ea80a363f1 usr/lib/lx-office-erp/modules/override/YAML/Tag.pm
-60be61a35b29627fb6aae8618946a7c6 usr/lib/lx-office-erp/modules/override/YAML/Loader/Base.pm
-38394965a1b0b387d1c17b24f88b26f5 usr/lib/lx-office-erp/modules/override/YAML/Error.pm
-b792e702c128d2157447fe6ec6b99ed9 usr/lib/lx-office-erp/modules/override/YAML/Base.pm
-f5b56af24bdaafd197381375e08583b2 usr/lib/lx-office-erp/modules/override/YAML/Loader.pm
-427adb3f3e2c9ea81bf8e077bc9e8c7c usr/lib/lx-office-erp/modules/override/YAML/Dumper/Base.pm
-337ccd5790d048839630487b089c7ca6 usr/lib/lx-office-erp/modules/override/YAML/Dumper.pm
-e998c17920e77e5694e4b268fe4681ca usr/lib/lx-office-erp/modules/override/YAML.pm
-3e611a5198f93a74745286b07e006aa5 usr/lib/lx-office-erp/modules/override/PDF/Table.pm
-62b671192bd365631aa5bbe62ea73a9d usr/lib/lx-office-erp/modules/override/CGI/Ajax.pm
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/modules/override/CGI/.htaccess
-da8909102779d502ce31ad51e7d7905e usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.28-2.2.0.29
-4531ad0b8f5c1154fdf033fca00b374c usr/lib/lx-office-erp/locale/de/sepa
-f3d026463ea4c7366d95823eb2dfab41 usr/lib/lx-office-erp/locale/de/auth_enable_sales_all_edit
-d3d781f82aec4a70d512819690b3534d usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.36-2.2.0.37
-27d7a4674f05151d6098da16d02a9544 usr/lib/lx-office-erp/locale/de/.gitignore
-55cb1602fa206bdd8330581d8efebabe usr/lib/lx-office-erp/locale/de/warehouse
-f33884f1d3152c2a630290430014d1ae usr/lib/lx-office-erp/locale/de/menuXML
-09703b6c3fb491e167d749dd20e9fec8 usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.27-2.2.0.28
-bb31e675567f25b7606ad453bac5d9f4 usr/lib/lx-office-erp/locale/de/arap
-fe1a27dadea9f8f054b4c0cd6e02f37a usr/lib/lx-office-erp/locale/de/menuv3
-13dba2c67d5c238c0ad98ad85c1cead6 usr/lib/lx-office-erp/locale/de/amcvar
-9d02eb937b03d54b24d021606c0aa954 usr/lib/lx-office-erp/locale/de/rp
-949e1764c106b6a1a80e627f057b349b usr/lib/lx-office-erp/locale/de/ustva
-bf9aca33e8e9771be2c7c1f66b9bcf97 usr/lib/lx-office-erp/locale/de/reportgenerator
-21ab950b3307985eb11b3370e5800725 usr/lib/lx-office-erp/locale/de/ic
-737b21123fd35192e1babd6072dfac59 usr/lib/lx-office-erp/locale/de/projects
-c8407a29b655279fe3c30c564bb0afd1 usr/lib/lx-office-erp/locale/de/SKR04-3804-addition
-3e0ceac49eabfce6c4e6f3923a039b6d usr/lib/lx-office-erp/locale/de/fu
-f996d610e18cbf6210ec0c93ccc566a9 usr/lib/lx-office-erp/locale/de/cp
-2b4c8e070e33b2ecd190e15b9641c9b1 usr/lib/lx-office-erp/locale/de/login
-63c48eb5bd46ce77556b77c42c2aedec usr/lib/lx-office-erp/locale/de/bankaccounts
-de1634171163f01f8975a3271bcc7cdb usr/lib/lx-office-erp/locale/de/gl
-ee8f1224fb149971eaadeff3f47e9319 usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.37-2.2.0.38
-f3d026463ea4c7366d95823eb2dfab41 usr/lib/lx-office-erp/locale/de/rundungsfehler_korrigieren_BUG1328
-84f9ae48edc627a909aae9ac7a0c2fcb usr/lib/lx-office-erp/locale/de/menunew
-edebb0435e3d56dfd2311af1c2627cef usr/lib/lx-office-erp/locale/de/wh
-0b6c6da8ec082fdc6deafb188acb116f usr/lib/lx-office-erp/locale/de/fa
-ad4a67099471d4b7a3fa875a070c697f usr/lib/lx-office-erp/locale/de/all
-cfa45d39e95c1fe7e55e0dbba2798a68 usr/lib/lx-office-erp/locale/de/ca
-21c64e66970fc688a1a07c9b71f14b82 usr/lib/lx-office-erp/locale/de/ap
-d3428e459de78c7e04e08dc97da40f5f usr/lib/lx-office-erp/locale/de/dn
-3c3b9de3249583e5c52f099ad7a725df usr/lib/lx-office-erp/locale/de/am
-e7515171115192d2a05371fcebd5b940 usr/lib/lx-office-erp/locale/de/cp_greeting_migration
-acabe626f4737fc5a65304f5696a4271 usr/lib/lx-office-erp/locale/de/locales.pl
-f1b826c5761429c1d33222e26495c7df usr/lib/lx-office-erp/locale/de/io
-6ad1aecab64803bb631459696a556b61 usr/lib/lx-office-erp/locale/de/datev
-20adb6fb232f7389cf82e2bf664cb7d5 usr/lib/lx-office-erp/locale/de/pe
-5472beaa493c96f0424ef940a3d578e0 usr/lib/lx-office-erp/locale/de/acctranscorrections
-262061cc4f445adf7a6d14bc513294b9 usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.31-2.2.0.32
-651cb5c2bfd9932e3f4e93656e5bd1c4 usr/lib/lx-office-erp/locale/de/fix_acc_trans_ap_taxkey_bug
-10023e515c98e7f0ef48c71f4b95a1d2 usr/lib/lx-office-erp/locale/de/bp
-534e9609a48c3b025650dd0aefce7c89 usr/lib/lx-office-erp/locale/de/todo
-563c0921a41609857be4d549f72fb96f usr/lib/lx-office-erp/locale/de/Num2text
-601fec39a8de5a8375d4bf35925f6670 usr/lib/lx-office-erp/locale/de/admin
-1cc3a7f1d802096e87164c6110ff49c2 usr/lib/lx-office-erp/locale/de/is
-f3d026463ea4c7366d95823eb2dfab41 usr/lib/lx-office-erp/locale/de/add_more_constraints_fibu_projekt_xplace
-133dc1c1f8d7b3bb125f2503598dd293 usr/lib/lx-office-erp/locale/de/menu
-8434a6422f99215d460a1497ff63ff72 usr/lib/lx-office-erp/locale/de/kopf
-52d285a12812daf54ec2c23b924adf29 usr/lib/lx-office-erp/locale/de/LANGUAGE
-6139e104c032d0b519672a9c6b8ba65c usr/lib/lx-office-erp/locale/de/USTVA_at
-3045fe3137965db9db44e92bce68359c usr/lib/lx-office-erp/locale/de/licenses
-ebb00c4c5465363223653aed8b2345f6 usr/lib/lx-office-erp/locale/de/special_chars
-7f48f32c77fbf6a9d6c37c20c2fc6349 usr/lib/lx-office-erp/locale/de/rc
-222ddf150d44b83d9dd9dcbbdc31d6ef usr/lib/lx-office-erp/locale/de/common
-f3d026463ea4c7366d95823eb2dfab41 usr/lib/lx-office-erp/locale/de/globalprojectnumber_ap_ar_oe
-1454b740d88eba5b0fd9f0603b90abfa usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.20-2.2.0.21
-137de2c170ef9493688c768e1cd7afb1 usr/lib/lx-office-erp/locale/de/charset
-fe1a27dadea9f8f054b4c0cd6e02f37a usr/lib/lx-office-erp/locale/de/menuv4
-929d38a77e391ba50a133080ea1815b8 usr/lib/lx-office-erp/locale/de/ct
-83a1c3da3dfd891de486d5b3226074e1 usr/lib/lx-office-erp/locale/de/COPYING
-52a90359ddd8f174323d0df210e0621c usr/lib/lx-office-erp/locale/de/generictranslations
-012e5ec3d55cc240474e6a945d5d426a usr/lib/lx-office-erp/locale/de/drafts
-c47d8e41c58414b3554c9dc0c482af8d usr/lib/lx-office-erp/locale/de/USTVA_abstraction
-de4773c1d7e1284f9791b1cbe8ce7664 usr/lib/lx-office-erp/locale/de/do
-f2dcb1ab5031efc023cd1248bb5e42c2 usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.25-2.2.0.26
-5fa0b92467865ebb119d34a7bfdf9c78 usr/lib/lx-office-erp/locale/de/amtemplates
-8f3a5b7f7de0598fba4531153643a49f usr/lib/lx-office-erp/locale/de/installationcheck
-e7b31f2e7efc141d4d69830be4d1e43f usr/lib/lx-office-erp/locale/de/ar
-bcb215a81539691f620d22c4d584b260 usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.33-2.2.0.34
-f290f6eb430d6bf36517582e9b62139e usr/lib/lx-office-erp/locale/de/ir
-e10d54c5c8e830bf91d288bf1cda2861 usr/lib/lx-office-erp/locale/de/oe
-07aacd68aeee9f301e55d0ee80da0e3b usr/lib/lx-office-erp/locale/de/menujs
-cf8463598558f90f0203c8315dd4d3ea usr/lib/lx-office-erp/locale/de/Pg-upgrade-2.2.0.19-2.2.0.20
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/locale/.htaccess
-5ed22be2ce7b7e228b52b63d327cc08d usr/lib/lx-office-erp/locale/fr/arap
-e396c7beb43a016431af750f6ced8625 usr/lib/lx-office-erp/locale/fr/rp
-14913790bfaa831ba3f83fab320be922 usr/lib/lx-office-erp/locale/fr/ic
-a127c9b9e28ce79faf68dfe9af5572ed usr/lib/lx-office-erp/locale/fr/cp
-091b5ee29c33de1b83e5c93db2f78484 usr/lib/lx-office-erp/locale/fr/login
-6bf533fb34e310a1b1cb13b543e6f8dc usr/lib/lx-office-erp/locale/fr/gl
-ee05c706aa9e853b0e547861f73bb823 usr/lib/lx-office-erp/locale/fr/all
-80a713acc99d9bacc12b744c310e8edb usr/lib/lx-office-erp/locale/fr/ca
-1dfa71426d0583fbe54c5b7d6cc6325b usr/lib/lx-office-erp/locale/fr/ap
-62fa801b4480804ccd9d08f9ba7db872 usr/lib/lx-office-erp/locale/fr/am
-d1c11fb8226b70c31aa2af5e626f193d usr/lib/lx-office-erp/locale/fr/io
-edfb93aad2dcfaa69eea41933784df13 usr/lib/lx-office-erp/locale/fr/pe
-6e3d42a38eb54681e1ebb3be5b74f98f usr/lib/lx-office-erp/locale/fr/admin
-8e9ab7fb5106b8c49bffbb799101df64 usr/lib/lx-office-erp/locale/fr/is
-9fcfdb760d0508d50e36d5aa407e1816 usr/lib/lx-office-erp/locale/fr/LANGUAGE.deactivated
-1654d91b045b3d6a52005256d04c64fb usr/lib/lx-office-erp/locale/fr/menu
-c55b9b4604434cc7baf5654843f07f7a usr/lib/lx-office-erp/locale/fr/rc
-4eff35ab80fc766d557a14319e0e554f usr/lib/lx-office-erp/locale/fr/ct
-b08b9e24448f594a93500188b19398e0 usr/lib/lx-office-erp/locale/fr/COPYING
-fb5e669cc572a7bba3ddc8478509ef86 usr/lib/lx-office-erp/locale/fr/ar
-8ca3aab9c333e50f3c459a93b15481b6 usr/lib/lx-office-erp/locale/fr/ir
-c00ac019b744602485795c54bc5ea8ee usr/lib/lx-office-erp/locale/fr/oe
-d6cc73257d2fe7319ce31428dff52616 usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.28-2.2.0.29
-2143623981d93701c92cd984ca5f5fb9 usr/lib/lx-office-erp/locale/en/sepa
-0d07ea9dcb82e9249f559281ea27503c usr/lib/lx-office-erp/locale/en/auth_enable_sales_all_edit
-d3d781f82aec4a70d512819690b3534d usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.36-2.2.0.37
-784955c49ed2f81869584e7e4aa4cc42 usr/lib/lx-office-erp/locale/en/warehouse
-86cfeedb94d83647bb139a628cdde6c0 usr/lib/lx-office-erp/locale/en/menuXML
-869bde4fb0acb3db9c9af85b02b1fc55 usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.27-2.2.0.28
-7938b9e538c50ed40f74f96b71527f2d usr/lib/lx-office-erp/locale/en/arap
-900e718e83f179fbb6eb1008ea0097eb usr/lib/lx-office-erp/locale/en/menuv3
-8bcf332ae5242f26f66cc18c044816b6 usr/lib/lx-office-erp/locale/en/amcvar
-5526f89978aba1f8242595ea3e49c9ca usr/lib/lx-office-erp/locale/en/rp
-7cb64793707343e01cf69e04ae35ed90 usr/lib/lx-office-erp/locale/en/ustva
-6e48766971cd8ee2a8ee5c704291959f usr/lib/lx-office-erp/locale/en/reportgenerator
-9f11b1e23b88c6c16a72800e108e0c9c usr/lib/lx-office-erp/locale/en/ic
-20a86b9352a2a802d4f78c66d1867f53 usr/lib/lx-office-erp/locale/en/lost
-9612aa61ad9f39a739814325ba6896cb usr/lib/lx-office-erp/locale/en/projects
-d83dcfabeb5375a30380f9989e9313e9 usr/lib/lx-office-erp/locale/en/SKR04-3804-addition
-d301f1806f84f7ffebeba1c9038c8786 usr/lib/lx-office-erp/locale/en/fu
-f0adb2a09a93491a6dffe31943ff880b usr/lib/lx-office-erp/locale/en/cp
-27a660cc763989c158fe1bf2e6656329 usr/lib/lx-office-erp/locale/en/missing
-45f10b99872de12169a80f6349cd4f81 usr/lib/lx-office-erp/locale/en/login
-9f673333e01ef870343daa930477583b usr/lib/lx-office-erp/locale/en/bankaccounts
-42168b845645a3050ec65576d19f6104 usr/lib/lx-office-erp/locale/en/gl
-2f60cfca19dea821f88c71a26bb15415 usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.37-2.2.0.38
-0d07ea9dcb82e9249f559281ea27503c usr/lib/lx-office-erp/locale/en/rundungsfehler_korrigieren_BUG1328
-4fffad9bcff9c50edc15b55ca840683c usr/lib/lx-office-erp/locale/en/menunew
-5399236bb59708644bcb63676b050e61 usr/lib/lx-office-erp/locale/en/wh
-6aae66fee2d8328aa7e0f4f595e231f5 usr/lib/lx-office-erp/locale/en/all
-330318f5ff8b2b8ae067a59633269827 usr/lib/lx-office-erp/locale/en/ca
-c794d419a9279045a464bb201e1cbc27 usr/lib/lx-office-erp/locale/en/ap
-077f57ae6bd3111d151e9a741ff49a21 usr/lib/lx-office-erp/locale/en/dn
-3538b5f542c471f8bf835c586b1bd383 usr/lib/lx-office-erp/locale/en/am
-4fe078edd4485ebad5b3e739b2284128 usr/lib/lx-office-erp/locale/en/cp_greeting_migration
-128bcc04234128f770bb68c1586ddc65 usr/lib/lx-office-erp/locale/en/locales.pl
-a4f45757ad8a85cb1acf5b85440a25ec usr/lib/lx-office-erp/locale/en/io
-205518c13319932c5f8545fbc61ad92c usr/lib/lx-office-erp/locale/en/datev
-68a41a0036ab5fb1a2abe4e478fe13be usr/lib/lx-office-erp/locale/en/pe
-8b1cd07b8d6036e059950205af93f74e usr/lib/lx-office-erp/locale/en/acctranscorrections
-f9070ceda51f756a8f593e1c1162826c usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.31-2.2.0.32
-1608ead4314a564e56ea606239e09d77 usr/lib/lx-office-erp/locale/en/fix_acc_trans_ap_taxkey_bug
-67e89f5c25d7d41159c8b5e691324f79 usr/lib/lx-office-erp/locale/en/bp
-9c7bd92ddb2df26f4e0851735ff7e779 usr/lib/lx-office-erp/locale/en/todo
-e03c94de85a41226b9f65420971f04b4 usr/lib/lx-office-erp/locale/en/admin
-799a33b90c1f4ae153125388b1540c3e usr/lib/lx-office-erp/locale/en/is
-0d07ea9dcb82e9249f559281ea27503c usr/lib/lx-office-erp/locale/en/add_more_constraints_fibu_projekt_xplace
-77c593e87f5319913a35d3057fe16589 usr/lib/lx-office-erp/locale/en/menu
-9f30d98609feed43224389cccd5472b2 usr/lib/lx-office-erp/locale/en/kopf
-cd5e1e13f12927d85bcf7afd3c24e2b3 usr/lib/lx-office-erp/locale/en/LANGUAGE
-665b440201dfb0574db6f6768bbcc6d8 usr/lib/lx-office-erp/locale/en/USTVA_at
-b99b6fc37e78e2f480549d9e974a4921 usr/lib/lx-office-erp/locale/en/licenses
-f89f7e4200790abd7a12b6fca11d2f90 usr/lib/lx-office-erp/locale/en/rc
-fa38845550c84de89df66807c2c02445 usr/lib/lx-office-erp/locale/en/common
-0d07ea9dcb82e9249f559281ea27503c usr/lib/lx-office-erp/locale/en/globalprojectnumber_ap_ar_oe
-a13348b017da94ab626d0e285f1c8f2f usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.20-2.2.0.21
-900e718e83f179fbb6eb1008ea0097eb usr/lib/lx-office-erp/locale/en/menuv4
-0c1f6a121aeb46ee5331bc1d9680fa53 usr/lib/lx-office-erp/locale/en/ct
-a03ed4247fcfe3af63b537e916cc99d0 usr/lib/lx-office-erp/locale/en/COPYING
-a41deffce595d0b7b8fe7735a9fd6964 usr/lib/lx-office-erp/locale/en/generictranslations
-5bf50554b33efa8f7505dfea2079fb47 usr/lib/lx-office-erp/locale/en/drafts
-db3efbc4c0e1c5426b189d204b7e6897 usr/lib/lx-office-erp/locale/en/USTVA_abstraction
-e76337d5f44d4570ab97067d88925b23 usr/lib/lx-office-erp/locale/en/do
-a6d8a5fe87ec6872ca95f1f6d79fb6cd usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.25-2.2.0.26
-f51b513d0ec7be1cc44db01d4d4813c1 usr/lib/lx-office-erp/locale/en/amtemplates
-9701f52f00671dbf8845e03b7803cb13 usr/lib/lx-office-erp/locale/en/installationcheck
-e077f52f5cf11362fcd1203631b4a434 usr/lib/lx-office-erp/locale/en/ar
-55f04b7dbb082f5380296d9937c396ee usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.33-2.2.0.34
-83f4edec7ae77015ab91e66337f32bf6 usr/lib/lx-office-erp/locale/en/ir
-73bc00de8791717645f4293500bac314 usr/lib/lx-office-erp/locale/en/oe
-1709c803d99e5e5c63d0a663febcf994 usr/lib/lx-office-erp/locale/en/menujs
-6565cef1a1a7f83ddcff772bc2a1171e usr/lib/lx-office-erp/locale/en/Pg-upgrade-2.2.0.19-2.2.0.20
-6dcc9dbc3a79dfc90e9f4d36d8023b5c usr/lib/lx-office-erp/VERSION
-6a654f083fad0fc6bd787dc28270d681 usr/lib/lx-office-erp/kopf.pl
-8c285fd14b60701cde4f2f67ebde2305 usr/lib/lx-office-erp/bin/mozilla/oe.pl
-0400951aaf6ceea32d60a2863c8253e5 usr/lib/lx-office-erp/bin/mozilla/ca.pl
-13b43989a62e8c1bd617cc4ae7870768 usr/lib/lx-office-erp/bin/mozilla/cp.pl
-ce76adc70aed679167fc9f00c8cae1c0 usr/lib/lx-office-erp/bin/mozilla/amcvar.pl
-a0f7a07e7c7a5a5e207e5d248aee6bd7 usr/lib/lx-office-erp/bin/mozilla/fu.pl
-fbeb9c0e476918f8665e547af4e8263a usr/lib/lx-office-erp/bin/mozilla/ir.pl
-b57732ca39ffe21311648d7f202b6a91 usr/lib/lx-office-erp/bin/mozilla/ustva.pl
-ebac03e97f30b5915bce76cedf37be42 usr/lib/lx-office-erp/bin/mozilla/admin.pl
-8714ac319d929276b2a8bba22d66f0e6 usr/lib/lx-office-erp/bin/mozilla/bp.pl
-3f8e21e2f0b3f41aadae55a8ee4b5ed8 usr/lib/lx-office-erp/bin/mozilla/invoice_io.pl
-91e6d4e823a08da85d6574ed84e35a34 usr/lib/lx-office-erp/bin/mozilla/drafts.pl
-b9231beb8a1ab5b61baf83e3da17c9e1 usr/lib/lx-office-erp/bin/mozilla/generictranslations.pl
-ef8fe202ac6a40a813d4e97cfa9103fd usr/lib/lx-office-erp/bin/mozilla/is.pl
-26bad270f0ae2053b809fe90dc44be9a usr/lib/lx-office-erp/bin/mozilla/ap.pl
-3c1136ccda2747dee42e8048eeaf2f62 usr/lib/lx-office-erp/bin/mozilla/wh.pl
-027da41bc35f809350e7f50c07db07e5 usr/lib/lx-office-erp/bin/mozilla/reportgenerator.pl
-e225197c9beebaa2ec79f8657b6d699f usr/lib/lx-office-erp/bin/mozilla/pe.pl
-cba14ae67e3dcd77b48f77ba4857ba12 usr/lib/lx-office-erp/bin/mozilla/amtemplates.pl
-c89a57bd13122cd0d8d3b3ee7406ca3d usr/lib/lx-office-erp/bin/mozilla/menuv4.pl
-a0f2c17c3a324f104a93c7cd23eeca48 usr/lib/lx-office-erp/bin/mozilla/rp.pl
-68e94549a7b4176a9bcb34e0c3047119 usr/lib/lx-office-erp/bin/mozilla/do.pl
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/bin/mozilla/.htaccess
-4955dcbd391b74634bcc062f18f49004 usr/lib/lx-office-erp/bin/mozilla/sepa.pl
-a846b32cea8efdfc5999d68ceeef957c usr/lib/lx-office-erp/bin/mozilla/common.pl
-01da4c32b9b8ccd1b4b2a328d30a1a88 usr/lib/lx-office-erp/bin/mozilla/io.pl
-da421d2426eb6352e22d37506151e2a9 usr/lib/lx-office-erp/bin/mozilla/dn.pl
-cdf89ded4bf77177ad808d2f95b3c594 usr/lib/lx-office-erp/bin/mozilla/admin_groups.pl
-b5a80a05467a501fee52d6de63ca48c7 usr/lib/lx-office-erp/bin/mozilla/am.pl
-d2d92ad13fd101654249da33398fce46 usr/lib/lx-office-erp/bin/mozilla/projects.pl
-684574800cf00bdf078e367c0de57b9b usr/lib/lx-office-erp/bin/mozilla/rc.pl
-399d6ea917f1c24154f448f09cd6f312 usr/lib/lx-office-erp/bin/mozilla/installationcheck.pl
-6d13120d2f2ebde59626bd3964031fa0 usr/lib/lx-office-erp/bin/mozilla/ic.pl
-214ed5e2da4c6c9e024fa2bd7b6b9293 usr/lib/lx-office-erp/bin/mozilla/ct.pl
-ac8eb7027807569a23bb78e11e3937d5 usr/lib/lx-office-erp/bin/mozilla/bankaccounts.pl
-3783df00e20d495fd84c6ef1f5a5dbe0 usr/lib/lx-office-erp/bin/mozilla/arap.pl
-279c36716939d20c61391e99eef82e6e usr/lib/lx-office-erp/bin/mozilla/menu.pl
-e4a1d3fc633b4e2b2c4f9ad51faf8b4f usr/lib/lx-office-erp/bin/mozilla/kopf.pl
-32a443468944dedcfbddffa983e189b8 usr/lib/lx-office-erp/bin/mozilla/acctranscorrections.pl
-df3389acc4c8200f6dfbc194b072ba38 usr/lib/lx-office-erp/bin/mozilla/menuv3.pl
-a3a3847b48f78b5a453af1b4958ed39b usr/lib/lx-office-erp/bin/mozilla/ar.pl
-8ee4c6c593388b21b90f1de96681a542 usr/lib/lx-office-erp/bin/mozilla/datev.pl
-b209af5f452be8bce83003cf830ee8cc usr/lib/lx-office-erp/bin/mozilla/menuXML.pl
-601323c7e3655da615f34c9acc9f0085 usr/lib/lx-office-erp/bin/mozilla/licenses.pl
-75cfd99bc5613d9a6069804a89df1990 usr/lib/lx-office-erp/bin/mozilla/gl.pl
-b465565ebd55950acf90ec65463ce58b usr/lib/lx-office-erp/bin/mozilla/login.pl
-433d7603a6fa773642f9853010264a91 usr/lib/lx-office-erp/bin/mozilla/menujs.pl
-88e11120a67721bc921234797afbad1e usr/lib/lx-office-erp/bin/mozilla/menunew.pl
-4448ef44b2238671118ad50b706deb6a usr/lib/lx-office-erp/bin/mozilla/todo.pl
-4e2f31eee6c88adb22925d70d86e6cb2 usr/lib/lx-office-erp/index.html
-9ea20a5c81b995093ec805a6d5a4de0b usr/lib/lx-office-erp/js/show_form_details.js
-c3eccfb4ccb79d13796738e66d8e9ab3 usr/lib/lx-office-erp/js/wz_tooltip.js
-94d061b03cd42c30b46c01dbeb8de942 usr/lib/lx-office-erp/js/dhtmlsuite/menu-for-applications.js
-109ba9ac44430c7e5dfa2831e657ee6b usr/lib/lx-office-erp/js/jquery-autocomplete/jquery.autocomplete.pack.js
-563c31ddb56257f87896d782e9d96973 usr/lib/lx-office-erp/js/parts_language_selection.js
-d8f9c4444580d285972803eed7392b8f usr/lib/lx-office-erp/js/tabcontent.js
-3363e3d0d58b778c1420be2e076c877f usr/lib/lx-office-erp/js/FormManager.js
-e079e82e9b2d01f73293691954e382c9 usr/lib/lx-office-erp/js/customer_or_vendor_selection.js
-fdf7fc6347e63cfbc6c336e2e7502e01 usr/lib/lx-office-erp/js/stock_in_out.js
-9e5348e873b2c7e9389f13c4453f2af4 usr/lib/lx-office-erp/js/delivery_customer_selection.js
-1a89273e16b40f1a5616461b0980debd usr/lib/lx-office-erp/js/common.js
-80faf8e5a24a1b4fec6b817741c29641 usr/lib/lx-office-erp/js/vendor_selection.js
-a9331828c517ac5d97f93b3cfdbcc9bc usr/lib/lx-office-erp/js/jquery/jquery-1.2.6.js
-bb381e2d19d8eace86b34d20759491a5 usr/lib/lx-office-erp/js/jquery/jquery-1.3.2.min.js
-b618d8c0a18b4f808cfaa08bba675679 usr/lib/lx-office-erp/js/calculate_qty.js
-c57d1bb845d07dfb1d3f19597ef2dd38 usr/lib/lx-office-erp/js/dunning.js
-196ecbfbc1ac18a24ad20b3a26f99bcc usr/lib/lx-office-erp/js/show_history.js
-ef319c566a78c2a34c8f3a4f7e02759f usr/lib/lx-office-erp/js/part_selection.js
-5e2f25f39bc838e8eec7d3d0c408d176 usr/lib/lx-office-erp/js/checkbox_utils.js
-4e7480f4e1d77b731b1c4be6d9c3402f usr/lib/lx-office-erp/js/jquery.checkall.js
-9454964285fbd9778da56690ccb6d502 usr/lib/lx-office-erp/js/follow_up.js
-614f7b5e1ba1968df5b5aa4db076b3f5 usr/lib/lx-office-erp/js/jscalendar/calendar.js
-622a9973a0db0f5e71dea8923c662901 usr/lib/lx-office-erp/js/jscalendar/calendar-setup.js
-1f8c673c8f76832febaeeac88a5f4353 usr/lib/lx-office-erp/js/jscalendar/menuarrow2.gif
-5319cdf259284bae393a655dbfe66ee7 usr/lib/lx-office-erp/js/jscalendar/calendar-win2k-1.css
-a9868c0d85ce1cec22cadf007c3f0661 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-ko-utf8.js
-7ff36b7944c535271983566ac10a041b usr/lib/lx-office-erp/js/jscalendar/lang/calendar-en.js
-8d3bc284f3c2bfad26b38c6224fbc1ca usr/lib/lx-office-erp/js/jscalendar/lang/calendar-hr-utf8.js
-10409c671140a39b91e9f96dcedbe1b1 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-hu.js
-00e83a2121db4d21c059d3335f67eb42 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-ca.js
-a947e189174be4d737ac034abe9db957 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-it.js
-4ac0b8870fa93c6f49c183f71cd4baf9 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-no.js
-4df2bd769a1ebf7bb9ff4e634a80fd1c usr/lib/lx-office-erp/js/jscalendar/lang/calendar-pl-utf8.js
-52dfa5a6118b2f7322fa46a3b098fab6 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-tr.js
-b47ddea3200306ace5d9493ef98eca8e usr/lib/lx-office-erp/js/jscalendar/lang/calendar-jp.js
-76d3d0e80ee3f36e96875442567682cd usr/lib/lx-office-erp/js/jscalendar/lang/calendar-sv.js
-b12c73d13c4048d9b3e11d591b979605 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-fr.js
-308381c1b3ebf1ae656b6cd2f6365a4d usr/lib/lx-office-erp/js/jscalendar/lang/calendar-si.js
-06b3f5ddc2465af49ac476efdfead122 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-lt.js
-961a0dc397f4e845c1e26ed37ebe9840 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-de.js
-b2e4098f50eb62ad3fd4d44c1202c0b7 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-ro.js
-b38f5c1915147fbcd4d7e47c9205b478 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-ru.js
-c4430aa0d5b85133938924c3d07f11c8 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-zh.js
-48e3cfc1e0406e09b4d85bfb7d21723b usr/lib/lx-office-erp/js/jscalendar/lang/calendar-hr.js
-8d0194ed53abae22c8e98d633aee4626 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-fi.js
-3556760402191331e9ebdc868992cf78 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-cs-win.js
-07b72300010fe3e1c3dbe1610f37277e usr/lib/lx-office-erp/js/jscalendar/lang/calendar-pl.js
-782c204921fac0922f297d2418b05756 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-sk.js
-22bce81d786dfdbcc91654b23cb89afe usr/lib/lx-office-erp/js/jscalendar/lang/calendar-ko.js
-c11f7ff9e2ef2d49c28f11ba0c9271b1 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-lt-utf8.js
-177f8bcab8ce4300dfffc1edbfa25e2c usr/lib/lx-office-erp/js/jscalendar/lang/calendar-pt.js
-8eb26742d8354ca3833e9be4d72e3bec usr/lib/lx-office-erp/js/jscalendar/lang/calendar-el.js
-fd800d23037eb366805e1ee287535531 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-nl.js
-b8fd8524ae91fe7a4d27742fb30eb9bc usr/lib/lx-office-erp/js/jscalendar/lang/calendar-sp.js
-d32928037f8219f0c2ce2f4df86ab53c usr/lib/lx-office-erp/js/jscalendar/lang/calendar-es.js
-14ba236068dd2666d30e1a34055e9e7e usr/lib/lx-office-erp/js/jscalendar/lang/calendar-da.js
-82ab1eabcc24cba821b950d12aaba8b3 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-du.js
-bd1eac390421c6c7dc72a87bc5134c52 usr/lib/lx-office-erp/js/jscalendar/lang/calendar-br.js
-65fc5963bf1f044c7f0d89be381cb87a usr/lib/lx-office-erp/js/jscalendar/lang/calendar-af.js
-b5a91d7a2755198b2eb729541ad3288c usr/lib/lx-office-erp/js/jscalendar/menuarrow.gif
-f6a2f4c7e410b86674259a7022ee8483 usr/lib/lx-office-erp/js/show_vc_details.js
-54de5d0ad628a22673d4e0d3476fd650 usr/lib/lx-office-erp/js/highlight_input.js
-68c7e4a0e6bd7b29a20f3ce5c674c692 usr/lib/lx-office-erp/login.pl
-a3d21aa7caa8fb1cf944fba323bbcf64 usr/lib/lx-office-erp/scripts/templ2t8.pl
-2b0bd2e592c5d9cf3c332d948ad88d43 usr/lib/lx-office-erp/scripts/pl2tmpl.pl
-db18c467bcde1fea7b0bf9f78ad6e5ac usr/lib/lx-office-erp/scripts/dbupgrade2_tool.pl
-2ac0172bc19c08880103c446065d913e usr/lib/lx-office-erp/scripts/mklinks.sh
-545aa68e2fd14b31987d02bb8fcb4235 usr/lib/lx-office-erp/scripts/inst_postgres_deb.sh
-b1211b80df6dd6752efdd70affe5d30d usr/lib/lx-office-erp/scripts/set_permissions.sh
-cc059ba3cba92d5f209438505fee37d4 usr/lib/lx-office-erp/scripts/installation_check.pl
-427f2c3500eb54ad8502b6d8940d0268 usr/lib/lx-office-erp/scripts/.htaccess
-afc2c5effef63185c0c35a0c90e1bd64 usr/lib/lx-office-erp/scripts/oo-uno-convert-pdf.py
-6dd3eb4f340d664022ccb3b93705b6cc usr/lib/lx-office-erp/scripts/spawn_oo.pl
-4ad92c05eb9721c067853d4ad653f126 usr/lib/lx-office-erp/scripts/create_tags_file.pl
-a33db483d8a52de658566383bda92406 usr/lib/lx-office-erp/scripts/oo-uno-test-conn.py
-f688fe48f72f34b590e8665e28a2995a usr/lib/lx-office-erp/scripts/inst_postgres.sh
-1fe072b39dfe698032087d2f2172aac9 usr/lib/lx-office-erp/scripts/find-use.pl
-da1131d235c9f139df88b0f824d3e20e usr/lib/menu/lx-office-erp
-ecd03d4720e07b05fb3c82ebf0e29fa2 var/lib/lx-office-erp/css/dhtmlsuite/menu-item.css
-c78a6c04683f6e2ad7d81df48e6107b9 var/lib/lx-office-erp/css/dhtmlsuite/menu-bar.css
-cc566a11541b6d93f73f02a12446e6a5 var/lib/lx-office-erp/css/menuv3.css
-003024af51dcbc2b00970c403c6b06cd var/lib/lx-office-erp/css/csshover.htc
-bd25e4a78b6d39d10f90cf7599c20733 var/lib/lx-office-erp/css/list_accounts.css
-be1d30ab84e6915904a0f49abff6f32b var/lib/lx-office-erp/css/mn_hauptmenu.png
-81e49e4ccde31c82bc859236a316fc31 var/lib/lx-office-erp/css/px_3.gif
-a945d250a2e1bad598588b4076e9d6c4 var/lib/lx-office-erp/css/tabcontent.css
-de2edb02e94df553bf3a305f8d32152a var/lib/lx-office-erp/css/Win2000.css
-b0f4e91f8437f42c8be66ec1fb2a645a var/lib/lx-office-erp/css/lx-office-erp.css
-0792ed83910ccb35ed026188876a6bf9 var/lib/lx-office-erp/css/menuv4.css
-719c9f56c4acd5081ae30fe127a965e4 var/lib/lx-office-erp/css/jquery.autocomplete.css
-f03ba6228fac2b78b04cbed21ddfe5be var/lib/lx-office-erp/css/Mobile.css
-ecd0d264b6d2d7295ba0e1471784f632 var/lib/lx-office-erp/users/ustva-2006-2.pdf
-d0f05f396bb021252070525c3c59268f var/lib/lx-office-erp/users/ustva-2005-1.pdf
-82283d929d5154eb98896ab92fa1bfa4 var/lib/lx-office-erp/users/html2ps-config
-8cf35a47e705ece7352b71289232a1f4 var/lib/lx-office-erp/users/ustva-2007-2.pdf
-05296b1e4d5b7c5c7ce176d91fd249c4 var/lib/lx-office-erp/users/ustva-2004-1.pdf
-6c25c0605f91a617991d46cc092565ee var/lib/lx-office-erp/users/ustva-2007-1.pdf
-e142fa2df8b67fad4fd2462b95eaa0c4 var/lib/lx-office-erp/users/ustva-2008.pdf
-959b825e2583ba05824e625f19751526 var/lib/lx-office-erp/users/.openoffice.org2/user/autotext/mytexts.bau
-39f361607fccecbccd5a15bdab6fc7e9 var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Office/Views.xcu
-a943baff842d3d84a647429e0b106e05 var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Office/Recovery.xcu
-eb04237d3368f632967a99ba69c9a23f var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Office/UI/WriterWindowState.xcu
-9aca60ae0b2599742c3a9eb0bc8a38cf var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Office/Common.xcu
-e9bc95097d320e12859afab36de1ffc9 var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Office/Linguistic.xcu
-01a4b238577119cee66380a35df2307f var/lib/lx-office-erp/users/.openoffice.org2/user/registry/data/org/openoffice/Setup.xcu
-0a8bb56fc873c195bf7117af925c7f08 var/lib/lx-office-erp/users/.openoffice.org2/user/registry/.gitignore
-d9bfe6730dee4de6d494843c8d588de0 var/lib/lx-office-erp/users/.openoffice.org2/user/basic/Standard/Module1.xba
-fb2a081383049c437f147a58a0be5529 var/lib/lx-office-erp/users/.openoffice.org2/user/basic/Standard/script.xlb
-d80c8e4ee4e87d35190a89853a3ad8a3 var/lib/lx-office-erp/users/.openoffice.org2/user/basic/Standard/dialog.xlb
-0715ee51dbc405548d4b35a4d373660e var/lib/lx-office-erp/users/.openoffice.org2/user/basic/script.xlc
-e5558becf651c0149cee3874892f7f1b var/lib/lx-office-erp/users/.openoffice.org2/user/basic/dialog.xlc
-579bdcf2ee81c4ff5dac39ab87e59b79 var/lib/lx-office-erp/users/.openoffice.org2/user/config/cmyk.soc
-67c5be9af13f1de43265017e55c533f5 var/lib/lx-office-erp/users/.openoffice.org2/user/config/.gitignore
-7fbfd948f6e00bdec1eeecf989cecdf6 var/lib/lx-office-erp/users/.openoffice.org2/user/config/classic_en-US.sog
-5d9ab85612b3f9fc843ae65411380575 var/lib/lx-office-erp/users/.openoffice.org2/user/config/styles_de.sod
-7cbb3ae8fab7fe26a2e5f9e24a3f8b1a var/lib/lx-office-erp/users/.openoffice.org2/user/config/soffice.cfg/global/accelerator/en-US/current.xml
-8fc29bb098f0bd9560d26f3007ad75cd var/lib/lx-office-erp/users/.openoffice.org2/user/config/soffice.cfg/modules/swriter/accelerator/en-US/current.xml
-5446a745f3bdd079a3185b3522935f57 var/lib/lx-office-erp/users/.openoffice.org2/user/config/gallery.soc
-9a15deff3a10395b2b28b967488ea280 var/lib/lx-office-erp/users/.openoffice.org2/user/config/web.soc
-5cfb06db5c833f84d9c2ef4f1a70a5d1 var/lib/lx-office-erp/users/.openoffice.org2/user/config/styles_en-US.sod
-1b6de3b40a2f5fe455b591358fd0bdce var/lib/lx-office-erp/users/.openoffice.org2/user/config/hatching_de.soh
-68bbf6f61f6c4ffedf391a9b9a78784b var/lib/lx-office-erp/users/.openoffice.org2/user/config/hatching_en-US.soh
-17dbd5511dda546920761691e4e97088 var/lib/lx-office-erp/users/.openoffice.org2/user/config/arrowhd_de.soe
-e69a59b816451e4feb5c756cc6064ddc var/lib/lx-office-erp/users/.openoffice.org2/user/config/autotbl.fmt
-83778a92fc717ae68e5d5269f05a4a40 var/lib/lx-office-erp/users/.openoffice.org2/user/config/javasettings_Linux_x86.xml
-3fa6042d9f65008a9ffbdd208ca6bf4d var/lib/lx-office-erp/users/.openoffice.org2/user/config/arrowhd_en-US.soe
-25c7b628c2800dcf5be464d35c56ccf5 var/lib/lx-office-erp/users/.openoffice.org2/user/config/palette_de.soc
-25c7b628c2800dcf5be464d35c56ccf5 var/lib/lx-office-erp/users/.openoffice.org2/user/config/palette_en-US.soc
-1b7c8b9bc0555e1a1b7e2706021b6c87 var/lib/lx-office-erp/users/.openoffice.org2/user/config/classic_de.sog
-d98d41cb6c30fbdcabb66f33d3ce6a0a var/lib/lx-office-erp/users/.openoffice.org2/user/config/modern_de.sog
-e080018f69bba7a0316a89011b592a13 var/lib/lx-office-erp/users/.openoffice.org2/user/config/sun-color.soc
-8e6544ab04f7a25ceb04dd2926caafe5 var/lib/lx-office-erp/users/.openoffice.org2/user/config/html.soc
-ff480c800270faceb67ca0d450e95e4c var/lib/lx-office-erp/users/.openoffice.org2/user/config/modern_en-US.sog
-17152b3c0e7ed9365b47b416e51d1c26 var/lib/lx-office-erp/users/.openoffice.org2/user/psprint/.gitignore
-8b8d464bbb760ac4987cdd5b711ff2ad var/lib/lx-office-erp/users/.openoffice.org2/user/gallery/sg30.thm
-58b26eb6ab03be973425381f1de81aeb var/lib/lx-office-erp/users/.openoffice.org2/user/gallery/sg100.sdv
-e0288e17058cc63505da7b616ffa89ab var/lib/lx-office-erp/users/.openoffice.org2/user/gallery/sg100.thm
-58b26eb6ab03be973425381f1de81aeb var/lib/lx-office-erp/users/.openoffice.org2/user/gallery/sg30.sdv
-693a6b781302eafcee0e80de3754e322 var/lib/lx-office-erp/users/ustva-2005-2.pdf
-f01e6c93fef4e7a684fb93116c9d5b98 var/lib/lx-office-erp/users/ustva-2006-1.pdf
-617c0ee6f5108ddcc79366ab299a1abb var/lib/lx-office-erp/users/ustva-2004-2.pdf
-803134d259ffb93c5678635c0369489f var/lib/lx-office-erp/templates/French-invoice.tex
-36c24055cbf3b50b2a16b5498ac9f6d1 var/lib/lx-office-erp/templates/Service-invoice.html
-2416956035c3bbb9c9d9a98a35e7830d var/lib/lx-office-erp/templates/German-purchase_order.tex
-9fb9ad5038aadb2e68492042fc93a1b1 var/lib/lx-office-erp/templates/German-request_quotation.html
-6f81ff6f4639eefe6816e7288374a28b var/lib/lx-office-erp/templates/German-receipt.tex
-cd6c925a129e52a543f280adacacac30 var/lib/lx-office-erp/templates/Service-invoice.tex
-906dbc9cf780686f2c473efac41d761e var/lib/lx-office-erp/templates/German-bin_list.html
-be606e8148a8813ef1ed8765b5426bfb var/lib/lx-office-erp/templates/Service-purchase_order.html
-95dc23a518a86c48d8a29fe3eb3a072c var/lib/lx-office-erp/templates/Service-packing_list.tex
-2b8962a89146dd265602ee59b47f3481 var/lib/lx-office-erp/templates/Default-sales_order.tex
-5f91001607e48252244a87fe3003e0f6 var/lib/lx-office-erp/templates/German-ustva.tex
-8ef5aeba77699a3b5aee9003840ef183 var/lib/lx-office-erp/templates/French-income_statement.html
-8e0cceb4f8a232755a7cd597c230f948 var/lib/lx-office-erp/templates/Default-pick_list.tex
-a02c9766f3399107f448d27f5cd26328 var/lib/lx-office-erp/templates/Default-request_quotation.html
-b58ec93d42358e9da6c4d96a2ae3b2eb var/lib/lx-office-erp/templates/Default-bin_list.html
-65023246ae43cb6a875841e4df766de1 var/lib/lx-office-erp/templates/German-sales_quotation.tex
-0543dec8fe7097f2500087d4c526e22f var/lib/lx-office-erp/templates/German-ustva-2005.tex
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/Default-receipt.tex
-9fe843c4044325fac0a26487613cf34f var/lib/lx-office-erp/templates/German-ustva.html
-680dc56398eba4c8371de8b316a3fb7e var/lib/lx-office-erp/templates/Default-sales_order.html
-8c8f5f238070be5ccf143548206755b0 var/lib/lx-office-erp/templates/German-balance_sheet.html
-719c94a82e43504e7641e0da4c8335f4 var/lib/lx-office-erp/templates/French-purchase_order.tex
-d27ba810a3400b2633ac8cfb437823cc var/lib/lx-office-erp/templates/German-bwa.html
-c567304bdcc3ed9c605bf58e04989800 var/lib/lx-office-erp/templates/Default-request_quotation.tex
-93dc30d65ff774108927d787b88fc6a4 var/lib/lx-office-erp/templates/Service-packing_list.html
-d5969ffaf08e4a6d318f0c77cc2e207a var/lib/lx-office-erp/templates/Default-purchase_order.html
-fe072665d329e6f162c35aba5f427050 var/lib/lx-office-erp/templates/Default-purchase_order.tex
-fbc958a053232aee2f3b6c73254354d9 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_create_en.html
-f3a7205e97c136f9e3060726fd546f58 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_add_en.html
-dd786affbaa8023c049e9495f517f11a var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_mark_as_closed_step1_de.html
-724c880c446ac8ec1bee55c3b544c8f6 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_created_master.html
-3e5ce9b3230352870c5d9ff36b6ea265 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_search_en.html
-9cc064b33d895250011f857dd8cc662b var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_bottom_master.html
-63dbd89a5ddaca7168540bf00955393c var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_top_en.html
-8ce2c7afde67e07622cd9af76ce65791 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_created_de.html
-63dbd89a5ddaca7168540bf00955393c var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_top_de.html
-66359e03f660efae17b95baba6b27604 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_bottom_en.html
-04d0b2b0727abbfef8c51fce97a4bb02 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_add_master.html
-d27d429f5049a11b1e7b60a9569e6a83 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_edit_de.html
-8078ef67c1bb99862681ee18a2352c91 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_mark_as_closed_step1_master.html
-63dbd89a5ddaca7168540bf00955393c var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_top_master.html
-cc0fc47dd092a21f68f925830949954d var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_created_en.html
-e0ce9ede02214dd5f08d9d942a8e8248 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_mark_as_closed_step1_en.html
-f5a3b5216fab315ff6fef90ac5bd95fb var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_create_de.html
-bab9633146f19f46d8e89aead72a9633 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_edit_en.html
-a17fb51217cf9076853a6f59928f977f var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_add_de.html
-4e5eb6c9504a7dc86558c90275fd8f3a var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_edit_master.html
-cbdaceae40405abd08e7be991a0108ce var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_search_master.html
-ac2505a70b453ac2c3e1caefa282a255 var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_search_de.html
-9d5f4713dc7b2f01b5d1cd6ce0bf2c1b var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_list_bottom_de.html
-c9b9a64224cc2c1cb7c243b66fbd7aca var/lib/lx-office-erp/templates/webpages/sepa/bank_transfer_create_master.html
-7f3e661bc2ea64a8ffdb7ebe96e32422 var/lib/lx-office-erp/templates/webpages/webdav/_list_en.html
-7f3e661bc2ea64a8ffdb7ebe96e32422 var/lib/lx-office-erp/templates/webpages/webdav/_list_de.html
-7f3e661bc2ea64a8ffdb7ebe96e32422 var/lib/lx-office-erp/templates/webpages/webdav/_list_master.html
-e3309ba3fd847651c247c63684bd5744 var/lib/lx-office-erp/templates/webpages/dunning/edit_config_master.html
-73dde9461f8c065dd1e508b60f36aa46 var/lib/lx-office-erp/templates/webpages/dunning/add_master.html
-4f3f3493091386988875289c859f26c1 var/lib/lx-office-erp/templates/webpages/dunning/add_en.html
-def2c1f69e9d16b2e406faf895d02442 var/lib/lx-office-erp/templates/webpages/dunning/edit_config_de.html
-44c973a50793d2023aad14cb4687491e var/lib/lx-office-erp/templates/webpages/dunning/edit_config_en.html
-7a4142b397091851e8aea0d88b98f3c3 var/lib/lx-office-erp/templates/webpages/dunning/set_email_master.html
-a88fab05fade7a22897f3339b561e7e7 var/lib/lx-office-erp/templates/webpages/dunning/set_email_en.html
-9bf1c38022f81b14779effed1be6524b var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_bottom_en.html
-87757e479caab80cfe8aaf737dcc8c91 var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_top_master.html
-ece59b8f7cdb58976c17d16225c35c17 var/lib/lx-office-erp/templates/webpages/dunning/set_email_de.html
-863b4eba8760750b887925042f5d5bb9 var/lib/lx-office-erp/templates/webpages/dunning/show_invoices_en.html
-d5009cf057286bc912cdf8416828b8bb var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_bottom_master.html
-5d763899244976a20e19979186e3e173 var/lib/lx-office-erp/templates/webpages/dunning/add_de.html
-3baad6438ee8409b8df27178901a4395 var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_bottom_de.html
-87757e479caab80cfe8aaf737dcc8c91 var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_top_en.html
-87757e479caab80cfe8aaf737dcc8c91 var/lib/lx-office-erp/templates/webpages/dunning/show_dunning_top_de.html
-f88e19ba8c7e1547163c11cae7aede6c var/lib/lx-office-erp/templates/webpages/dunning/search_en.html
-e283097c5cfd3fb2911cd3ee23f566d1 var/lib/lx-office-erp/templates/webpages/dunning/show_invoices_master.html
-40ddbb06460701082f919ac35bb0551c var/lib/lx-office-erp/templates/webpages/dunning/search_de.html
-5112478bb3b9db82b71922940dea5628 var/lib/lx-office-erp/templates/webpages/dunning/show_invoices_de.html
-b935449c161a1630ad77e6fb3ef4d834 var/lib/lx-office-erp/templates/webpages/dunning/search_master.html
-b506e64afbb08e0738212eaf1348c0f6 var/lib/lx-office-erp/templates/webpages/amcvar/search_filter_master.html
-8b14dbd2fc59e24ddd41dd44e15b1431 var/lib/lx-office-erp/templates/webpages/amcvar/render_checkboxes_master.html
-71cb2931ef543747d58d52b5007cb900 var/lib/lx-office-erp/templates/webpages/amcvar/display_cvar_config_form_de.html
-688516753eeb1d9a267e6836d71fbdd6 var/lib/lx-office-erp/templates/webpages/amcvar/search_include_master.html
-8b14dbd2fc59e24ddd41dd44e15b1431 var/lib/lx-office-erp/templates/webpages/amcvar/render_checkboxes_en.html
-d2c3131fc6e63c1087a7f5127958a213 var/lib/lx-office-erp/templates/webpages/amcvar/render_inputs_de.html
-8b14dbd2fc59e24ddd41dd44e15b1431 var/lib/lx-office-erp/templates/webpages/amcvar/render_checkboxes_de.html
-1475e663c353c9f488e9ad75d9ec2882 var/lib/lx-office-erp/templates/webpages/amcvar/search_filter_en.html
-688516753eeb1d9a267e6836d71fbdd6 var/lib/lx-office-erp/templates/webpages/amcvar/search_include_en.html
-688516753eeb1d9a267e6836d71fbdd6 var/lib/lx-office-erp/templates/webpages/amcvar/search_include_de.html
-7a1639b6ed6fa59199c79c860c595473 var/lib/lx-office-erp/templates/webpages/amcvar/list_cvar_configs_en.html
-2bdecbfb2f5f48ba1a71606663f9b1a2 var/lib/lx-office-erp/templates/webpages/amcvar/render_inputs_en.html
-7cbf07b4ac6ebe9082ed4d3de398c61d var/lib/lx-office-erp/templates/webpages/amcvar/render_inputs_master.html
-0ae4153c9d55ef04f324fdb0357971bf var/lib/lx-office-erp/templates/webpages/amcvar/list_cvar_configs_master.html
-01740d5fa5c561e4dedf2660eaa1d862 var/lib/lx-office-erp/templates/webpages/amcvar/display_cvar_config_form_en.html
-86187e1024dde27e99632f8331362631 var/lib/lx-office-erp/templates/webpages/amcvar/list_cvar_configs_de.html
-d18d6af162b2685dbc98f196507ff7ae var/lib/lx-office-erp/templates/webpages/amcvar/search_filter_de.html
-b64dec7b5de53023502ccd522d864196 var/lib/lx-office-erp/templates/webpages/amcvar/display_cvar_config_form_master.html
-c5641986e684de0049f57e55a7044748 var/lib/lx-office-erp/templates/webpages/rp/html_report_susa_de.html
-38ed4c66cb6cc6f4bd59079c50d2decf var/lib/lx-office-erp/templates/webpages/rp/balance_sheet_en.html
-160601a28330cf7e597283829d1db674 var/lib/lx-office-erp/templates/webpages/rp/balance_sheet_de.html
-e0bcec1d76377a5dc5c7af3a05c45628 var/lib/lx-office-erp/templates/webpages/rp/aging_ar_bottom_de.html
-5d1a20ed5bc0a6a8a23d911236cafa03 var/lib/lx-office-erp/templates/webpages/rp/html_report_susa_master.html
-bdf5fe431535103be593268c7c864965 var/lib/lx-office-erp/templates/webpages/rp/aging_ar_top_en.html
-c50e0a7955db090f657905029483e50d var/lib/lx-office-erp/templates/webpages/rp/aging_ar_bottom_master.html
-31d407b9d20159c3acffda1ea9681610 var/lib/lx-office-erp/templates/webpages/rp/html_report_susa_en.html
-bdf5fe431535103be593268c7c864965 var/lib/lx-office-erp/templates/webpages/rp/aging_ar_top_de.html
-6409c1dbd53c1a0b81fe6b7f8934faf8 var/lib/lx-office-erp/templates/webpages/rp/balance_sheet_master.html
-e3e5dffaec7478e0aa1d21ea5aedc9e0 var/lib/lx-office-erp/templates/webpages/rp/aging_ar_bottom_en.html
-bdf5fe431535103be593268c7c864965 var/lib/lx-office-erp/templates/webpages/rp/aging_ar_top_master.html
-f385e2f79ecfbded68a276fcf31d2968 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_de.html
-1e12adc743a445942c303d92ae5bf90e var/lib/lx-office-erp/templates/webpages/dbupgrade/coa_guess_master.html
-575748bb2612205ac1db854f267614e0 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_master.html
-60d467fd643b77e726fe26e1d29e9c52 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_done_en.html
-764f8eba7f4242c9225830e7ecb8f77e var/lib/lx-office-erp/templates/webpages/dbupgrade/warehouse_form_de.html
-d7b1712c89c841a57c70c15019120636 var/lib/lx-office-erp/templates/webpages/dbupgrade/upgrade_message2_en.html
-428ab2c02887084ce43978859b263cc9 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_en.html
-3aecaff36da06f396db14eeccc7fa8fb var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_master.html
-f7375b7ce144f6ce9209303a70b81a8b var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_footer_de.html
-c43fcee53c430be80b545a40b0037097 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_done_de.html
-fff669bfd84d8e48dae1c88005d951a7 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_done_en.html
-4c3ca3c262ddb2f6da5fdf3ae958f02f var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_en.html
-9efa5dabdc54b3a05f6f1d368fc1b755 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_done_en.html
-1f37a58dc9eea704cb127c93fcba03b6 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_done_en.html
-a23e8602e9d4049cc6998f22143acd23 var/lib/lx-office-erp/templates/webpages/dbupgrade/std_buchungsgruppen_unknown_coa_de.html
-17ff5065d820455c050e5fc8a91e9cc6 var/lib/lx-office-erp/templates/webpages/dbupgrade/upgrade_message2_de.html
-5a5ef048463a7ef37303c71edfdc9145 var/lib/lx-office-erp/templates/webpages/dbupgrade/upgrade_message2_master.html
-107f01aebdb9bdfaef1c16771585ad85 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_master.html
-3621d663bf5836048646b82a63fe5594 var/lib/lx-office-erp/templates/webpages/dbupgrade/warehouse_form_en.html
-2551c2a46373f0ecaa555294aee144f5 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_done_de.html
-ab1012b068cd7c30df034c4882748143 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_done_master.html
-29fcd61f68fc03810c7d7d3965dcfebf var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_de.html
-c75e3089548a09365100b4a050d8a29a var/lib/lx-office-erp/templates/webpages/dbupgrade/coa_guess_en.html
-9eac0b5c72f60b211cc7191c338821af var/lib/lx-office-erp/templates/webpages/dbupgrade/warning_de.html
-f4ffa3b2a68bee7a110ebe43f01b4564 var/lib/lx-office-erp/templates/webpages/dbupgrade/warning_en.html
-863c145d1daef9e2aa35fd44101d1335 var/lib/lx-office-erp/templates/webpages/dbupgrade/cp_greeting_update_form_en.html
-f2bd7aafcba7f83e7417ece85946738b var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_header_master.html
-91e031a49da062959953bdcc925ced82 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_error_en.html
-fa7c7c87f1c2f0e1d4ff55d224b6eed3 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_de.html
-f864262764563dcdcb00bbf7f6ca0a58 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_de.html
-44838dd39a8da9c79c574c76a3065980 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_header_en.html
-a801918b9caf4d9c8e662355eaa36772 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_error_master.html
-45dea7e45a54abb822371be3515bff6a var/lib/lx-office-erp/templates/webpages/dbupgrade/footer_de.html
-757e0fe1bb8e8332f8a4e84a65a99c0c var/lib/lx-office-erp/templates/webpages/dbupgrade/std_buchungsgruppen_unknown_coa_en.html
-fae4de80a5b741647fe5616daa495472 var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_update_en.html
-27a1b29370ce43742cdb0d65533efba7 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_master.html
-86a711f91b021bea6ee57682fbd21770 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_done_de.html
-42d065f139bf27eff1a5cbf233248144 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_done_de.html
-a3570949c98e21e77c53c8df49a4c047 var/lib/lx-office-erp/templates/webpages/dbupgrade/header_en.html
-80fc76a983ac0b0968dd32d0c8fb8c10 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_done_de.html
-ecdbfc108ea7a8bcf23024c04df0b653 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_header_master.html
-4ea96d795a5e0772f467b46b74b9ef64 var/lib/lx-office-erp/templates/webpages/dbupgrade/update_templates_warnings_master.html
-42f58c81a4e640f18f5b73372e8c2529 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_done_master.html
-fabfa40e85d5bdb5d1ec9fc04a8968dd var/lib/lx-office-erp/templates/webpages/dbupgrade/units_error_de.html
-233863657c28868b82beecbe59711976 var/lib/lx-office-erp/templates/webpages/dbupgrade/header_de.html
-0e72ca93e1934295bc624406d8fc407b var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_update_de.html
-d762eec09bb7f33de346e7d86a7fcdcf var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_done_de.html
-990140ad52135c35b4b22cc79e741ab9 var/lib/lx-office-erp/templates/webpages/dbupgrade/std_buchungsgruppen_unknown_coa_master.html
-58ebd87657d857e968f2763943d2ecac var/lib/lx-office-erp/templates/webpages/dbupgrade/coa_guess_de.html
-1c73b14e80185aa1eba014f925acacf2 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_header_en.html
-f0b25a31ec28f701c20f135cbf69fe31 var/lib/lx-office-erp/templates/webpages/dbupgrade/header_master.html
-7625304367172d726746c6773ddfde61 var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_already_exists_en.html
-16c10e3a522b6cf58bc54defad2ae224 var/lib/lx-office-erp/templates/webpages/dbupgrade/error_en.html
-0430daa342de4c3d8096fffe3d90dfdd var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_en.html
-6334d4b5e30f048a044d5c53d0c24d78 var/lib/lx-office-erp/templates/webpages/dbupgrade/warning_master.html
-0ec37b486eb320dd399da3c259d4afb1 var/lib/lx-office-erp/templates/webpages/dbupgrade/warehouse_form_master.html
-3be376f64e37b18333f21cd0426f26aa var/lib/lx-office-erp/templates/webpages/dbupgrade/cp_greeting_update_form_de.html
-9c8876166a45e31e26f230f25e3cb39f var/lib/lx-office-erp/templates/webpages/dbupgrade/error_de.html
-e1cbb66b5a8f2f4d279407d25567c31d var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_parts_en.html
-dac96aadbb8e5fd355570d1cabb9195d var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_footer_en.html
-b88ac035d74d7deb2bf380288431de72 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_header_de.html
-177ee123f4cd1e2e678883286d1a3704 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_done_en.html
-ce26fa98ef0d54cdacfb9a6167b694af var/lib/lx-office-erp/templates/webpages/dbupgrade/error_master.html
-b651f0eabf126383bee9cf380c768b30 var/lib/lx-office-erp/templates/webpages/dbupgrade/footer_master.html
-5f8b29ff70c1bbb6e5cafa351b754197 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_done_en.html
-8966ec6abb0c1c260ae1c8cd40911b27 var/lib/lx-office-erp/templates/webpages/dbupgrade/cp_greeting_update_form_master.html
-d74f15db3d2f67367276926026d20481 var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_already_exists_de.html
-7069b6a2bf1ff21ba980c86674fb7a1e var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_update_master.html
-ce50b6710b1539827c97091e9d1ed173 var/lib/lx-office-erp/templates/webpages/dbupgrade/SKR04_3804_already_exists_master.html
-6596c1333c7e19fe06cbf192101fc921 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_de.html
-b792995be843a6c1d7e1a74f715dea73 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_header_de.html
-af57b48822dc7f30570f9ad24a5e5936 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_master.html
-b5379d08db9e0001198ba453f79c9667 var/lib/lx-office-erp/templates/webpages/dbupgrade/footer_en.html
-4e534b2e34873c469a92b29284eb5c8e var/lib/lx-office-erp/templates/webpages/dbupgrade/units_parts_done_master.html
-387d78f5db797f5db7948b4b924dd4a8 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_en.html
-77e4a1dbef0350966b62801bd36e9e30 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_assemblies_done_master.html
-a5a99e229ef3d06317dbf066bc4c34c7 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_footer_master.html
-a8d5f18e5343fce77a56e4afdc6277e3 var/lib/lx-office-erp/templates/webpages/dbupgrade/buchungsgruppen_services_en.html
-3a73adedd3c905102e9f084bae211cae var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_master.html
-35225a31bd62538c715b8db509ab803e var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_done_master.html
-994107ad95bccb9f8f4d1c31c76b5f09 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_set_default_done_master.html
-87d24e5cfb8e86bf74892b0ff29043c5 var/lib/lx-office-erp/templates/webpages/dbupgrade/units_services_de.html
-be19e3118bd23ec1264ffc055f052646 var/lib/lx-office-erp/templates/webpages/dbupgrade/update_templates_warnings_en.html
-b3690f99c8093fc421190fcd0e78d3dc var/lib/lx-office-erp/templates/webpages/dbupgrade/update_templates_warnings_de.html
-c69ede943aed109cf62e9b0fa794a827 var/lib/lx-office-erp/templates/webpages/ustva/config_step2_en.html
-51ad9ebc8c214d321cfca0f2792b151a var/lib/lx-office-erp/templates/webpages/ustva/config_step1_en.html
-0e35704a8cb2642dc1ebfafe9149b6d0 var/lib/lx-office-erp/templates/webpages/ustva/config_step1_de.html
-313500434dd3c0019cb9c4d8776dc61a var/lib/lx-office-erp/templates/webpages/ustva/generic_taxreport_de.html
-a4d0be48defb966cdebd199466322a6c var/lib/lx-office-erp/templates/webpages/ustva/generic_taxreport_master.html
-e81d592753aee76e1e07334b968c7c33 var/lib/lx-office-erp/templates/webpages/ustva/config_step2_master.html
-2dfcff14adf3598fafb6d1a5580ffd83 var/lib/lx-office-erp/templates/webpages/ustva/report_master.html
-e94b5122fc9e913c9609ce55de13b316 var/lib/lx-office-erp/templates/webpages/ustva/report_en.html
-c42755086ebd35e3239a726f9a5a4ed9 var/lib/lx-office-erp/templates/webpages/ustva/config_step2_de.html
-0fd7bf5875c8d01abc35c62e9c0778f3 var/lib/lx-office-erp/templates/webpages/ustva/config_step1_master.html
-805dc79abb2380b526ff684598521a4a var/lib/lx-office-erp/templates/webpages/ustva/generic_taxreport_en.html
-d91a0c5a8ee528b0fe0b7946cb91f94c var/lib/lx-office-erp/templates/webpages/ustva/report_de.html
-1ea10f656e406d04eac1d162e7051257 var/lib/lx-office-erp/templates/webpages/ic/form_header_master.html
-fbc043124826cd71f4ce0a5f046de3c8 var/lib/lx-office-erp/templates/webpages/ic/ajax_autocomplete_en.html
-4f6acdc63ea9ac8c7c27c027d44ea32d var/lib/lx-office-erp/templates/webpages/ic/search_update_prices_de.html
-2de5466636f55eafcfc6ae2b39dea90c var/lib/lx-office-erp/templates/webpages/ic/generate_report_bottom_de.html
-605a965665fd9f173d8a28a0e8007419 var/lib/lx-office-erp/templates/webpages/ic/choice_master.html
-48700bf6a6eb266eb98cbb31a2319abb var/lib/lx-office-erp/templates/webpages/ic/assembly_row_de.html
-c1c65d9590eecfa372e76ca904a3b169 var/lib/lx-office-erp/templates/webpages/ic/generate_report_bottom_master.html
-075c3092c7249267166a0bccf002ad7a var/lib/lx-office-erp/templates/webpages/ic/makemodel_master.html
-66d40f6a3adbee0ea7d64fed057b1375 var/lib/lx-office-erp/templates/webpages/ic/assembly_row_master.html
-b782c645b1b8bf99081cd97c6cdfc779 var/lib/lx-office-erp/templates/webpages/ic/confirm_price_update_de.html
-86c1e721edbf0560d97edbc139cc4db5 var/lib/lx-office-erp/templates/webpages/ic/parts_language_selection_master.html
-aff59bab39dca99d0146017a71a7fca3 var/lib/lx-office-erp/templates/webpages/ic/search_update_prices_en.html
-eebf2904167fda7cebda5f7807bb2884 var/lib/lx-office-erp/templates/webpages/ic/generate_report_bottom_en.html
-fbc043124826cd71f4ce0a5f046de3c8 var/lib/lx-office-erp/templates/webpages/ic/ajax_autocomplete_master.html
-85da5ec9a0f63c4941d160469dacd330 var/lib/lx-office-erp/templates/webpages/ic/price_row_de.html
-93f763c4c676e506f5372363b26af0cd var/lib/lx-office-erp/templates/webpages/ic/makemodel_en.html
-31eef4bb1267c6d3dded4bf880f9d289 var/lib/lx-office-erp/templates/webpages/ic/confirm_price_update_master.html
-775984375cb24a522507f8a4bbc56880 var/lib/lx-office-erp/templates/webpages/ic/choice_de.html
-9635858f93d927b70ff2c15b5da25ec6 var/lib/lx-office-erp/templates/webpages/ic/price_row_master.html
-61e4517a75c480e74d10d5061e121ff6 var/lib/lx-office-erp/templates/webpages/ic/form_footer_en.html
-6898a0a455e5b516a65b09e13f3c7567 var/lib/lx-office-erp/templates/webpages/ic/form_header_de.html
-5d14902f6a70f163d2926e7a226f1b85 var/lib/lx-office-erp/templates/webpages/ic/parts_language_selection_de.html
-fbc043124826cd71f4ce0a5f046de3c8 var/lib/lx-office-erp/templates/webpages/ic/ajax_autocomplete_de.html
-07e9138e416bc21ad5938cdc144f96de var/lib/lx-office-erp/templates/webpages/ic/search_en.html
-f0d254b9552467989518b6be2b5d1bb5 var/lib/lx-office-erp/templates/webpages/ic/search_update_prices_master.html
-c745c33a448f1745da86d6066241106a var/lib/lx-office-erp/templates/webpages/ic/makemodel_de.html
-d05d9e24ccbf6cce02e860e2402afcd3 var/lib/lx-office-erp/templates/webpages/ic/confirm_price_update_en.html
-c0cca5d0e08f92fa5bb453a67d8d30bf var/lib/lx-office-erp/templates/webpages/ic/choice_en.html
-4a18e8d6b69712cfc6fa87cd262ff0ab var/lib/lx-office-erp/templates/webpages/ic/search_de.html
-0c79ad67c5e4ed9d690f9d025325b51e var/lib/lx-office-erp/templates/webpages/ic/parts_language_selection_en.html
-09c1069db2bae7472b810c995c567c71 var/lib/lx-office-erp/templates/webpages/ic/assembly_row_en.html
-b4e4d32d0edc610b3cbb434472f8029a var/lib/lx-office-erp/templates/webpages/ic/form_footer_master.html
-e9a1e05e371782aa688134cdb20d8531 var/lib/lx-office-erp/templates/webpages/ic/price_row_en.html
-4df3ed196fde7494b87bcae472b008fa var/lib/lx-office-erp/templates/webpages/ic/search_master.html
-dd5585031eda146cf19e5ec5a8e4ebd4 var/lib/lx-office-erp/templates/webpages/ic/form_footer_de.html
-7efcbd3fa8925361d32d928e433fab1a var/lib/lx-office-erp/templates/webpages/ic/form_header_en.html
-023ba8eb9067e5f9dceafdfc6c24e9bf var/lib/lx-office-erp/templates/webpages/projects/project_form_master.html
-401ae410e8574aebe6b583686c519668 var/lib/lx-office-erp/templates/webpages/projects/search_en.html
-b942d4b6958d627a5cf0100e38ce4a94 var/lib/lx-office-erp/templates/webpages/projects/project_form_en.html
-1d1cd1fa7d8965cbe4b7cab42df30a16 var/lib/lx-office-erp/templates/webpages/projects/search_de.html
-5cddcf039e605ef93c41e5d8db581d56 var/lib/lx-office-erp/templates/webpages/projects/search_master.html
-6869e32aa268b16ba82bf3c9beea2bc6 var/lib/lx-office-erp/templates/webpages/projects/project_form_de.html
-8c27dff36659a202af2a8a4fbe0d6e27 var/lib/lx-office-erp/templates/webpages/generic/select_delivery_customer_en.html
-00a31a4b3cbd298b2cc6aecca2ba3e9e var/lib/lx-office-erp/templates/webpages/generic/set_longdescription_master.html
-ad9f6ed368678681ecb14b7af8f0b586 var/lib/lx-office-erp/templates/webpages/generic/part_selection_master.html
-a0b6c687efc0d779b61cbc5e493ec5d8 var/lib/lx-office-erp/templates/webpages/generic/part_selection_en.html
-61340563d86ea4a68a3eace3b6e90c87 var/lib/lx-office-erp/templates/webpages/generic/print_options_en.html
-0fb303db82bbf0b400a04b3de37091e0 var/lib/lx-office-erp/templates/webpages/generic/select_delivery_customer_de.html
-a823cbd7d654c6cc4a347d022029fb3c var/lib/lx-office-erp/templates/webpages/generic/edit_email_de.html
-48efe2a8a38f2908accf052bc68ae39d var/lib/lx-office-erp/templates/webpages/generic/cov_selection_de.html
-5a9c18c3315f84eae8a5b626d6b173c4 var/lib/lx-office-erp/templates/webpages/generic/select_vendor_en.html
-0d676d28844d2bdf19f19c7c2d68eb54 var/lib/lx-office-erp/templates/webpages/generic/calculate_qty_master.html
-599306dcc2903fbf1ac0ca905ccb2ad2 var/lib/lx-office-erp/templates/webpages/generic/multibox.html
-4b66b83f20ecd1e774be62a117c25e34 var/lib/lx-office-erp/templates/webpages/generic/cov_selection_master.html
-85bd95f793076f25e3a492548eb56edb var/lib/lx-office-erp/templates/webpages/generic/print_options_master.html
-512fc9dfd0e45b24c08d246f23f1d06a var/lib/lx-office-erp/templates/webpages/generic/new_item_master.html
-8c9c7be25c1caa647e9d1d7ca1d3256d var/lib/lx-office-erp/templates/webpages/generic/set_longdescription_de.html
-8c127da0387c5999d9c62f665f634a61 var/lib/lx-office-erp/templates/webpages/generic/new_item_en.html
-079c1431a376bb04e42fa67c0808aa54 var/lib/lx-office-erp/templates/webpages/generic/error_en.html
-52b3752cde93eaabfe16b598543af62a var/lib/lx-office-erp/templates/webpages/generic/new_item_de.html
-ebe5d380f5ae1be8dc5177e4e32f6e74 var/lib/lx-office-erp/templates/webpages/generic/edit_email_en.html
-a0bac1f185b47b6448d7235c098b7613 var/lib/lx-office-erp/templates/webpages/generic/set_longdescription_en.html
-ee25c62c9ec8389a2e7109dfa821c7be var/lib/lx-office-erp/templates/webpages/generic/error_de.html
-ac3996cc0db4caae81ba5b47390331bc var/lib/lx-office-erp/templates/webpages/generic/print_options_de.html
-9ecdbab7e33b215959ddcde4b90a667c var/lib/lx-office-erp/templates/webpages/generic/select_vendor_master.html
-f25fad25a7e35edcb23dd6c02d874246 var/lib/lx-office-erp/templates/webpages/generic/information_en.html
-517659cca466f45cd269a0521c72108e var/lib/lx-office-erp/templates/webpages/generic/select_part_de.html
-9ab8d73053c7d6bc252d13e65e2284d4 var/lib/lx-office-erp/templates/webpages/generic/select_part_en.html
-ac1b845e95924044445a57ba8e8c5004 var/lib/lx-office-erp/templates/webpages/generic/error_master.html
-add1a8611ae92e27b34cb56d55078568 var/lib/lx-office-erp/templates/webpages/generic/calculate_qty_en.html
-c6f1b6b2316cd1241c0ba1bc2fea04d6 var/lib/lx-office-erp/templates/webpages/generic/cov_selection_en.html
-2e74c23861c0e82ab25cab8fd94e010b var/lib/lx-office-erp/templates/webpages/generic/select_vendor_de.html
-384af1d31985e444d00aef4a852b317f var/lib/lx-office-erp/templates/webpages/generic/calculate_qty_de.html
-8d4e1f84985bd1478ac8d754f730950f var/lib/lx-office-erp/templates/webpages/generic/select_part_master.html
-7a792fd3154aac016f40dec38c479c8b var/lib/lx-office-erp/templates/webpages/generic/edit_email_master.html
-f25fad25a7e35edcb23dd6c02d874246 var/lib/lx-office-erp/templates/webpages/generic/information_de.html
-de0b98779f5e378e0357b15885e8c926 var/lib/lx-office-erp/templates/webpages/generic/select_delivery_customer_master.html
-99d2c3122c9ae525645b04b73d8492f7 var/lib/lx-office-erp/templates/webpages/generic/information_master.html
-1e7cb2ff383be49ed5bfcedf9be48b2e var/lib/lx-office-erp/templates/webpages/generic/autocomplete.html
-723f4695e1be154266f59eb3ce36d8f6 var/lib/lx-office-erp/templates/webpages/generic/part_selection_de.html
-af52c125e5209b4496d29bfd11b24e7c var/lib/lx-office-erp/templates/webpages/fu/close_window_en.html
-446bfb60c35d56be90d20d7e498bff7f var/lib/lx-office-erp/templates/webpages/fu/report_top_de.html
-58f45564fe90b114bddebba78cbd4ffa var/lib/lx-office-erp/templates/webpages/fu/add_edit_master.html
-3c03d16ec594b4ddb3ab064e6a072536 var/lib/lx-office-erp/templates/webpages/fu/edit_access_rights_de.html
-af52c125e5209b4496d29bfd11b24e7c var/lib/lx-office-erp/templates/webpages/fu/close_window_de.html
-6c375826610b93b633ea0be6e67fa171 var/lib/lx-office-erp/templates/webpages/fu/report_bottom_de.html
-fcc8c0ee56eefb6b712e59ab1cd5ecd0 var/lib/lx-office-erp/templates/webpages/fu/add_edit_de.html
-446bfb60c35d56be90d20d7e498bff7f var/lib/lx-office-erp/templates/webpages/fu/report_top_master.html
-10aa1531b877bea0290fa961c69d0081 var/lib/lx-office-erp/templates/webpages/fu/report_for_todo_list_master.html
-bda9f1a1d0149ec1f190af082768cfe5 var/lib/lx-office-erp/templates/webpages/fu/search_en.html
-1fb9ff8f8983c631e9106c6114d51d27 var/lib/lx-office-erp/templates/webpages/fu/edit_access_rights_en.html
-27553a326ed088c28dfea10c074de0bd var/lib/lx-office-erp/templates/webpages/fu/report_for_todo_list_en.html
-b1d922e5554df09e42e05f6d3cd7c49d var/lib/lx-office-erp/templates/webpages/fu/search_de.html
-87985f7b653362268bf144dfef990ef5 var/lib/lx-office-erp/templates/webpages/fu/report_bottom_en.html
-ec3e36ad51e8d499d363e4212c4290a1 var/lib/lx-office-erp/templates/webpages/fu/add_edit_en.html
-af52c125e5209b4496d29bfd11b24e7c var/lib/lx-office-erp/templates/webpages/fu/close_window_master.html
-cee904b2486b66844cc971074c8b6baa var/lib/lx-office-erp/templates/webpages/fu/search_master.html
-1c2a631a4bb10ceb8e29820698d94269 var/lib/lx-office-erp/templates/webpages/fu/report_for_todo_list_de.html
-a12ac943c5de9bccccd7a7f13565a570 var/lib/lx-office-erp/templates/webpages/fu/report_bottom_master.html
-446bfb60c35d56be90d20d7e498bff7f var/lib/lx-office-erp/templates/webpages/fu/report_top_en.html
-c2a95b6f139d6dea16689e9fcc48cc7d var/lib/lx-office-erp/templates/webpages/fu/edit_access_rights_master.html
-3da6b9787dfdc7f80cc417672c9b7180 var/lib/lx-office-erp/templates/webpages/report_generator/html_report_en.html
-761ee0f595df5da3342b756dbf78f673 var/lib/lx-office-erp/templates/webpages/report_generator/csv_export_options_en.html
-2535f7fbedebd82dc7a951a72006afb6 var/lib/lx-office-erp/templates/webpages/report_generator/csv_export_options_de.html
-11d8664c7aa415631d26b67fe1c12413 var/lib/lx-office-erp/templates/webpages/report_generator/pdf_export_options_en.html
-46c800b692729401ed8d37a3f3692885 var/lib/lx-office-erp/templates/webpages/report_generator/pdf_export_options_de.html
-7913e56166d72420c413412cf110fa99 var/lib/lx-office-erp/templates/webpages/report_generator/html_report_de.html
-6f48a3c2eb16503b5a811484dddb756c var/lib/lx-office-erp/templates/webpages/report_generator/csv_export_options_master.html
-5a8906ce118324ae4abf9ef82a2c1148 var/lib/lx-office-erp/templates/webpages/report_generator/html_report_master.html
-b30a701708274ae8ac5ba5329877d09e var/lib/lx-office-erp/templates/webpages/report_generator/pdf_export_options_master.html
-38c742ae1c6b8849f28017107ca75f05 var/lib/lx-office-erp/templates/webpages/login/password_error_de.html
-f98c69f5d427b15ec1c9dc04bcd3f90a var/lib/lx-office-erp/templates/webpages/login/authentication_pl_missing_master.html
-0d1571bef9bc0efeebde1aa5dd139c19 var/lib/lx-office-erp/templates/webpages/login/company_logo_de.html
-a76a5665bbc0bb82489bdf4409250fad var/lib/lx-office-erp/templates/webpages/login/login_screen_en.html
-cff2545afb89009803529d0f17b5834a var/lib/lx-office-erp/templates/webpages/login/company_logo_en.html
-ea3f87322ab1821a1881b7ed2993f603 var/lib/lx-office-erp/templates/webpages/login/auth_db_unreachable_en.html
-09c7902c1ee3c101b0a7e818605440c9 var/lib/lx-office-erp/templates/webpages/login/password_error_en.html
-f0dbc7059d4d7da532cb15a09a91cecb var/lib/lx-office-erp/templates/webpages/login/password_error_master.html
-2f28d0c8ae850f9c85a116d626afc86b var/lib/lx-office-erp/templates/webpages/login/login_screen_master.html
-8ae7e2f3d6a6682ab137af58dde6456f var/lib/lx-office-erp/templates/webpages/login/auth_db_unreachable_master.html
-f1f53e4040059a13d5ff65606b33961e var/lib/lx-office-erp/templates/webpages/login/login_screen_de.html
-f1f77358c26b23d16b487da97bb7779a var/lib/lx-office-erp/templates/webpages/login/authentication_pl_missing_de.html
-30b1bafdc3b657bd65266247f15b6d3d var/lib/lx-office-erp/templates/webpages/login/company_logo_master.html
-ac3e9d84abe32af56741c930ba762d46 var/lib/lx-office-erp/templates/webpages/login/authentication_pl_missing_en.html
-4b0785b594904ec2a958c6daea005090 var/lib/lx-office-erp/templates/webpages/login/auth_db_unreachable_de.html
-0f1a6043aee9d68a7ff40fba8490495c var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_display_form_master.html
-9cd99bda887c2c424c3d735b531826c1 var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_display_form_en.html
-ffa0f02033fc6d72853ed1ff16fd9f3b var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_list_bottom_de.html
-61f453b84399ae1d523750b7cd4883d6 var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_display_form_de.html
-e1d7558d15f29febac7604a06c8dac93 var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_list_bottom_master.html
-5294e2c22372ea8898b66a55e5235c58 var/lib/lx-office-erp/templates/webpages/bankaccounts/bank_account_list_bottom_en.html
-67304488a9093b6bed9a645637491fa4 var/lib/lx-office-erp/templates/webpages/gl/generate_report_bottom_de.html
-7e3a325bc9baf0193a5baa09c8251a74 var/lib/lx-office-erp/templates/webpages/gl/generate_report_bottom_master.html
-e9ebe746f5eb5cc50a7a30c4969ed288 var/lib/lx-office-erp/templates/webpages/gl/generate_report_bottom_en.html
-ac6b3c4af2047560f298fdee613e34ef var/lib/lx-office-erp/templates/webpages/gl/form_header_chart_balances_js_master.html
-ac6b3c4af2047560f298fdee613e34ef var/lib/lx-office-erp/templates/webpages/gl/form_header_chart_balances_js_en.html
-ac6b3c4af2047560f298fdee613e34ef var/lib/lx-office-erp/templates/webpages/gl/form_header_chart_balances_js_de.html
-ae77e6d2b9e14f273ea47aec6655d783 var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_stock_master.html
-9d0bac0e2b25680985082d6e30d0060d var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_en.html
-03d94b24443ec47de5d460e9d84b4cab var/lib/lx-office-erp/templates/webpages/wh/removal_parts_selection_en.html
-8c469c68da49ff2cd0c9d02c2a138e43 var/lib/lx-office-erp/templates/webpages/wh/transfer_parts_selection_de.html
-4f28f06fae98d28c4c8934c36eb7912c var/lib/lx-office-erp/templates/webpages/wh/report_filter_de.html
-9986d9f705446f6b24e8df7cf43b5aaa var/lib/lx-office-erp/templates/webpages/wh/removal_parts_selection_de.html
-7d545ffc0946bd8880c5277cb4d64d04 var/lib/lx-office-erp/templates/webpages/wh/report_filter_master.html
-011399f25332d751fe1b47f2ab78abb4 var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_master.html
-ecff811e42ea4bd5ed714409855089b1 var/lib/lx-office-erp/templates/webpages/wh/removal_parts_selection_master.html
-10fec5f5b8971c37cf6157de77583fce var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_assembly_de.html
-f884750d9c284399057cd303acb4b356 var/lib/lx-office-erp/templates/webpages/wh/transfer_parts_selection_master.html
-5fb5da4f151f8a6e8416d64a5c63e655 var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_stock_en.html
-3b81588cc910e8d56edb6636acdc0b98 var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_stock_de.html
-47d45129322c969db0772c22a7a01a5a var/lib/lx-office-erp/templates/webpages/wh/journal_filter_en.html
-8ee0ac4c19decba11be84485bbdeadae var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_de.html
-ff3d12b517fec56ce8f5f112d6cea269 var/lib/lx-office-erp/templates/webpages/wh/report_filter_en.html
-5dbb476108d10672a52e767aeab4e11f var/lib/lx-office-erp/templates/webpages/wh/journal_filter_de.html
-a9f0dad3845f6cda8b77780992f53a93 var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_assembly_master.html
-14bef23770eb3ab91b02583898bf2fda var/lib/lx-office-erp/templates/webpages/wh/warehouse_selection_assembly_en.html
-5b807c88bdb3d96fe8e240fb4d013e20 var/lib/lx-office-erp/templates/webpages/wh/journal_filter_master.html
-3016238eaedade29f6807a409b915a2c var/lib/lx-office-erp/templates/webpages/wh/transfer_parts_selection_en.html
-da2581e4798b852c553533b8cfb16484 var/lib/lx-office-erp/templates/webpages/ap/ap_transactions_bottom_de.html
-d194f2599e5dfe15ea3a6f16e5bc9c42 var/lib/lx-office-erp/templates/webpages/ap/search_en.html
-2bff7da86ec1859a946626fa9135dacf var/lib/lx-office-erp/templates/webpages/ap/search_de.html
-6acad280147716619d48deb32d7b82fe var/lib/lx-office-erp/templates/webpages/ap/ap_transactions_bottom_master.html
-245808f195ddad0a41bec286421513ed var/lib/lx-office-erp/templates/webpages/ap/search_master.html
-db17e8a8553a35fd30eb17967296ad8a var/lib/lx-office-erp/templates/webpages/ap/ap_transactions_bottom_en.html
-8077225135a1c92319c9ef42bafa8a94 var/lib/lx-office-erp/templates/webpages/am/config_de.html
-9d13d9029709e7f99bae678eef3c08e3 var/lib/lx-office-erp/templates/webpages/am/edit_defaults_de.html
-540834c94ce37828b41767c661905105 var/lib/lx-office-erp/templates/webpages/am/edit_price_factor_master.html
-05da231dfb43bd52555f1917260c9dda var/lib/lx-office-erp/templates/webpages/am/list_tax_en.html
-21279b3e7f738a913a60306375aa6dc8 var/lib/lx-office-erp/templates/webpages/am/list_tax_de.html
-842ea362b5895a1cfb803b0afd054e31 var/lib/lx-office-erp/templates/webpages/am/edit_warehouse_en.html
-0339c819acb14f1c49eb4202422997aa var/lib/lx-office-erp/templates/webpages/am/list_account_details_en.html
-a40777b1b636184f52f0c4b1ac001b3d var/lib/lx-office-erp/templates/webpages/am/list_price_factors_de.html
-73e310944d1ba8ff017882281a68bd94 var/lib/lx-office-erp/templates/webpages/am/list_accounts_master.html
-8aed3c73946c33cc6d707f35a394e80a var/lib/lx-office-erp/templates/webpages/am/list_account_details_de.html
-19e11e7e824a5157de7b79f20534560b var/lib/lx-office-erp/templates/webpages/am/config_en.html
-07593669512ce18eee2bd89cc330ee68 var/lib/lx-office-erp/templates/webpages/am/edit_accounts_en.html
-98c4b189c2415704f68a430a1d63c4ed var/lib/lx-office-erp/templates/webpages/am/list_price_factors_master.html
-87f61ae88f3e6a43ad0997f4d33f875d var/lib/lx-office-erp/templates/webpages/am/edit_units_de.html
-f2d19057d3d59c65a7be9280c640dd6b var/lib/lx-office-erp/templates/webpages/am/confirm_delete_warehouse_master.html
-728a1899404b2082e722189e505a1edb var/lib/lx-office-erp/templates/webpages/am/edit_tax_en.html
-28bd967c65053dbd45c3fe7026432c6b var/lib/lx-office-erp/templates/webpages/am/edit_units_master.html
-bfcb8be47b7ea0cdd414cdf9df9917f8 var/lib/lx-office-erp/templates/webpages/am/edit_warehouse_master.html
-537fea6afd4a90e8bbd6a2dacee2f3a8 var/lib/lx-office-erp/templates/webpages/am/edit_accounts_master.html
-b56c567b1c0ca00512b2ecbc7ee334d1 var/lib/lx-office-erp/templates/webpages/am/config_master.html
-7891f89f0b857c1d2f9ffacf7d4aa0e1 var/lib/lx-office-erp/templates/webpages/am/list_warehouses_master.html
-73a469851785d3d223d6ac4f2532a67d var/lib/lx-office-erp/templates/webpages/am/edit_templates_master.html
-8a335cf617d6b5002ceb755a6a09013f var/lib/lx-office-erp/templates/webpages/am/edit_price_factor_en.html
-08b6257e6caebe9eb06b4703ecd91f4f var/lib/lx-office-erp/templates/webpages/am/list_accounts_de.html
-93199543744b12ccadcd0724c485c2c5 var/lib/lx-office-erp/templates/webpages/am/list_account_details_master.html
-3943348fc90663d99f103caa2144428f var/lib/lx-office-erp/templates/webpages/am/edit_templates_en.html
-0a927a8cb5fa1d61760cdf252899dea4 var/lib/lx-office-erp/templates/webpages/am/list_warehouses_en.html
-a115d2ddadbf973d60d74e1fb86a5d04 var/lib/lx-office-erp/templates/webpages/am/list_accounts_en.html
-17353f82986928f2a80c4503de439d76 var/lib/lx-office-erp/templates/webpages/am/edit_defaults_en.html
-75d4752f7068294ae0d341788262bf8d var/lib/lx-office-erp/templates/webpages/am/edit_defaults_master.html
-5aa9e068bfc1850c4ccbc23325e456e3 var/lib/lx-office-erp/templates/webpages/am/edit_warehouse_de.html
-3d5d5857edab69b77aa882d51e1b6e13 var/lib/lx-office-erp/templates/webpages/am/edit_tax_master.html
-0e56f548f2765949bfd6538e7f8ec912 var/lib/lx-office-erp/templates/webpages/am/list_warehouses_de.html
-68ef595ae75d447b4033e86b7f0c30a7 var/lib/lx-office-erp/templates/webpages/am/confirm_delete_warehouse_en.html
-0f32342394d2dbb1e3fb94db59b25e8c var/lib/lx-office-erp/templates/webpages/am/edit_price_factor_de.html
-7c251d57b5248b201147b10253b2fb2b var/lib/lx-office-erp/templates/webpages/am/confirm_delete_warehouse_de.html
-a87ff3e41da8bdf027846a1ef2ae93ad var/lib/lx-office-erp/templates/webpages/am/edit_tax_de.html
-7734eabb868b004cd350566c72460c82 var/lib/lx-office-erp/templates/webpages/am/edit_accounts_de.html
-a18a9d12b1cafd78ed3eb92552eab915 var/lib/lx-office-erp/templates/webpages/am/list_tax_master.html
-d3403bca68e63b171f3c2e8dfbaca95d var/lib/lx-office-erp/templates/webpages/am/edit_templates_de.html
-f33be4493fcb74e80f23f2e5b673f734 var/lib/lx-office-erp/templates/webpages/am/edit_units_en.html
-7b1e2bd19460d9fd7aa09f52a717abea var/lib/lx-office-erp/templates/webpages/am/list_price_factors_en.html
-4f1e47a2022188c01eade98f70da5c2e var/lib/lx-office-erp/templates/webpages/datev/net_gross_difference_de.html
-4f1e47a2022188c01eade98f70da5c2e var/lib/lx-office-erp/templates/webpages/datev/net_gross_difference_en.html
-4f1e47a2022188c01eade98f70da5c2e var/lib/lx-office-erp/templates/webpages/datev/net_gross_difference_master.html
-08038721eae64756e3be59a37968fb04 var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_master.html
-b09e35c34d846703620ac9859ed308b9 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxkeys_en.html
-b427789fb6c1ea6175f285d817a6ac7c var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_ap_ar_wrong_taxkeys_de.html
-f17967f459eea809fa75c4f51eb27116 var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_en.html
-b4165dceb6cf084c5ac3ced3a6071331 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_ap_ar_wrong_taxkeys_de.html
-febc5a84dda823a7fa124fc2a627138c var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_invoice_inventory_with_taxkeys_master.html
-bfb60f48ec682711adf7b5f58a11671d var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxkeys_de.html
-508d23779686f6c1f8254ddd3a657240 var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_confirmation_en.html
-9907784cc7d3b2213817245ad19f5a87 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_invoice_inventory_with_taxkeys_de.html
-1bee05786433c15e8f101e749521f5f0 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_wrong_taxkeys_de.html
-ec7fb02073665b196c699edc78fa896d var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_invoice_inventory_with_taxkeys_en.html
-948ad8b601b045f17d7119efac4fb819 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_invoice_inventory_with_taxkeys_de.html
-a6f001b5ccc0679e0d0c8760ea9a8769 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_ap_ar_wrong_taxkeys_master.html
-ee016646714f193724c871a06f11a153 var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_filter_en.html
-90e87807de6790a2bdc0ae11da345476 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxes_de.html
-142e5fb9893a3204c6a799fc9bf45852 var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_overview_master.html
-be0b5d720803d9d326c4a1dc3269cce4 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxkeys_master.html
-e49f1ed453e43c19172ec8ebf02cd255 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_wrong_taxkeys_en.html
-c9ca4e2f5834f2690ec9b19d3c49534f var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_overview_en.html
-bd90612e6da239828243d1fef3380a64 var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_confirmation_master.html
-d0c2c0ff6af11c4dfa14b2deb8124d58 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_ap_ar_wrong_taxkeys_master.html
-b3d9aace3262bee791a6bf58612ab08e var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_de.html
-32f73561bc9c24640c65c1c64a1c2e4b var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_filter_de.html
-c9314188ace862a62dca7a430281ca29 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_wrong_taxkeys_master.html
-a811f2534322718b72c8e479e994e43f var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_invoice_inventory_with_taxkeys_en.html
-98350667a4bf79b331ca085931a4ab45 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_invoice_inventory_with_taxkeys_master.html
-9721b7a629e2a258946071925803a127 var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_overview_de.html
-87a0dd4c843749b2ac10f257f550c4c8 var/lib/lx-office-erp/templates/webpages/acctranscorrections/fix_ap_ar_wrong_taxkeys_en.html
-c3737387ca651056fe76841ad005b347 var/lib/lx-office-erp/templates/webpages/acctranscorrections/analyze_filter_master.html
-68050a5b41e6b60cfc0f9a8ef1e0402b var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxes_master.html
-14d525c6afdf312cc868819f0ebb9860 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_wrong_taxes_en.html
-a64664ffdc91f42cb83e3b001f6595f4 var/lib/lx-office-erp/templates/webpages/acctranscorrections/assistant_for_ap_ar_wrong_taxkeys_en.html
-7794077eb330ca142dd062a64a76cb2f var/lib/lx-office-erp/templates/webpages/acctranscorrections/delete_transaction_confirmation_de.html
-b0134638a381aaeb354fe0c16245da95 var/lib/lx-office-erp/templates/webpages/todo/show_todo_list_en.html
-182374255028c8e5568c44c42e7e23a5 var/lib/lx-office-erp/templates/webpages/todo/show_todo_list_de.html
-2296c2fc78c1d9415cf2ba4f2aac0f40 var/lib/lx-office-erp/templates/webpages/todo/show_todo_list_master.html
-d863f8d5546ec0589cfb146bfb4c26b2 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_header_de.html
-33e66db3d10fd5a625b5dd53c9f5b9ae var/lib/lx-office-erp/templates/webpages/admin/user_migration_done_master.html
-eb5f5a2c195866c1bd0795cc92532c0c var/lib/lx-office-erp/templates/webpages/admin/create_dataset_de.html
-04d339fa4d5a16019332aa65a65affe4 var/lib/lx-office-erp/templates/webpages/admin/list_users_de.html
-ece9541c399fbdd7c2f2b52583d1e4b9 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_footer_master.html
-ceec7169d0b90d993897f55dee7b0229 var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_done_master.html
-1c254edd457b9a57520d2946269dc5e5 var/lib/lx-office-erp/templates/webpages/admin/dbadmin_en.html
-ae6c1dd81f27440772634bea2b490aab var/lib/lx-office-erp/templates/webpages/admin/update_dataset_en.html
-7ca14dec44736c9669a1f96d076ce489 var/lib/lx-office-erp/templates/webpages/admin/adminlogin_de.html
-e697467aa24a030e0b53347f8fa4f64e var/lib/lx-office-erp/templates/webpages/admin/dbcreate_en.html
-6f6b3634afc59cdbef03c3f30db11fea var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_footer_de.html
-21688bb17aa4b7004d6d6abfccdac2bc var/lib/lx-office-erp/templates/webpages/admin/edit_groups_de.html
-6f2858e5abc040139f6193ac71145baa var/lib/lx-office-erp/templates/webpages/admin/delete_dataset_en.html
-47e8873f162cb75e54ec99f56015f2ed var/lib/lx-office-erp/templates/webpages/admin/edit_group_membership_de.html
-798ca89690df058b000e63a2edf0206f var/lib/lx-office-erp/templates/webpages/admin/delete_group_confirm_master.html
-4aedc25729ab7315cbfbde2930650263 var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_footer_en.html
-694c1cacf475ade738041694c28e621c var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_header_en.html
-046363112b2361f9e16bb0a449ad129e var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_header_de.html
-7c9e65059b850ddc6b7edd0bb732103a var/lib/lx-office-erp/templates/webpages/admin/create_standard_group_ask_en.html
-046363112b2361f9e16bb0a449ad129e var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_header_en.html
-0c7db2c378dbbe8ae7b7f24714f09768 var/lib/lx-office-erp/templates/webpages/admin/dbcreate_de.html
-e2217ac5c07c4cae27bc8e24421c94ca var/lib/lx-office-erp/templates/webpages/admin/dbdelete_en.html
-d78e737cfd2a13f28c282a8112583305 var/lib/lx-office-erp/templates/webpages/admin/delete_group_confirm_de.html
-a1bffabbbad908078e10b7712cc7aeed var/lib/lx-office-erp/templates/webpages/admin/dbadmin_master.html
-c3281eaa74ee0256df01510b7f55ad37 var/lib/lx-office-erp/templates/webpages/admin/delete_dataset_master.html
-661572e12231efbd16596d783e2bd610 var/lib/lx-office-erp/templates/webpages/admin/adminlogin_en.html
-e60bba5b00ee9f8bd6fc69f25a5e0f7b var/lib/lx-office-erp/templates/webpages/admin/dbdelete_de.html
-2349445863fda797b87f1dab72407313 var/lib/lx-office-erp/templates/webpages/admin/user_migration_done_de.html
-ac433dd4cc53dc96b3f5fd89029e2472 var/lib/lx-office-erp/templates/webpages/admin/create_dataset_master.html
-478a46a584c9e04d983aa70c8a5971cf var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_footer_master.html
-4e2bbd370ababb7909ee3546ebed7cf1 var/lib/lx-office-erp/templates/webpages/admin/dbadmin_de.html
-f3c863fb26529f9c30f80e3802daf264 var/lib/lx-office-erp/templates/webpages/admin/edit_group_en.html
-00aa7991efdcceb4a250eabbbd07aee9 var/lib/lx-office-erp/templates/webpages/admin/dbdelete_master.html
-ac3c7f445d21042b9a9230b8f1206621 var/lib/lx-office-erp/templates/webpages/admin/edit_groups_master.html
-506bfeb7ef6c7288e4d5a50f66f5f2a3 var/lib/lx-office-erp/templates/webpages/admin/edit_group_de.html
-94f4d0fed7cdc8f5ff1952506a2cad8a var/lib/lx-office-erp/templates/webpages/admin/check_auth_tables_en.html
-4e6b6b41ada615a457c4bf70e4b953ce var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_done_de.html
-de5ac5904650e4e2d26fd22668e0916b var/lib/lx-office-erp/templates/webpages/admin/check_auth_database_en.html
-068ad2edc4a9f6e328d8a5b5696ab97b var/lib/lx-office-erp/templates/webpages/admin/check_auth_tables_master.html
-25ae4aabd9d0d5a3019bd418260fee56 var/lib/lx-office-erp/templates/webpages/admin/edit_user_de.html
-e179dc4ed07550b53ab76e5b55f476c1 var/lib/lx-office-erp/templates/webpages/admin/dbcreate_master.html
-ac1fe9429b9d5c39487fc266bf5a4f8e var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_master.html
-555331e85b301db4d69c28326bbb385b var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_email_done_de.html
-ed993a69ff46718fed59243733767b2c var/lib/lx-office-erp/templates/webpages/admin/check_auth_tables_de.html
-5ed359b3fb3474eadceb5a763fca392c var/lib/lx-office-erp/templates/webpages/admin/create_standard_group_ask_de.html
-2192c2ee774f395a3523e2e863df2568 var/lib/lx-office-erp/templates/webpages/admin/test_db_connection_de.html
-5de2a61d713becc069d2164aa3892002 var/lib/lx-office-erp/templates/webpages/admin/user_migration_complete_en.html
-fadb09c40a22fd33d7eb9f3172e5ce18 var/lib/lx-office-erp/templates/webpages/admin/test_db_connection_en.html
-f0ddb757f809edf9476e1c83a4e7a768 var/lib/lx-office-erp/templates/webpages/admin/user_migration_de.html
-946ee129adf928b88bd9b523cdd813ad var/lib/lx-office-erp/templates/webpages/admin/delete_dataset_de.html
-046363112b2361f9e16bb0a449ad129e var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_header_master.html
-2ba7ce2d7647693af84f50a86aec4c79 var/lib/lx-office-erp/templates/webpages/admin/user_migration_complete_de.html
-fde8cd6c777752ded8a14f0d576bb041 var/lib/lx-office-erp/templates/webpages/admin/edit_user_en.html
-7d59c8de001ac13e98c4348da2384b3a var/lib/lx-office-erp/templates/webpages/admin/check_auth_database_de.html
-05c01ea072a4d6f9acef30bee26bc380 var/lib/lx-office-erp/templates/webpages/admin/test_db_connection_master.html
-431895ea7b6d67b3c85173b157d2c2c7 var/lib/lx-office-erp/templates/webpages/admin/edit_groups_en.html
-60d18b43c24ba513e1e0c1acefd98046 var/lib/lx-office-erp/templates/webpages/admin/adminlogin_master.html
-1ddc1fb9fd275e25fb25109f11602246 var/lib/lx-office-erp/templates/webpages/admin/list_users_en.html
-f4dcdc0622968e8896fdc47b365c08b6 var/lib/lx-office-erp/templates/webpages/admin/update_dataset_de.html
-5b60a0f5f80bb05ab2f3fecbb6109c42 var/lib/lx-office-erp/templates/webpages/admin/list_users_master.html
-9d3b5d3e7de514924125a465fc465250 var/lib/lx-office-erp/templates/webpages/admin/user_migration_complete_master.html
-c0f1d089c6b2bf60b54153d8004a8008 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_footer_de.html
-b9d3d0c32151a6d01fc432d94df4e48b var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_de.html
-9c39fe1932060b8a188b277b072532ab var/lib/lx-office-erp/templates/webpages/admin/update_dataset_master.html
-4fff97c57768a44dea1f917c26499e42 var/lib/lx-office-erp/templates/webpages/admin/user_migration_master.html
-20b3e8e0c852a2750df1f42d5c0d5cee var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_de.html
-2d09708fa30d6e1bc522014cdc2679c6 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_header_master.html
-78c2f83258d46fc7f165df496fcec28f var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_master.html
-0c930a89aa810c2b84a79442e2191f3a var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_header_de.html
-9dbca199f3b4c688b9c345150c29b5b6 var/lib/lx-office-erp/templates/webpages/admin/edit_group_membership_master.html
-0f5764be4ce9b8bc1a42525bdcac5944 var/lib/lx-office-erp/templates/webpages/admin/user_migration_done_en.html
-a5fd86c6fa587a41f516c78172445b4e var/lib/lx-office-erp/templates/webpages/admin/check_auth_database_master.html
-067c593facc10a659e5101967e7fb9f0 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_en.html
-24d1c94e11ebab4871ea39218c486b41 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_footer_en.html
-f9df02c838acdae9d62b599ef6c1ca58 var/lib/lx-office-erp/templates/webpages/admin/restore_dataset_start_header_en.html
-0bec724c26b398a05d6d19c2917656ad var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_all_done_en.html
-0d279cd0c16c155490cb6130e1508676 var/lib/lx-office-erp/templates/webpages/admin/dbupgrade_header_master.html
-bcf2875e9f197fe1b56519c272eeb6bb var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_email_done_en.html
-c069affa7e9b09ad14a8491c35ede14b var/lib/lx-office-erp/templates/webpages/admin/edit_user_master.html
-ddf059f97098d0af0e10c78537cbf116 var/lib/lx-office-erp/templates/webpages/admin/user_migration_en.html
-01bef6d35bf4386dbf3b3e42e863c848 var/lib/lx-office-erp/templates/webpages/admin/edit_group_master.html
-c9ad27607d7257044ac95de92ad13709 var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_email_done_master.html
-cc98d1b5d9fab9193c894ce574199d5b var/lib/lx-office-erp/templates/webpages/admin/edit_group_membership_en.html
-4a764a7e4da5b6efe79e7893d9f085e2 var/lib/lx-office-erp/templates/webpages/admin/create_dataset_en.html
-ec3e6f6162aadd28afcbdd3fd087e133 var/lib/lx-office-erp/templates/webpages/admin/create_standard_group_ask_master.html
-6f98f79b4e7290919d800fffcc85014e var/lib/lx-office-erp/templates/webpages/admin/delete_group_confirm_en.html
-00cbf77efd1416ce1964ccb074a58f05 var/lib/lx-office-erp/templates/webpages/admin/backup_dataset_en.html
-ff7357473d13176c6a922e4b007e20eb var/lib/lx-office-erp/templates/webpages/is/form_header_master.html
-cadff1c2fbeb09a5440db854b8500488 var/lib/lx-office-erp/templates/webpages/is/_payments_en.html
-55fd786c72c674f9bb96c9fef1207964 var/lib/lx-office-erp/templates/webpages/is/form_footer_en.html
-67764fe7bf6a09f9de11e41ae7ef8d7c var/lib/lx-office-erp/templates/webpages/is/form_header_de.html
-cadff1c2fbeb09a5440db854b8500488 var/lib/lx-office-erp/templates/webpages/is/_payments_master.html
-cadff1c2fbeb09a5440db854b8500488 var/lib/lx-office-erp/templates/webpages/is/_payments_de.html
-ed0c4b8febf82d53ef5ca227a773259a var/lib/lx-office-erp/templates/webpages/is/form_footer_master.html
-af801b75bb842640b065adbd16a8ea2f var/lib/lx-office-erp/templates/webpages/is/form_footer_de.html
-a7ac4371b243d567e23422cf539b2c90 var/lib/lx-office-erp/templates/webpages/is/form_header_en.html
-531e685010e689e6fc7f53f8f9b4cded var/lib/lx-office-erp/templates/webpages/menu/menuv4_de.html
-253695451dfd0d5ac5512c302b69eb02 var/lib/lx-office-erp/templates/webpages/menu/menuv4_en.html
-b0f84138644122da453db01d96fedfda var/lib/lx-office-erp/templates/webpages/menu/menunew_master.html
-fcb240204703b0303656d74a8b0add27 var/lib/lx-office-erp/templates/webpages/menu/menunew_en.html
-e44b31161c5b23dcf7c70d309bedbb51 var/lib/lx-office-erp/templates/webpages/menu/menuv3_en.html
-b868314d2afa21c74eefd7010471a0d0 var/lib/lx-office-erp/templates/webpages/menu/menunew_de.html
-ec3b23ddcbd3be3bf3e01f47595b0369 var/lib/lx-office-erp/templates/webpages/menu/menuv3_master.html
-01f16591b6a78e87d51ce8da2ecace57 var/lib/lx-office-erp/templates/webpages/menu/menuv3_de.html
-4b50e5b2566dc8eb3761f710ce555254 var/lib/lx-office-erp/templates/webpages/menu/menuv4_master.html
-e4a1b0abdce3da780bb9115ec3ad2c76 var/lib/lx-office-erp/templates/webpages/common/show_history_master.html
-6facfa7ef577b1ffef6b8cc415a6c904 var/lib/lx-office-erp/templates/webpages/common/search_history_master.html
-594915e055870caddc36ce510ce386f0 var/lib/lx-office-erp/templates/webpages/common/show_vc_details_en.html
-871015dc2f6c2b6327c1a941c135ae60 var/lib/lx-office-erp/templates/webpages/common/show_vc_details_master.html
-27493eef32215eddc7001928ea5e798e var/lib/lx-office-erp/templates/webpages/common/search_history_de.html
-a008ba8a543c388b88b3e3aa04e5e45a var/lib/lx-office-erp/templates/webpages/common/show_vc_details_de.html
-235f1b60d2d28743533445456f60248b var/lib/lx-office-erp/templates/webpages/common/search_history_en.html
-312a9ccf79d5868233fb3b5468cf530c var/lib/lx-office-erp/templates/webpages/common/show_history_en.html
-e930a7946ffaf2b1dfea0844d980ceac var/lib/lx-office-erp/templates/webpages/common/show_history_de.html
-00aa122d11ff2f1d1276b5bc70adb09b var/lib/lx-office-erp/templates/webpages/ct/form_header_master.html
-8dfeb8ded906df252ba82203e4e01dcf var/lib/lx-office-erp/templates/webpages/ct/ajax_autocomplete_en.html
-717ff76d55d4024c1f35f4b71199a6f8 var/lib/lx-office-erp/templates/webpages/ct/get_delivery_de.html
-935b3398f53128d75c75dc3eb2ec6d6d var/lib/lx-office-erp/templates/webpages/ct/get_delivery_master.html
-1467f400f2417d4ce83fa6b42771685a var/lib/lx-office-erp/templates/webpages/ct/list_names_bottom_de.html
-8dfeb8ded906df252ba82203e4e01dcf var/lib/lx-office-erp/templates/webpages/ct/ajax_autocomplete_master.html
-895eb91f6f8c04cc956a035fd9d7b6ff var/lib/lx-office-erp/templates/webpages/ct/form_footer_en.html
-e306a9e07cf865ba90a0ac5dd321fa79 var/lib/lx-office-erp/templates/webpages/ct/list_names_bottom_master.html
-d0b017b140796c2385fa795a38014cbc var/lib/lx-office-erp/templates/webpages/ct/list_names_bottom_en.html
-bc401c133a38b0aefc8a442c8c6c321f var/lib/lx-office-erp/templates/webpages/ct/form_header_de.html
-8dfeb8ded906df252ba82203e4e01dcf var/lib/lx-office-erp/templates/webpages/ct/ajax_autocomplete_de.html
-16a2328dcd61fdd19700cdaa06475178 var/lib/lx-office-erp/templates/webpages/ct/search_en.html
-2ae48f54c2594b2e1e1d1fa75b1c6eb1 var/lib/lx-office-erp/templates/webpages/ct/get_delivery_en.html
-310aa8151b53f83084080a11ede3e00e var/lib/lx-office-erp/templates/webpages/ct/search_de.html
-6f095fd9ca5a24f36feb832cafb97c62 var/lib/lx-office-erp/templates/webpages/ct/form_footer_master.html
-19dc9e04caf7a0f233a102b09b6ce0a8 var/lib/lx-office-erp/templates/webpages/ct/search_master.html
-8c8ec26ffa09a8d13f5a259bfeed21e4 var/lib/lx-office-erp/templates/webpages/ct/form_footer_de.html
-b9bc8a177ce413c4f34453a16f4253cb var/lib/lx-office-erp/templates/webpages/ct/form_header_en.html
-1bc9e08b4ff7a8f5d9c4ce3a74de52fa var/lib/lx-office-erp/templates/webpages/generictranslations/edit_greetings_en.html
-998259880b69bdf7620d20de122ec8b9 var/lib/lx-office-erp/templates/webpages/generictranslations/edit_greetings_master.html
-3c9622e6fea6483316b2a428d88dcbc6 var/lib/lx-office-erp/templates/webpages/generictranslations/edit_greetings_de.html
-deb218b40a8f844ff007cd88657a2b78 var/lib/lx-office-erp/templates/webpages/drafts/load_master.html
-75dcbc3fd4cabfc2258de571592ca51c var/lib/lx-office-erp/templates/webpages/drafts/save_new_de.html
-3ab537037ba476066d3aaa0beb70137b var/lib/lx-office-erp/templates/webpages/drafts/save_new_en.html
-eb1a313b3330bd347f423816498a924c var/lib/lx-office-erp/templates/webpages/drafts/load_en.html
-53ff1beb4be4bff479fe5ad4d45c3b05 var/lib/lx-office-erp/templates/webpages/drafts/save_new_master.html
-c660b88492a5b9b185589ae73dadbfcf var/lib/lx-office-erp/templates/webpages/drafts/load_de.html
-c3a5e79525fe0efb3b946dd50817b1ac var/lib/lx-office-erp/templates/webpages/do/set_stock_in_out_master.html
-6d1c23065b2a7737b3c0a25e8645ec8e var/lib/lx-office-erp/templates/webpages/do/form_header_master.html
-c00f7e95c7a7302ee6ad7eed9510091a var/lib/lx-office-erp/templates/webpages/do/orders_bottom_master.html
-c3a5e79525fe0efb3b946dd50817b1ac var/lib/lx-office-erp/templates/webpages/do/set_stock_in_out_en.html
-c21ecca4c07bd368162afeeb129b9557 var/lib/lx-office-erp/templates/webpages/do/stock_in_form_master.html
-bfc28511b41e8a58c15c1cfe14537f53 var/lib/lx-office-erp/templates/webpages/do/stock_out_form_en.html
-a5834a9fb3d789306cf3e0e54dbe1edd var/lib/lx-office-erp/templates/webpages/do/orders_top_de.html
-c3a5e79525fe0efb3b946dd50817b1ac var/lib/lx-office-erp/templates/webpages/do/set_stock_in_out_de.html
-b18ceefe58bb99f102668177a6facbd3 var/lib/lx-office-erp/templates/webpages/do/form_footer_en.html
-0985a406061fff79031335d8ca5e0ad7 var/lib/lx-office-erp/templates/webpages/do/form_header_de.html
-00da491a1a17fb9bfc8299ae4f62025e var/lib/lx-office-erp/templates/webpages/do/delete_master.html
-a2e739053a5eea8b40a7a2cec0ae4343 var/lib/lx-office-erp/templates/webpages/do/stock_out_form_de.html
-989f8d15e9cf6cc18590c5ce5c3be5c8 var/lib/lx-office-erp/templates/webpages/do/delete_de.html
-31b5309a42d6d8b9ae545aeba6da9ec7 var/lib/lx-office-erp/templates/webpages/do/orders_bottom_de.html
-2c15fbcb969236966f6ae552d6be587e var/lib/lx-office-erp/templates/webpages/do/stock_in_form_en.html
-a5834a9fb3d789306cf3e0e54dbe1edd var/lib/lx-office-erp/templates/webpages/do/orders_top_en.html
-3433d7688902a926f2b8075ecda9080b var/lib/lx-office-erp/templates/webpages/do/search_en.html
-5cfa758aa28d8bc0a75f1e27e900101c var/lib/lx-office-erp/templates/webpages/do/orders_bottom_en.html
-a5834a9fb3d789306cf3e0e54dbe1edd var/lib/lx-office-erp/templates/webpages/do/orders_top_master.html
-88317a1c48555bcf0da679a17b328866 var/lib/lx-office-erp/templates/webpages/do/search_de.html
-0b25ef6bbec7d0b4ccf387ccb83e7dbe var/lib/lx-office-erp/templates/webpages/do/stock_in_form_de.html
-dc45787dc5aee3537c9e169b4b789673 var/lib/lx-office-erp/templates/webpages/do/delete_en.html
-a6ccd7cc157886428cabc7d0b8e2a247 var/lib/lx-office-erp/templates/webpages/do/form_footer_master.html
-8e5a20cbb8d49f5020f1066afd645929 var/lib/lx-office-erp/templates/webpages/do/search_master.html
-4d7a67c3f5e39f7cd367fd85666f7b9c var/lib/lx-office-erp/templates/webpages/do/form_footer_de.html
-6aeb8499d54e9c6a8c13a84a96b201e5 var/lib/lx-office-erp/templates/webpages/do/form_header_en.html
-9f4465a1fc6373b36b05d9f8eb6d86ac var/lib/lx-office-erp/templates/webpages/do/stock_out_form_master.html
-a65d425e7d1eb31eacb12be7667b1368 var/lib/lx-office-erp/templates/webpages/ar/ar_transactions_bottom_de.html
-2676f2e3a02714ee6ee6b0b1a9abba42 var/lib/lx-office-erp/templates/webpages/ar/ar_transactions_bottom_master.html
-feb9aed2dbe4c908b98ebcb0efe51456 var/lib/lx-office-erp/templates/webpages/ar/ar_transactions_bottom_en.html
-e2dfb2004d49b7d6082eaa5ade84c884 var/lib/lx-office-erp/templates/webpages/ar/search_en.html
-3fa797591608bfa32d16c9e43dcad883 var/lib/lx-office-erp/templates/webpages/ar/search_de.html
-02671ae38b4ec2cbeb47e3de2661d412 var/lib/lx-office-erp/templates/webpages/ar/search_master.html
-093e5d917ccec67e7691eb1294f0a2a3 var/lib/lx-office-erp/templates/webpages/ir/form_header_master.html
-112f7277800a824633594b418e5ed9dc var/lib/lx-office-erp/templates/webpages/ir/_payments_en.html
-e7e0298bc9343d670bf9d343d8d5f875 var/lib/lx-office-erp/templates/webpages/ir/form_footer_en.html
-344af913187bbda04523e45f6d570477 var/lib/lx-office-erp/templates/webpages/ir/form_header_de.html
-be65d3a3f3e74971aa0d0684312768d2 var/lib/lx-office-erp/templates/webpages/ir/_payments_master.html
-53f0dd00f0dc1dba5e65546206121c9a var/lib/lx-office-erp/templates/webpages/ir/_payments_de.html
-858b250fb93391ef820634a9adaa6781 var/lib/lx-office-erp/templates/webpages/ir/form_footer_master.html
-850b18112eb58679e97d6912172af346 var/lib/lx-office-erp/templates/webpages/ir/form_footer_de.html
-6f7158f2bb48ec9bf94b8e18185b4225 var/lib/lx-office-erp/templates/webpages/ir/form_header_en.html
-7f4bc510b0d83d31ecf59e9750c2808b var/lib/lx-office-erp/templates/webpages/oe/form_header_master.html
-91ef9bcec595d6229df8c7a7e3e7f4f7 var/lib/lx-office-erp/templates/webpages/oe/check_for_direct_delivery_en.html
-7fb290ea153a17e5a03d68abf212c6c7 var/lib/lx-office-erp/templates/webpages/oe/orders_bottom_master.html
-aee0e8f0a3b1fdc8f2a8fc3d9f9dcced var/lib/lx-office-erp/templates/webpages/oe/sales_order_en.html
-8fbf74b86ab154bfd4ed7816251000ca var/lib/lx-office-erp/templates/webpages/oe/check_for_direct_delivery_de.html
-d795f900b82fa3ed4e80f2cda45f7b82 var/lib/lx-office-erp/templates/webpages/oe/orders_top_de.html
-d06bcceb8916e7e4e785e94c6fe65974 var/lib/lx-office-erp/templates/webpages/oe/form_footer_en.html
-e674c958e399208e8a54f403d749351e var/lib/lx-office-erp/templates/webpages/oe/form_header_de.html
-e72b1926727a29766f49730c773fd81f var/lib/lx-office-erp/templates/webpages/oe/sales_order_de.html
-c80b1d0eedaee9e7ffab97933b0cfd16 var/lib/lx-office-erp/templates/webpages/oe/sales_order_master.html
-671ba6c1cddb37bff8a44a1f26418494 var/lib/lx-office-erp/templates/webpages/oe/orders_bottom_de.html
-c1d39517af8eaee431cb860bcac4ff97 var/lib/lx-office-erp/templates/webpages/oe/report_for_todo_list_master.html
-d795f900b82fa3ed4e80f2cda45f7b82 var/lib/lx-office-erp/templates/webpages/oe/orders_top_en.html
-a155e92d175e059bec7263eaa9cc55d8 var/lib/lx-office-erp/templates/webpages/oe/search_en.html
-1e59b469798d610a83098354dc0fc29b var/lib/lx-office-erp/templates/webpages/oe/check_for_direct_delivery_master.html
-da31d82f89220d1a7828f52227054f79 var/lib/lx-office-erp/templates/webpages/oe/report_for_todo_list_en.html
-1c27a2cb9f20ec9ceb2f999bd009cadf var/lib/lx-office-erp/templates/webpages/oe/orders_bottom_en.html
-d795f900b82fa3ed4e80f2cda45f7b82 var/lib/lx-office-erp/templates/webpages/oe/orders_top_master.html
-8a24c60fce93d8bd42d6ddde1a1cff11 var/lib/lx-office-erp/templates/webpages/oe/search_de.html
-cf29debac15a5521036de7bbfde3b46f var/lib/lx-office-erp/templates/webpages/oe/form_footer_master.html
-ce674abf0dd6d554a6636227d3e89dc0 var/lib/lx-office-erp/templates/webpages/oe/search_master.html
-34ecec11eda4babe851b444538eb6250 var/lib/lx-office-erp/templates/webpages/oe/form_footer_de.html
-8ddd7392428992789e355353e6615e15 var/lib/lx-office-erp/templates/webpages/oe/report_for_todo_list_de.html
-10adb561f8b07601147d044a7982908b var/lib/lx-office-erp/templates/webpages/oe/form_header_en.html
-b414bc46433eaf94fc8b797fc183c67c var/lib/lx-office-erp/templates/Service-purchase_order.tex
-839b7d7649eedc2821c1eaa2895ed575 var/lib/lx-office-erp/templates/German-ustva-2007.tex
-0d40f63220ea3bd89d47ce5adba5a5a9 var/lib/lx-office-erp/templates/Default-statement.html
-5e9ac282909e3c2a8bd5b62fb337f8c8 var/lib/lx-office-erp/templates/Default-sales_quotation.html
-7b80ccbfa27caecdc5d0f008f3a7fd82 var/lib/lx-office-erp/templates/German-sales_order.html
-476f94f3fe82520e0d7eaa3291bddaad var/lib/lx-office-erp/templates/French-sales_order.tex
-69ca8d14bd6c55ee3986651724068af9 var/lib/lx-office-erp/templates/German-purchase_order.html
-d8ac374d2b12eb05bb96699545ba7b63 var/lib/lx-office-erp/templates/Service-income_statement.html
-85211f161d3756653a51fc0e98bdc34c var/lib/lx-office-erp/templates/German-pick_list.html
-309395cc15f2815806f954e05cd56c3a var/lib/lx-office-erp/templates/German-ustva-2004.tex
-08709c5d76c0bb448b13ecd3052833b8 var/lib/lx-office-erp/templates/German-request_quotation.tex
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/Default-check.tex
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/French-check.tex
-d1077ce1ff3fc7653f2e0e1408929527 var/lib/lx-office-erp/templates/Default-statement.tex
-9ce6dc1f839f2e9b0559f1a160953e63 var/lib/lx-office-erp/templates/German-sales_quotation.odt
-68136cbe9ddae73ec0834499d20d8190 var/lib/lx-office-erp/templates/German-bin_list.tex
-000ed50819696dbae3eb778e967d4d6a var/lib/lx-office-erp/templates/German-sales_delivery_order.tex
-da3b0fbff4a8dcbe8a1fc1b7638d0e5a var/lib/lx-office-erp/templates/German-taxbird.txb
-b31dd7c0b91c91933fc50b6a06ea751f var/lib/lx-office-erp/templates/German-statement.tex
-9731f84931dab5707c8016146be8f07f var/lib/lx-office-erp/templates/Service-statement.tex
-1d64c7e6b09733867cee7e53a5c03362 var/lib/lx-office-erp/templates/German-invoice.tex
-055cc37e055a931af585a5af05628329 var/lib/lx-office-erp/templates/German-winston.xml
-1aed69835a8481081b850b8bf8818968 var/lib/lx-office-erp/templates/German-credit_note.tex
-427f2c3500eb54ad8502b6d8940d0268 var/lib/lx-office-erp/templates/.htaccess
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/French-receipt.tex
-cccf3f986050c69bb12dc225fdf09297 var/lib/lx-office-erp/templates/Service-sales_order.tex
-c32897cd3d1d1ac410c0da1137c2f2f4 var/lib/lx-office-erp/templates/French-statement.html
-93dc30d65ff774108927d787b88fc6a4 var/lib/lx-office-erp/templates/Default-packing_list.html
-9af675b363186211e84500db49ebe417 var/lib/lx-office-erp/templates/Service-balance_sheet.html
-20d916a480a81959cdccc99725997c06 var/lib/lx-office-erp/templates/Default-pick_list.html
-cd5ae3a2526af1bd2468f98050e21c11 var/lib/lx-office-erp/templates/German-ustva-2008.tex
-0d40f63220ea3bd89d47ce5adba5a5a9 var/lib/lx-office-erp/templates/Service-statement.html
-c5d8ce8a85047d0a592c8ac6e7d77bfe var/lib/lx-office-erp/templates/German-statement.html
-c15774d3e9a9d9d136d946f9645e9144 var/lib/lx-office-erp/templates/Default-sales_quotation.tex
-d8ac374d2b12eb05bb96699545ba7b63 var/lib/lx-office-erp/templates/Default-income_statement.html
-092c3dc7914ea52d6428ee76fad75cc6 var/lib/lx-office-erp/templates/French-packing_list.tex
-bd65961c34555fb7c01961ffad49a7e0 var/lib/lx-office-erp/templates/French-invoice.html
-e415a6c099e0a493c12ce07ced795d7e var/lib/lx-office-erp/templates/German-packing_list.html
-7dbe39c0e9d2ebe47e387c98c4843021 var/lib/lx-office-erp/templates/French-packing_list.html
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/Service-check.tex
-451c39235d61c63158befe8a66c0a597 var/lib/lx-office-erp/templates/German-invoice.html
-a2bbdeb44910e0176925191cd1a49510 var/lib/lx-office-erp/templates/German-pick_list.tex
-6fd3d2c75beaf9accd9fecb353b99976 var/lib/lx-office-erp/templates/German-sales_order.tex
-9e08b53f351d7847ddefd50cf0e7d65b var/lib/lx-office-erp/templates/German-income_statement.html
-9af675b363186211e84500db49ebe417 var/lib/lx-office-erp/templates/Default-balance_sheet.html
-155dc470337c0d189968c8ded25e1cfa var/lib/lx-office-erp/templates/Service-receipt.tex
-9731f84931dab5707c8016146be8f07f var/lib/lx-office-erp/templates/French-statement.tex
-369570021760bad16586a3531301cc36 var/lib/lx-office-erp/templates/French-balance_sheet.html
-22a90b4b44e72f6f54c8dd57d6856cec var/lib/lx-office-erp/templates/German-zahlungserinnerung_invoice.tex
-2d565296c041e21d8eea2459d8764290 var/lib/lx-office-erp/templates/Service-sales_order.html
-efe4734b5db286cea607ffe00e260334 var/lib/lx-office-erp/templates/German-ustva-2006.tex
-a8db82b7408fbb09ec0d95dfc124c0d5 var/lib/lx-office-erp/templates/German-packing_list.tex
-48a4b1634eb5f51813f2ceffe02d934f var/lib/lx-office-erp/templates/Default-invoice.tex
-b78cff44045628a42a19cd8548a6d68f var/lib/lx-office-erp/templates/German-zahlungserinnerung.tex
-378578c92e2ef41fadd0fdd9cdad5d15 var/lib/lx-office-erp/templates/German-sales_quotation.html
-ff55b5128e22500e7c97bc2f8b6154fb var/lib/lx-office-erp/templates/Default-bin_list.tex
-ca1942a777bb9757e0929f677dcc6f49 var/lib/lx-office-erp/templates/German-invoice.odt
-2ed163ca132661bdde443d9fa26564bf var/lib/lx-office-erp/templates/French-purchase_order.html
-3d363f762c99e9cdcb08a423a8ce039e var/lib/lx-office-erp/templates/Default-packing_list.tex
-8bc701c81a0ee89fe4478ddae2ef4827 var/lib/lx-office-erp/templates/French-sales_order.html
-6f81ff6f4639eefe6816e7288374a28b var/lib/lx-office-erp/templates/German-check.tex
-b064d0f07f8fd71423879e8ffe9d6be5 var/lib/lx-office-erp/templates/Default-invoice.html
-947ddd3cdc8d188dce0d9b0c689f3235 etc/lx-office-erp/lx-erp.conf.default
-ea0d4d87c77d5b69a20bcafc76c987c6 etc/lx-office-erp/lx-office-erp.cherokee
-947ddd3cdc8d188dce0d9b0c689f3235 etc/lx-office-erp/lx-erp.conf
-bea7284fe4b080a4ab01b4dabf951295 etc/lx-office-erp/lx-office-erp.apache2.conf
+++ /dev/null
-#!/bin/bash
-# postinst script for lx-office-erp-svn
-#
-# see: dh_installdeb(1)
-
-# e = exit on error
-set -e
-# x = xtrace
-#set -x
-
-debugfile=$(mktemp /tmp/lx-erp.log.XXXXXX)
-echo " ! "`date`" Postinst $1 !" >> $debugfile
-
-source /usr/share/debconf/confmodule
-
-# summary of how this script can be called:
-# * <postinst> `configure' <most-recently-configured-version>
-# * <old-postinst> `abort-upgrade' <new version>
-# * <conflictor's-postinst> `abort-remove' `in-favour' <package>
-# <new-version>
-# * <postinst> `abort-remove'
-# * <deconfigured's-postinst> `abort-deconfigure' `in-favour'
-# <failed-install-package> <version> `removing'
-# <conflicting-package> <version>
-# for details, see http://www.debian.org/doc/debian-policy/ or
-# the debian-policy package
-
-
-config_postgresql_factory_script() {
-
- echo "Starting factory postgresql config script: scripts/inst_postgres_deb.sh.."
- cd /usr/lib/lx-office-erp/
- ./scripts/inst_postgres_deb.sh
- echo "Factory postgresql config script done."
-}
-
-
-set_lx_office_erp_web_admin_password() {
- db_get lx-office-erp/admin-password
- ADMINPASSWORD="$RET"
-
- sed --in-place --expression "s/^admin_password.*=.*/admin_password = $ADMINPASSWORD/" /etc/lx-office-erp/lx_office.conf
-}
-
-
-set_lx_office_erp_authentication_db_user_password() {
- db_get lx-office-erp/lx-office-erp-user-postgresql-password
- PASSWORD="$RET"
-
- sed --in-place --expression "s/^password.*=.*/password = $PASSWORD/" /etc/lx-office-erp/lx_office.conf
- sed --in-place --expression "s/^user.*=.*postgres/user = lxoffice/g" /etc/lx-office-erp/lx_office.conf
-}
-
-
-set_user_rights() {
- chown -R www-data:www-data /usr/lib/lx-office-erp/users
- chown -R www-data:www-data /usr/lib/lx-office-erp/templates
- chown www-data:www-data /etc/lx-office-erp/lx_office.conf
- chown www-data:www-data /usr/lib/lx-office-erp/menu.ini
- chmod 0600 /etc/lx-office-erp/lx_office.conf
-}
-
-mk_new_menu() {
- if [ -e /usr/lib/lx-office-crm ] ; then
- #crm vorhanden, dann die menu.ini mit der höchsten VersNr nehmen
- for i in `ls -1 /usr/lib/lx-office-crm/update/menu*ini` ; do
- cat $i > /usr/lib/lx-office-erp/menu.ini
- done;
- cat /usr/lib/lx-office-erp/menu.default >> /usr/lib/lx-office-erp/menu.ini
- else
- cp /usr/lib/lx-office-erp/menu.default /usr/lib/lx-office-erp/menu.ini
- fi
-}
-
-mk_new_config() {
- if ! [ -f /etc/lx-office-erp/lx_office.conf ] ; then
- cp /etc/lx-office-erp/lx_office.conf.default /etc/lx-office-erp/lx_office.conf
- fi
-}
-
-mk_links() {
- for file in lx_office.conf lx_office.conf.default ; do
- test -f /usr/lib/lx-office-erp/config/${file} || ln -s /etc/lx-office-erp/${file} /usr/lib/lx-office-erp/config/${file}
- done
- for file in lx-erp.conf authentication.pl ; do
- if [ -f /usr/lib/lx-office-erp/config/${file} ] ; then
- rm /usr/lib/lx-office-erp/config/${file}
- fi
- done
- if [ -e /etc/apache2 ] ; then
- if ! [ -f /etc/apache2/conf.d/lx-office-erp.apache2.conf ] ; then
- ln -s /etc/lx-office-erp/lx-office-erp.apache2.conf /etc/apache2/conf.d/lx-office-erp.apache2.conf
- fi;
- fi;
- if [ -e /etc/cherokee/sites-available ] ; then
- if ! [ -f /etc/cherokee/sites-available/lx-office-erp.cherokee ] ; then
- cat /etc/lx-office-erp/lx-office-erp.cherokee.handler >> /etc/cherokee/sites-available/default
- ln -s /etc/lx-office-erp/lx-office-erp.cherokee /etc/cherokee/sites-available/lx-office-erp.cherokee
- fi;
- fi;
- if [ -e /etc/lighttpd ] ; then
- if ! [ -f /etc/lighttpd/conf-enabled/lx-office-erp.lighttpd ] ; then
- ln -s /etc/lx-office-erp/lx-office-erp.lighttpd /etc/lighttpf/conf-enabled/10-lx-office-erp
- fi;
- fi;
-}
-web_server_ctrl() {
- local action=$1
- if [ -x "/etc/init.d/apache2" ]; then
- if [ -x /usr/sbin/invoke-rc.d ]; then
- invoke-rc.d apache2 $action ||true
- else
- /etc/init.d/apache2 $action ||true
- fi
- fi
- if [ -f /etc/init.d/cherokee ] ; then
- /etc/init.d/cherokee $action || true
- fi
- if [ -f /etc/init.d/lighttpd ] ; then
- /etc/init.d/lighttpd $action || true
- fi
-
- # if [ $action = restart ] ; then
- # echo Sleeping
- # sleep 5
- # echo Awake
- # fi
-}
-
-enable_fcgi() {
- if [ -x /usr/sbin/a2enmod -a -f /usr/lib/apache2/modules/mod_fcgid.so ] ; then
- /usr/sbin/a2enmod fcgid
- # web_server_ctrl restart
- fi
-}
-
-case "$1" in
-
- upgrade)
- echo " ! "`date`" $1 !" >> $debugfile
-
- enable_fcgi
-
- VER=`cat /var/www/lx-office-erp/VERSION | cut -d '.' -f2`
- if [ $VER = '6' ]; then
- echo " ! 2.6 !" >> $debugfile
- echo "Version 2.6.x"
- mk_new_menu
- else
- mk_new_menu
- mk_new_config
- config_postgresql_factory_script
- set_lx_office_erp_web_admin_password
- set_lx_office_erp_authentication_db_user_password
- mk_links
- fi;
-
- set_user_rights
- ps auxw
-
- db_stop || true
- web_server_ctrl restart
-
- ;;
-
- install|configure)
- echo " ! "`date`" $1 !" >> $debugfile
-
- enable_fcgi
-
- mk_new_menu
- mk_new_config
- config_postgresql_factory_script
- set_lx_office_erp_web_admin_password
- set_lx_office_erp_authentication_db_user_password
- mk_links
-
- set_user_rights
-
- db_stop || true
- web_server_ctrl restart
-
- ;;
-
- abort-upgrade|abort-remove|abort-deconfigure)
- ;;
-
- *)
- echo "postinst called with unknown argument \`$1'" >&2
- exit 1
- ;;
-esac
-
-echo "done!!"
-
-exit 0
+++ /dev/null
-#!/bin/sh
-set -e
-#set -x
-echo " ! "`date`" Postrm $1 !" >> /tmp/lxo-erp.log
-
-if [ "$1" = purge ] && [ -e /usr/share/debconf/confmodule ]; then
- rm -rf /var/lib/lx-office-erp/templates/*
- rm -rf /usr/lib/lx-office-erp/config/*
- rm -rf /etc/apache*/conf.d/lx-office-erp*
- rm -f /usr/lib/lx-office-erp/lxdbinst.sql
- . /usr/share/debconf/confmodule
- db_purge
-fi
+++ /dev/null
-#!/bin/sh
-#Nur für das Update von einer 2.6.0 nötig, da hier gnadenlos gelöscht wird
-#set -x
-
-(
-echo " ! "`date`" Preinst $1 !" >> /tmp/lxo-erp.log
-)
-
-if [ "$1" = "upgrade" ]; then
- echo " ! upgrade !" >> /tmp/lxo-erp.log
- cnt=`grep -c '\-e /usr/lib/lx-office-erp' /var/lib/dpkg/info/lx-office-erp.postrm`
- echo " ! $cnt !" >> /tmp/lxo-erp.log
- if [ $cnt -gt 0 ]; then
- echo "#!/bin/sh" > /var/lib/dpkg/info/lx-office-erp.postrm
- echo "set -e" >> /var/lib/dpkg/info/lx-office-erp.postrm
- echo "echo ' ! '`date`' postrm2 $1 !'" >> /var/lib/dpkg/info/lx-office-erp.postrm
- chmod +x /var/lib/dpkg/info/lx-office-erp.postrm
- else
- echo " ! ok !" >> /tmp/lxo-erp.log
- fi
-fi
-
+++ /dev/null
-Template: lx-office-erp/admin-password-conf
-Type: boolean
-Default: true
-Description: Admin Passwort einrichten?
- Es wird empfohlen, ein Admin Passwort fuer das Web-Frontend von LX-Office-ERP einzurichten (127.0.0.1/lx-erp/admin.pl).
-
-Template: lx-office-erp/admin-password
-Type: password
-Description: Neues Admin Passwort
-
-Template: lx-office-erp/admin-password2
-Type: password
-Description: Bestaetigung
- Bitte Admin-Passwort wiederholen.
-
-Template: lx-office-erp/password-mismatch
-Type: error
-Description: Keine Uebereinstimmung.
- Sie haben keine uebereinstimmenden Passwoerter eingegeben. Bitte nochmals eingeben.
-
-Template: lx-office-erp/lx-office-erp-user-postgresql-password
-Type: password
-Description: Neues Passwort fuer Lx-Office-ERP Datenbank-Nutzer
- Der neue Account des Lx-Office-ERP Datenbanknutzers ist zu schuetzen. Bitte ein neues
- Passwort eingeben.
-
-Template: lx-office-erp/lx-office-erp-user-postgresql-password2
-Type: password
-Description: Bestaetigung
- Bitte Datenbank-Passwort wiederholen.
-
-Template: lx-office-erp/password-empty
-Type: error
-Description: Fehlendes Kennwort
- Sie müssen ein Datenbank-Kennwort vergeben!
+++ /dev/null
-Debian-Paket erzeugen.
-
-ERP aus dem Git clonen:
-
-git clone git://lx-office.linet-services.de/lx-office-erp.git
-
-Die Datei mk_erp_deb.sh
-In das neue Verzeichnis lx-office-erp wechsel und die Datei
-DEBIAN/mk_erp_deb.sh mit einem Editor öffnen. Die Pfade:
-SRC und DST ggf. anpassen und wieder speichern.
-
-Die Datei DEBIAN/mk_erp_deb.sh ausführen. Fertig.
-
-
-FCGI wird mit diesem Paket nicht installiert.
-Dafür würde ich ein eigenes Paket bauen.
-Dieses bekommt ein eigenes Konfigfile für den Apache und
-erfüllt die Abhängigkeiten.
-Dann kann jeder Admin selber entscheiden, ob er
-fcgi einschaltet.
\ No newline at end of file
+++ /dev/null
-#!/bin/bash
-
-#Jedes neue Paket der gleichen Version bekommt eine eigene Nummer
-NR="${NR:-0}"
-
-#hier wurde das Git-Paket entpakt:
-SRC=/tmp/lx-office-erp
-
-#hier wird das Debian-Paket gebaut:
-DST=/tmp/package
-
-
-################################################
-# ab hier keine Konfiguration mehr
-################################################
-
-VER=`cat VERSION`
-DEST=$DST/lx-office-erp_$VER-$NR$1_all
-
-
-mkdir -p $DEST
-cd $DEST
-
-#Struktur anlegen:
-cp -a $SRC/DEBIAN/DEBIAN .
-tar xzf $SRC/DEBIAN/struktur.tgz
-
-#Für Hardy + co Sonderbehandlung
-if [ "$1#" == "-older#" ]; then
- mv DEBIAN/control.older DEBIAN/control
-else
- rm DEBIAN/control.older
-fi
-
-#Dateien kopieren:
-#aber keine fertigen Konfigurationen, nur *.default
-cp -a $SRC/SL usr/lib/lx-office-erp
-cp -a $SRC/bin usr/lib/lx-office-erp
-cp -a $SRC/js usr/lib/lx-office-erp
-cp -a $SRC/locale usr/lib/lx-office-erp
-cp -a $SRC/lxo-import usr/lib/lx-office-erp
-cp -a $SRC/modules usr/lib/lx-office-erp
-cp -a $SRC/scripts usr/lib/lx-office-erp
-cp -a $SRC/sql usr/lib/lx-office-erp
-cp -a $SRC/t usr/lib/lx-office-erp
-cp -a $SRC/*.pl usr/lib/lx-office-erp
-cp -a $SRC/dispatcher.f* usr/lib/lx-office-erp
-cp $SRC/VERSION usr/lib/lx-office-erp
-cp $SRC/index.html usr/lib/lx-office-erp
-cp $SRC/config/lx_office.conf.default etc/lx-office-erp/lx_office.conf.default
-cp $SRC/menu.ini usr/lib/lx-office-erp/menu.default
-cp -a $SRC/css var/lib/lx-office-erp
-cp -a $SRC/templates var/lib/lx-office-erp
-cp -a $SRC/users var/lib/lx-office-erp
-
-cp -a $SRC/doc/* usr/share/doc/lx-office-erp/
-cp -a $SRC/image/* usr/share/lx-office-erp/
-
-#Ist nicht im Repository. Liegt bei sf
-if [ "$1#" == "-older#" ]; then
- tar xzf $SRC/DEBIAN/lx-erp-perl-libs-compat-v2.tar.gz
-fi
-
-#Git- und dummy-files löschen
-find . -name ".git*" -exec rm -rf {} \;
-find . -name ".dummy" -exec rm -rf {} \;
-
-#Rechte setzen
-chown -R www-data: usr/lib/lx-office-erp
-chown -R www-data: var/lib/lx-office-erp
-chown -R www-data: etc/lx-office-erp
-
-#MD5 Summe bilden:
-find usr/ -name "*" -type f -exec md5sum {} \; > DEBIAN/md5sum
-find var/ -name "*" -type f -exec md5sum {} \; >> DEBIAN/md5sum
-find etc/ -name "*" -type f -exec md5sum {} \; >> DEBIAN/md5sum
-
-#Größe feststellen:
-SIZE=`du -scb . | tail -n 1 | cut -f1`
-
-#Controlfile updaten:
-sed --in-place --expression "s/Installed-Size: 0/Installed-Size: $SIZE/g" DEBIAN/control
-sed --in-place --expression "s/Version: 0/Version: $VER-$NR/g" DEBIAN/control
-#Revisionsnummer evtl. von Hand eintragen
-
-#Paket bauen:
-cd ..
-dpkg-deb --build lx-office-erp_$VER-$NR$1_all
-
-echo "Done"
$form->{id} = "";
}
+ $query = '
+ SELECT accno
+ FROM chart
+ WHERE accno = ?';
+
+ my @values = ($form->{accno});
+
+ if ( $form->{id} ) {
+ $query .= ' AND NOT id = ?';
+ push(@values, $form->{id});
+ }
+
+ my ($accno) = selectrow_query($form, $dbh, $query, @values);
+
+ if ($accno) {
+ $form->error($::locale->text('Account number not unique!'));
+ }
+
+
if (!$form->{id} || $form->{id} eq "") {
$query = qq|SELECT nextval('id')|;
($form->{"id"}) = selectrow_query($form, $dbh, $query);
do_query($form, $dbh, $query, $form->{"id"}, $form->{"accno"});
}
- my @values;
+ @values = ();
if ($form->{id}) {
use SL::DBUtils;
use SL::IO;
use SL::MoreCommon;
-
+use SL::DB::Default;
use Data::Dumper;
use strict;
# add paid transactions
for my $i (1 .. $form->{paidaccounts}) {
- if ($form->{"acc_trans_id_$i"} && $payments_only && ($::lx_office_conf{features}->{payments_changeable} == 0)) {
+ if ($form->{"acc_trans_id_$i"} && $payments_only && (SL::DB::Default->get->payments_changeable == 0)) {
next;
}
IO->set_datepaid(table => 'ap', id => $form->{id}, dbh => $dbh);
# safety check datev export
- if ($::lx_office_conf{datev_check}{check_on_ap_transaction}) {
+ if ($::instance_conf->get_datev_check_on_ap_transaction) {
my $transdate = $::form->{transdate} ? DateTime->from_lxoffice($::form->{transdate}) : undef;
$transdate ||= DateTime->today;
$old_form = save_form();
# Delete all entries in acc_trans from prior payments.
- if ($::lx_office_conf{features}->{payments_changeable} != 0) {
+ if (SL::DB::Default->get->payments_changeable != 0) {
$self->_delete_payments($form, $dbh);
}
use SL::DBUtils;
use SL::IO;
use SL::MoreCommon;
+use SL::DB::Default;
use strict;
# add paid transactions
for my $i (1 .. $form->{paidaccounts}) {
- if ($form->{"acc_trans_id_$i"} && $payments_only && ($::lx_office_conf{features}->{payments_changeable} == 0)) {
+ if ($form->{"acc_trans_id_$i"} && $payments_only && (SL::DB::Default->get->payments_changeable == 0)) {
next;
}
IO->set_datepaid(table => 'ar', id => $form->{id}, dbh => $dbh);
# safety check datev export
- if ($::lx_office_conf{datev_check}{check_on_ar_transaction}) {
+ if ($::instance_conf->get_datev_check_on_ar_transaction) {
my $transdate = $::form->{transdate} ? DateTime->from_lxoffice($::form->{transdate}) : undef;
$transdate ||= DateTime->today;
$old_form = save_form();
# Delete all entries in acc_trans from prior payments.
- if ($::lx_office_conf{features}->{payments_changeable} != 0) {
+ if (SL::DB::Default->get->payments_changeable != 0) {
$self->_delete_payments($form, $dbh);
}
if (!$self->{authenticator}) {
my $locale = Locale->new('en');
- $self->mini_error($locale->text('No or an unknown authenticantion module specified in "config/lx_office.conf".'));
+ $self->mini_error($locale->text('No or an unknown authenticantion module specified in "config/kivitendo.conf".'));
}
my $cfg = $self->{DB_config};
if (!$cfg) {
my $locale = Locale->new('en');
- $self->mini_error($locale->text('config/lx_office.conf: Key "DB_config" is missing.'));
+ $self->mini_error($locale->text('config/kivitendo.conf: Key "DB_config" is missing.'));
}
if (!$cfg->{host} || !$cfg->{db} || !$cfg->{user}) {
my $locale = Locale->new('en');
- $self->mini_error($locale->text('config/lx_office.conf: Missing parameters in "authentication/database". Required parameters are "host", "db" and "user".'));
+ $self->mini_error($locale->text('config/kivitendo.conf: Missing parameters in "authentication/database". Required parameters are "host", "db" and "user".'));
}
$self->{authenticator}->verify_config();
# The XUL/XML backed menu has been removed.
$user_data{menustyle} = 'v3' if lc($user_data{menustyle} || '') eq 'xml';
+ # Set default language if selected language does not exist (anymore).
+ $user_data{countrycode} = $::lx_office_conf{system}->{language} unless $user_data{countrycode} && -d "locale/$user_data{countrycode}";
+
$sth->finish();
$main::lxdebug->leave_sub();
$self->{ldap} = Net::LDAP->new($cfg->{host}, 'port' => $port);
if (!$self->{ldap}) {
- $main::form->error($main::locale->text('The LDAP server "#1:#2" is unreachable. Please check config/lx_office.conf.', $cfg->{host}, $port));
+ $main::form->error($main::locale->text('The LDAP server "#1:#2" is unreachable. Please check config/kivitendo.conf.', $cfg->{host}, $port));
}
if ($cfg->{tls}) {
my $mesg = $self->{ldap}->start_tls('verify' => 'none');
if ($mesg->is_error()) {
- $main::form->error($main::locale->text('The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/lx_office.conf.'));
+ $main::form->error($main::locale->text('The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/kivitendo.conf.'));
}
}
if ($cfg->{bind_dn}) {
my $mesg = $self->{ldap}->bind($cfg->{bind_dn}, 'password' => $cfg->{bind_password});
if ($mesg->is_error()) {
- $main::form->error($main::locale->text('Binding to the LDAP server as "#1" failed. Please check config/lx_office.conf.', $cfg->{bind_dn}));
+ $main::form->error($main::locale->text('Binding to the LDAP server as "#1" failed. Please check config/kivitendo.conf.', $cfg->{bind_dn}));
}
}
my $cfg = $self->{auth}->{LDAP_config};
if (!$cfg) {
- $form->error($locale->text('config/lx_office.conf: Key "authentication/ldap" is missing.'));
+ $form->error($locale->text('config/kivitendo.conf: Key "authentication/ldap" is missing.'));
}
if (!$cfg->{host} || !$cfg->{attribute} || !$cfg->{base_dn}) {
- $form->error($locale->text('config/lx_office.conf: Missing parameters in "authentication/ldap". Required parameters are "host", "attribute" and "base_dn".'));
+ $form->error($locale->text('config/kivitendo.conf: Missing parameters in "authentication/ldap". Required parameters are "host", "attribute" and "base_dn".'));
}
$main::lxdebug->leave_sub();
use parent qw(Rose::Object);
+use IO::Dir;
use SL::DB::BackgroundJob;
+use SL::System::Process;
+
+sub get_known_job_classes {
+ tie my %dir_h, 'IO::Dir', File::Spec->catdir(File::Spec->splitdir(SL::System::Process->exe_dir), 'SL', 'BackgroundJob');
+ return sort map { s/\.pm$//; $_ } grep { m/\.pm$/ && !m/(?: ALL | Base) \.pm$/x } keys %dir_h;
+}
sub create_standard_job {
my $self_or_class = shift;
$self->config($::lx_office_conf{self_test} || {});
$self->tester(Test::Builder->new);
+ $self->tester->reset; # stupid Test::Builder mplementation uses class variables
$self->aggreg(TAP::Parser::Aggregator->new);
$self->modules(split /\s+/, $self->config->{modules});
$project = qq| AND ac.project_id = ? |;
@project_values = (conv_i($form->{project_id}));
}
- my $acc_cash_where = "";
- my $ar_cash_where = "";
- my $ap_cash_where = "";
-
-
- if ($form->{method} eq "cash") {
- $where = qq| (ac.trans_id IN (SELECT id FROM ar WHERE datepaid>= ? AND datepaid<= ? UNION SELECT id FROM ap WHERE datepaid>= ? AND datepaid<= ? UNION SELECT id FROM gl WHERE transdate>= ? AND transdate<= ?)) |;
- @where_values = ();
- push(@where_values, conv_date($form->{fromdate}));
- push(@where_values, conv_date($form->{todate}));
- push(@where_values, conv_date($form->{fromdate}));
- push(@where_values, conv_date($form->{todate}));
- push(@where_values, conv_date($form->{fromdate}));
- push(@where_values, conv_date($form->{todate}));
- }
-
if ($form->{accno}) {
my @columns = qw(cp_title cp_givenname cp_name cp_email cp_phone1 cp_phone2 cp_abteilung cp_fax
cp_mobile1 cp_mobile2 cp_satphone cp_satfax cp_project cp_privatphone cp_privatemail cp_birthday cp_gender
cp_street cp_zipcode cp_city);
- my @values = map { $_ eq 'cp_gender' ? ($form->{$_} eq 'f' ? 'f' : 'm') : $form->{$_} } @columns;
+ my @values = map(
+ {
+ if ( $_ eq 'cp_gender' ) {
+ $form->{$_} eq 'f' ? 'f' : 'm';
+ } elsif ( $_ eq 'cp_birthday' && $form->{cp_birthday} eq '' ) {
+ undef;
+ } else {
+ $form->{$_};
+ }
+ }
+ @columns
+ );
my ($query, $cp_id);
if ($form->{cp_id}) {
my $dbh = $form->dbconnect($myconfig);
my $cv = $form->{db} eq "customer" ? "customer" : "vendor";
+ my $join_records = $form->{l_invnumber} || $form->{l_ordnumber} || $form->{l_quonumber};
my $where = "1 = 1";
my @values;
$form->{sort} = $sortorder;
my $sortdir = !defined $form->{sortdir} ? 'ASC' : $form->{sortdir} ? 'ASC' : 'DESC';
- if ($sortorder !~ /(business|id)/ && 1 >= scalar grep { $form->{$_} } qw(l_ordnumber l_quonumber l_invnumber )) {
+ if ($sortorder !~ /(business|id)/ && !$join_records) {
$sortorder = "lower($sortorder) ${sortdir}";
} else {
$sortorder .= " ${sortdir}";
my $query =
qq|SELECT ct.*, b.description AS business | .
+ (qq|, NULL AS invnumber, NULL AS ordnumber, NULL AS quonumber, NULL AS invid, NULL AS module, NULL AS formtype, NULL AS closed | x!! $join_records) .
qq|FROM $cv ct | .
qq|LEFT JOIN business b ON (ct.business_id = b.id) | .
qq|WHERE $where|;
my @saved_values = @values;
# redo for invoices, orders and quotations
- if ($form->{l_invnumber} || $form->{l_ordnumber} || $form->{l_quonumber}) {
- my ($ar, $union, $module);
- $query = "";
+ if ($join_records) {
+ my $union = "UNION";
if ($form->{l_invnumber}) {
my $ar = $cv eq 'customer' ? 'ar' : 'ap';
my $module = $ar eq 'ar' ? 'is' : 'ir';
-
- $query =
+ push(@values, @saved_values);
+ $query .=
+ qq| UNION | .
qq|SELECT ct.*, b.description AS business, | .
qq| a.invnumber, a.ordnumber, a.quonumber, a.id AS invid, | .
qq| '$module' AS module, 'invoice' AS formtype, | .
qq|JOIN $ar a ON (a.${cv}_id = ct.id) | .
qq|LEFT JOIN business b ON (ct.business_id = b.id) | .
qq|WHERE $where AND (a.invoice = '1')|;
-
- $union = qq|UNION|;
}
if ( $form->{l_ordnumber} ) {
- if ($union eq "UNION") {
- push(@values, @saved_values);
- }
+ push(@values, @saved_values);
$query .=
- qq| $union | .
+ qq| UNION | .
qq|SELECT ct.*, b.description AS business,| .
qq| ' ' AS invnumber, o.ordnumber, o.quonumber, o.id AS invid, | .
qq| 'oe' AS module, 'order' AS formtype, o.closed | .
qq|JOIN oe o ON (o.${cv}_id = ct.id) | .
qq|LEFT JOIN business b ON (ct.business_id = b.id) | .
qq|WHERE $where AND (o.quotation = '0')|;
-
- $union = qq|UNION|;
}
if ( $form->{l_quonumber} ) {
- if ($union eq "UNION") {
- push(@values, @saved_values);
- }
+ push(@values, @saved_values);
$query .=
- qq| $union | .
+ qq| UNION | .
qq|SELECT ct.*, b.description AS business, | .
qq| ' ' AS invnumber, o.ordnumber, o.quonumber, o.id AS invid, | .
qq| 'oe' AS module, 'quotation' AS formtype, o.closed | .
use parent qw(SL::Controller::Base);
+use SL::BackgroundJob::Base;
use SL::Controller::Helper::GetModels;
use SL::Controller::Helper::Paginated;
use SL::Controller::Helper::Sorted;
sub action_new {
my ($self) = @_;
- $self->background_job(SL::DB::BackgroundJob->new(cron_spec => '* * * * *'));
- $self->render('background_job/form', title => $::locale->text('Create a new background job'));
+ $self->background_job(SL::DB::BackgroundJob->new(cron_spec => '* * * * *', package_name => 'Test'));
+ $self->render('background_job/form',
+ title => $::locale->text('Create a new background job'),
+ JOB_CLASSES => [ SL::BackgroundJob::Base->get_known_job_classes ]);
}
sub action_edit {
my ($self) = @_;
- $self->render('background_job/form', title => $::locale->text('Edit background job'));
+
+ $self->render('background_job/form',
+ title => $::locale->text('Edit background job'),
+ JOB_CLASSES => [ SL::BackgroundJob::Base->get_known_job_classes ]);
}
sub action_create {
=item * C<LOCALE> -- C<$::locale>
-=item * C<LXCONFIG> -- all parameters from C<config/lx_office.conf>
+=item * C<LXCONFIG> -- all parameters from C<config/kivitendo.conf>
with the same name they appear in the file (first level is the
section, second the actual variable, e.g. C<system.dbcharset>,
C<features.webdav> etc)
--- /dev/null
+package SL::Controller::ClientConfig;
+
+use strict;
+use parent qw(SL::Controller::Base);
+
+use SL::DB::Default;
+use SL::Helper::Flash;
+
+__PACKAGE__->run_before('check_auth');
+
+
+sub action_edit {
+ my ($self, %params) = @_;
+
+ $self->{posting_options} = [ { title => $::locale->text("never"), value => 0 },
+ { title => $::locale->text("every time"), value => 1 },
+ { title => $::locale->text("on the same day"), value => 2 }, ];
+ $self->{payment_options} = [ { title => $::locale->text("never"), value => 0 },
+ { title => $::locale->text("every time"), value => 1 },
+ { title => $::locale->text("on the same day"), value => 2 }, ];
+ $self->{accounting_options} = [ { title => $::locale->text("Accrual"), value => "accrual" },
+ { title => $::locale->text("cash"), value => "cash" }, ];
+ $self->{inventory_options} = [ { title => $::locale->text("perpetual"), value => "perpetual" },
+ { title => $::locale->text("periodic"), value => "periodic" }, ];
+ $self->{profit_options} = [ { title => $::locale->text("balance"), value => "balance" },
+ { title => $::locale->text("income"), value => "income" }, ];
+
+ map { $self->{$_} = SL::DB::Default->get->$_ } qw(is_changeable ir_changeable ar_changeable ap_changeable gl_changeable);
+
+ $self->{payments_changeable} = SL::DB::Default->get->payments_changeable;
+
+ map { $self->{$_} = SL::DB::Default->get->$_ } qw(is_show_mark_as_paid ir_show_mark_as_paid ar_show_mark_as_paid ap_show_mark_as_paid);
+
+ map { $self->{$_} = SL::DB::Default->get->$_ } qw(accounting_method inventory_system profit_determination);
+
+ $self->{show_bestbefore} = SL::DB::Default->get->show_bestbefore;
+
+ map { $self->{$_} = SL::DB::Default->get->$_ } qw(datev_check_on_sales_invoice datev_check_on_purchase_invoice datev_check_on_ar_transaction datev_check_on_ap_transaction datev_check_on_gl_transaction);
+ # datev check: not implemented yet:
+ #check_on_cash_and_receipt = 0
+ #check_on_dunning = 0
+ #check_on_sepa_import = 0
+
+ map { $self->{$_} = SL::DB::Default->get->$_ } qw(sales_order_show_delete purchase_order_show_delete sales_delivery_order_show_delete purchase_delivery_order_show_delete);
+
+ $self->render('client_config/form', title => $::locale->text('Client Configuration'));
+}
+
+
+sub action_save {
+ my ($self, %params) = @_;
+
+ map { SL::DB::Default->get->update_attributes($_ => $::form->{$_}); } qw(is_changeable ir_changeable ar_changeable ap_changeable gl_changeable);
+
+ SL::DB::Default->get->update_attributes('payments_changeable' => $::form->{payments_changeable});
+
+ map { SL::DB::Default->get->update_attributes($_ => $::form->{$_}); } qw(is_show_mark_as_paid ir_show_mark_as_paid ar_show_mark_as_paid ap_show_mark_as_paid);
+
+ map { SL::DB::Default->get->update_attributes($_ => $::form->{$_}); } qw(accounting_method inventory_system profit_determination);
+
+ SL::DB::Default->get->update_attributes('show_bestbefore' => $::form->{show_bestbefore});
+
+ map { SL::DB::Default->get->update_attributes($_ => $::form->{$_}); } qw(datev_check_on_sales_invoice datev_check_on_purchase_invoice datev_check_on_ar_transaction datev_check_on_ap_transaction datev_check_on_gl_transaction);
+
+ map { SL::DB::Default->get->update_attributes($_ => $::form->{$_}); } qw(sales_order_show_delete purchase_order_show_delete sales_delivery_order_show_delete purchase_delivery_order_show_delete);
+
+ flash_later('info', $::locale->text('Client Configuration saved!'));
+
+ $self->redirect_to(action => 'edit');
+}
+
+
+#################### private stuff ##########################
+
+sub check_auth {
+ $::auth->assert('admin');
+}
+
+1;
profile => $profile,
ignore_unknown_columns => 1,
strict_profile => 1,
+ case_insensitive_header => 1,
map { ( $_ => $self->controller->profile->get($_) ) } qw(sep_char escape_char quote_char),
));
$profile{$col} = $name;
}
+ if ($self->can('all_cvar_configs')) {
+ for (@{ $self->all_cvar_configs }) {
+ $profile{ 'cvar_' . $_->name } = '';
+ }
+ }
+
$self->profile(\%profile);
}
my $found_any;
my @makemodels;
- foreach my $idx (map { substr $_, 5 } grep { m/^make_\d+$/ && $entry->{raw_data}->{$_} } keys %{ $entry->{raw_data} }) {
+ foreach my $idx (sort map { substr $_, 5 } grep { m/^make_\d+$/ && $entry->{raw_data}->{$_} } keys %{ $entry->{raw_data} }) {
my $vendor = $entry->{raw_data}->{"make_${idx}"};
$vendor = $self->vc_by->{id}-> { $vendor }
|| $self->vc_by->{number}->{vendors}->{ $vendor }
{ name => 'image', description => $::locale->text('Image') },
{ name => 'lastcost', description => $::locale->text('Last Cost') },
{ name => 'listprice', description => $::locale->text('List Price') },
- { name => 'make_X', description => $::locale->text('Make (with X being a number)') },
+ { name => 'make_X', description => $::locale->text('Make (vendor\'s database ID, number or name; with X being a number)') . ' [1]' },
{ name => 'microfiche', description => $::locale->text('Microfiche') },
- { name => 'model_X', description => $::locale->text('Model (with X being a number)') },
- { name => 'lastcost_X', description => $::locale->text('Lastcost (with X being a number)') },
+ { name => 'model_X', description => $::locale->text('Model (with X being a number)') . ' [1]' },
+ { name => 'lastcost_X', description => $::locale->text('Lastcost (with X being a number)') . ' [1]' },
{ name => 'not_discountable', description => $::locale->text('Not Discountable') },
{ name => 'notes', description => $::locale->text('Notes') },
{ name => 'obsolete', description => $::locale->text('Obsolete') },
rl.from_table ='oe' AND
rl.to_table = 'delivery_orders'
)
+
+ UNION ALL
+
+ -- 5. In case someone deleted a line of the delivery_order there will be a record_link (4 fails)
+ -- but there won't be a delivery_order_items to find (3 fails too). Search for orphaned orderitems this way
+ SELECT oi.id FROM orderitems AS oi, oe, record_links AS rl
+ WHERE
+ rl.from_table = 'oe' AND
+ rl.to_table = 'delivery_orders' AND
+
+ oi.trans_id = rl.from_id AND
+ oi.parts_id NOT IN (
+ SELECT doi.parts_id FROM delivery_order_items AS doi WHERE doi.delivery_order_id = rl.to_id
+ ) AND
+
+ oe.id = oi.trans_id AND
+
+ oe.customer_id IS NOT NULL AND
+ (oe.quotation = 'f' OR oe.quotation IS NULL) AND
+ NOT oe.closed
" ],
)
];
my $count = $ref->{amount};
my $firstrun = 1;
+
+ # if the amount of a booking in a group is smaller than 0.02, any tax
+ # amounts will likely be smaller than 1 cent, so go into subcent mode
my $subcent = abs($count) < 0.02;
+ # records from acc_trans are ordered by trans_id and acc_trans_id
+ # first check for unbalanced ledger inside one trans_id
+ # there may be several groups inside a trans_id, e.g. the original booking and the payment
+ # each group individually should be exactly balanced and each group
+ # individually needs its own datev lines
+
+ # keep fetching new acc_trans lines until the end of a balanced group is reached
while (abs($count) > 0.01 || $firstrun || ($subcent && abs($count) > 0.005)) {
my $ref2 = $sth->fetchrow_hashref("NAME_lc");
last unless ($ref2);
+ # check if trans_id of current acc_trans line is still the same as the
+ # trans_id of the first line in group
+
if ($ref2->{trans_id} != $trans->[0]->{trans_id}) {
$self->add_error("Unbalanced ledger! old trans_id " . $trans->[0]->{trans_id} . " new trans_id " . $ref2->{trans_id} . " count $count");
return;
next;
}
+ # determine at which array position the reference value (called absumsatz) is
+ # and which amount it has
+
for my $j (0 .. (scalar(@{$trans}) - 1)) {
+
+ # Three cases:
+ # 1: gl transaction (Dialogbuchung), invoice is false, no double split booking allowed
+
+ # 2: sales or vendor invoice (Verkaufs- und Einkaufsrechnung): invoice is
+ # true, instead of absumsatz use link AR/AP (there should only be one
+ # entry)
+
+ # 3. AR/AP transaction (Kreditoren- und Debitorenbuchung): invoice is false,
+ # instead of absumsatz use link AR/AP (there should only be one, so jump
+ # out of search as soon as you find it )
+
+ # case 1 and 2
# for gl-bookings no split is allowed and there is no AR/AP account, so we always use the maximum value as a reference
# for ap/ar bookings we can always search for AR/AP in link and use that
if ( ( not $trans->[$j]->{'invoice'} and abs($trans->[$j]->{'amount'}) > abs($absumsatz) )
$absumsatz = $trans->[$j]->{'amount'};
$notsplitindex = $j;
}
+
+ # case 3
+ # Problem: we can't distinguish between AR and AP and normal invoices via boolean "invoice"
+ # for AR and AP transaction exit the loop as soon as an AR or AP account is found
+ # there must be only one AR or AP chart in the booking
+ if ( $trans->[$j]->{'link'} eq 'AR' or $trans->[$j]->{'link'} eq 'AP') {
+ $notsplitindex = $j; # position in booking with highest amount
+ $absumsatz = $trans->[$j]->{'amount'};
+ last;
+ };
}
my $ml = ($trans->[0]->{'umsatz'} > 0) ? 1 : -1;
my $rounding_error = 0;
my @taxed;
+ # go through each line and determine if it is a tax booking or not
+ # skip all tax lines and notsplitindex line
+ # push all other accounts (e.g. income or expense) with corresponding taxkey
+
for my $j (0 .. (scalar(@{$trans}) - 1)) {
if ( ($j != $notsplitindex)
&& !$trans->[$j]->{is_tax}
=item 6. Items in C<invoice> are updated according to their allocation
status (regarding for costs of goold sold). Will only be done if
-Lx-Office is not configured to use Einnahmenüberschussrechnungen
-(see config/lx_office.conf, section "system", variable "eur").
+kivitendo is not configured to use Einnahmenüberschussrechnungen.
=item 7. The invoice and its items are saved.
cp_project => { type => 'text' },
cp_privatphone => { type => 'text' },
cp_privatemail => { type => 'text' },
- cp_birthday => { type => 'text' },
cp_abteilung => { type => 'text' },
cp_gender => { type => 'character', length => 1 },
+ cp_street => { type => 'text' },
+ cp_zipcode => { type => 'text' },
+ cp_city => { type => 'text' },
+ cp_birthday => { type => 'date' },
],
primary_key_columns => [ 'cp_id' ],
iban => { type => 'varchar', length => 100 },
bic => { type => 'varchar', length => 100 },
direct_debit => { type => 'boolean', default => 'false' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
taxincluded_checked => { type => 'boolean' },
],
table => 'defaults',
columns => [
- inventory_accno_id => { type => 'integer' },
- income_accno_id => { type => 'integer' },
- expense_accno_id => { type => 'integer' },
- fxgain_accno_id => { type => 'integer' },
- fxloss_accno_id => { type => 'integer' },
- invnumber => { type => 'text' },
- sonumber => { type => 'text' },
- weightunit => { type => 'varchar', length => 5 },
- businessnumber => { type => 'text' },
- version => { type => 'varchar', length => 8 },
- curr => { type => 'text' },
- closedto => { type => 'date' },
- revtrans => { type => 'boolean', default => 'false' },
- ponumber => { type => 'text' },
- sqnumber => { type => 'text' },
- rfqnumber => { type => 'text' },
- customernumber => { type => 'text' },
- vendornumber => { type => 'text' },
- audittrail => { type => 'boolean', default => 'false' },
- articlenumber => { type => 'text' },
- servicenumber => { type => 'text' },
- coa => { type => 'text' },
- itime => { type => 'timestamp', default => 'now()' },
- mtime => { type => 'timestamp' },
- rmanumber => { type => 'text' },
- cnnumber => { type => 'text' },
- dunning_ar_amount_fee => { type => 'integer' },
- dunning_ar_amount_interest => { type => 'integer' },
- dunning_ar => { type => 'integer' },
- pdonumber => { type => 'text' },
- sdonumber => { type => 'text' },
- ar_paid_accno_id => { type => 'integer' },
- id => { type => 'serial', not_null => 1 },
- accounting_method => { type => 'text' },
- inventory_system => { type => 'text' },
- profit_determination => { type => 'text' },
- language_id => { type => 'integer' },
+ inventory_accno_id => { type => 'integer' },
+ income_accno_id => { type => 'integer' },
+ expense_accno_id => { type => 'integer' },
+ fxgain_accno_id => { type => 'integer' },
+ fxloss_accno_id => { type => 'integer' },
+ invnumber => { type => 'text' },
+ sonumber => { type => 'text' },
+ weightunit => { type => 'varchar', length => 5 },
+ businessnumber => { type => 'text' },
+ version => { type => 'varchar', length => 8 },
+ curr => { type => 'text' },
+ closedto => { type => 'date' },
+ revtrans => { type => 'boolean', default => 'false' },
+ ponumber => { type => 'text' },
+ sqnumber => { type => 'text' },
+ rfqnumber => { type => 'text' },
+ customernumber => { type => 'text' },
+ vendornumber => { type => 'text' },
+ audittrail => { type => 'boolean', default => 'false' },
+ articlenumber => { type => 'text' },
+ servicenumber => { type => 'text' },
+ coa => { type => 'text' },
+ itime => { type => 'timestamp', default => 'now()' },
+ mtime => { type => 'timestamp' },
+ rmanumber => { type => 'text' },
+ cnnumber => { type => 'text' },
+ accounting_method => { type => 'text' },
+ inventory_system => { type => 'text' },
+ profit_determination => { type => 'text' },
+ dunning_ar_amount_fee => { type => 'integer' },
+ dunning_ar_amount_interest => { type => 'integer' },
+ dunning_ar => { type => 'integer' },
+ pdonumber => { type => 'text' },
+ sdonumber => { type => 'text' },
+ ar_paid_accno_id => { type => 'integer' },
+ id => { type => 'serial', not_null => 1 },
+ language_id => { type => 'integer' },
+ payments_changeable => { type => 'integer', default => '0', not_null => 1 },
+ show_bestbefore => { type => 'boolean', default => 'false' },
+ datev_check_on_sales_invoice => { type => 'boolean', default => 'true' },
+ datev_check_on_purchase_invoice => { type => 'boolean', default => 'true' },
+ datev_check_on_ar_transaction => { type => 'boolean', default => 'true' },
+ datev_check_on_ap_transaction => { type => 'boolean', default => 'true' },
+ datev_check_on_gl_transaction => { type => 'boolean', default => 'true' },
+ is_changeable => { type => 'integer', default => 2, not_null => 1 },
+ ir_changeable => { type => 'integer', default => 2, not_null => 1 },
+ ar_changeable => { type => 'integer', default => 2, not_null => 1 },
+ ap_changeable => { type => 'integer', default => 2, not_null => 1 },
+ gl_changeable => { type => 'integer', default => 2, not_null => 1 },
+ is_show_mark_as_paid => { type => 'boolean', default => 'true' },
+ ir_show_mark_as_paid => { type => 'boolean', default => 'true' },
+ ar_show_mark_as_paid => { type => 'boolean', default => 'true' },
+ ap_show_mark_as_paid => { type => 'boolean', default => 'true' },
+ sales_order_show_delete => { type => 'boolean', default => 'true' },
+ purchase_order_show_delete => { type => 'boolean', default => 'true' },
+ sales_delivery_order_show_delete => { type => 'boolean', default => 'true' },
+ purchase_delivery_order_show_delete => { type => 'boolean', default => 'true' },
],
primary_key_columns => [ 'id' ],
taxzone_id => { type => 'integer' },
taxincluded => { type => 'boolean' },
terms => { type => 'integer' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
],
primary_key_columns => [ 'id' ],
table => 'exchangerate',
columns => [
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
transdate => { type => 'date' },
buy => { type => 'numeric', precision => 5, scale => 15 },
sell => { type => 'numeric', precision => 5, scale => 15 },
shippingpoint => { type => 'text' },
terms => { type => 'integer', default => '0' },
notes => { type => 'text' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
ordnumber => { type => 'text' },
employee_id => { type => 'integer' },
quonumber => { type => 'text' },
duedate => { type => 'date' },
invoice => { type => 'boolean', default => 'false' },
ordnumber => { type => 'text' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
notes => { type => 'text' },
employee_id => { type => 'integer' },
quonumber => { type => 'text' },
taxincluded => { type => 'boolean' },
shippingpoint => { type => 'text' },
notes => { type => 'text' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
employee_id => { type => 'integer' },
closed => { type => 'boolean', default => 'false' },
quotation => { type => 'boolean', default => 'false' },
iban => { type => 'varchar', length => 100 },
bic => { type => 'varchar', length => 100 },
direct_debit => { type => 'boolean', default => 'false' },
- curr => { type => 'character', length => 3 },
+ curr => { type => 'text' },
],
primary_key_columns => [ 'id' ],
$params{path_suffix} ||= '';
$params{schema} ||= '';
+ $params{path} = "sql/" . $params{dbdriver} . "-upgrade2" . $params{path_suffix};
map { $self->{$_} = $params{$_} } keys %params;
return $self;
}
+sub path {
+ $_[0]{path};
+}
+
sub parse_dbupdate_controls {
$::lxdebug->enter_sub();
local *IN;
my %all_controls;
- my $path = "sql/" . $self->{dbdriver} . "-upgrade2" . $self->{path_suffix};
+ my $path = $self->path;
foreach my $file_name (<$path/*.sql>, <$path/*.pl>) {
next unless (open(IN, $file_name));
pop(@quote_chars);
} elsif (length $quote_chars[-1] > 1
&& substr($_, $i, length $quote_chars[-1]) eq $quote_chars[-1]) {
- $i += length $quote_chars[-1] - 1;
+ $i += length($quote_chars[-1]) - 1;
$char = $quote_chars[-1];
pop(@quote_chars);
}
my $template = SL::Template::create(type => 'PlainText', form => $form, myconfig => $myconfig);
my $mail = Mailer->new();
+ $mail->{charset} = $::lx_office_conf{system}->{dbcharset} || Common::DEFAULT_CHARSET;
$mail->{from} = $myconfig->{email};
$mail->{to} = $ref->{recipient};
$mail->{subject} = $template->parse_block($ref->{email_subject});
$additional_params->{"conf_latex_templates"} = $::lx_office_conf{print_templates}->{latex};
$additional_params->{"conf_opendocument_templates"} = $::lx_office_conf{print_templates}->{opendocument};
$additional_params->{"conf_vertreter"} = $::lx_office_conf{features}->{vertreter};
- $additional_params->{"conf_show_best_before"} = $::lx_office_conf{features}->{show_best_before};
$additional_params->{"conf_parts_image_css"} = $::lx_office_conf{features}->{parts_image_css};
$additional_params->{"conf_parts_listing_images"} = $::lx_office_conf{features}->{parts_listing_images};
$additional_params->{"conf_parts_show_image"} = $::lx_office_conf{features}->{parts_show_image};
- $additional_params->{"conf_payments_changeable"} = $::lx_office_conf{features}->{payments_changeable};
$additional_params->{"INSTANCE_CONF"} = $::instance_conf;
if (my $debug_options = $::lx_office_conf{debug}{options}) {
UNLINK => ($::lx_office_conf{debug} && $::lx_office_conf{debug}->{keep_temp_files})? 0 : 1,
);
close $temp_fh;
+ (undef, undef, $self->{template_meta}{tmpfile}) = File::Spec->splitpath( $self->{tmpfile} );
if ($template->uses_temp_file() || $self->{media} eq 'email') {
$out = $self->{OUT};
my ($self, $dbh, $curr, $transdate, $fld) = @_;
my ($query);
- unless ($transdate) {
+ unless ($transdate && $curr) {
$main::lxdebug->leave_sub();
return 1;
}
}
# safety check datev export
- if ($::lx_office_conf{datev_check}{check_on_gl_transaction}) {
+ if ($::instance_conf->get_datev_check_on_gl_transaction) {
my $transdate = $::form->{transdate} ? DateTime->from_lxoffice($::form->{transdate}) : undef;
$transdate ||= DateTime->today;
use Rose::Object::MakeMethods::Generic scalar => [ qw(
file encoding sep_char quote_char escape_char header profile class
numberformat dateformat ignore_unknown_columns strict_profile _io _csv
- _objects _parsed _data _errors
+ _objects _parsed _data _errors all_cvar_configs case_insensitive_header
) ];
use SL::Helper::Csv::Dispatcher;
dateformat => 0,
ignore_unknown_columns => 0,
strict_profile => 0,
+ case_insensitive_header => 0,
});
my $self = bless {}, $class;
}
return unless $header;
- return $self->header([ map { lc } @$header ]);
+
+ # Special case: human stupidity
+ # people insist that case sensitivity doesn't exist and try to enter all
+ # sorts of stuff. at this point we've got a profile (with keys that represent
+ # valid methods), and a header full of strings. if two of them match, the user
+ # mopst likely meant that field, so rewrite the header
+ if ($self->case_insensitive_header) {
+ die 'case_insensitive_header is only possible with profile' unless $self->profile;
+ my @names = (
+ keys %{ $self->profile || {} },
+ );
+ for my $name (@names) {
+ for my $i (0..$#$header) {
+ $header->[$i] = $name if lc $header->[$i] eq lc $name;
+ }
+ }
+ }
+
+ return $self->header($header);
}
sub _parse_data {
will have to do that for yourself. Since you provided the profile, it is
assumed you know what to do in this case.
+If no profile is given, any header field found will be taken as is.
+
+If the path in a profile entry is empty, the field will be subjected to
+C<strict_profile> and C<case_insensitive_header> checking, will be parsed into
+C<get_data>, but will not be attempted to be dispatched into objects.
+
=item C<class>
If present, the line will be handed to the new sub of this class,
If set, the import will ignore unkown header columns. Useful for lazy imports,
but deactivated by default.
+=item C<case_insensitive_header>
+
+If set, header columns will be matched against profile entries case
+insensitive, and on match the profile name will be taken.
+
+Only works if a profile is given, will die otherwise.
+
+If both C<case_insensitive_header> and C<strict_profile> is set, matched header
+columns will be accepted.
+
=item C<strict_profile>
If set, all columns to be parsed must be specified in C<profile>. Every header
field not listed there will be treated like an unknown column.
+If both C<case_insensitive_header> and C<strict_profile> is set, matched header
+columns will be accepted.
+
=back
=head1 ERROR HANDLING
$self->unknown_column($col, undef);
}
} else {
- push @specs, $self->make_spec($col, $profile->{$col} || $col);
+ if (exists $profile->{$col}) {
+ push @specs, $self->make_spec($col, $profile->{$col});
+ } else {
+ push @specs, $self->make_spec($col, $col);
+ }
}
}
my ($self, $col, $path) = @_;
my $spec = { key => $col, steps => [] };
+
+ return unless $path;
+
my $cur_class = $self->_csv->class;
return unless $cur_class;
$joins_needed{makemodel} = 1 if grep { $form->{$_} || $form->{"l_$_"} } @makemodel_filters;
$joins_needed{mv} = 1 if $joins_needed{makemodel};
$joins_needed{cv} = 1 if $bsooqr;
- $joins_needed{apoe} = 1 if $joins_needed{cv} || grep { $form->{$_} || $form->{"l_$_"} } @apoe_filters;
+ $joins_needed{apoe} = 1 if $joins_needed{project} || $joins_needed{cv} || grep { $form->{$_} || $form->{"l_$_"} } @apoe_filters;
$joins_needed{invoice_oi} = 1 if $joins_needed{project} || $joins_needed{apoe} || grep { $form->{$_} || $form->{"l_$_"} } @invoice_oi_filters;
# special case for description search.
} else {
$transdate = $form->{deliverydate};
}
+ } elsif (($form->{type} eq "credit_note") and $form->{deliverydate}) {
+ # if credit_note has a deliverydate, use this instead of invdate
+ # useful for credit_notes of invoices from an old period with different tax
+ # if there is no deliverydate then invdate is used, old default (see next elsif)
+ $transdate = $form->{deliverydate};
} elsif (($form->{type} eq "credit_note") || ($form->{script} eq 'ir.pl')) {
$transdate = $form->{invdate};
} else {
use SL::GenericTranslations;
use SL::IO;
use SL::MoreCommon;
+use SL::DB::Default;
use List::Util qw(min);
use strict;
for my $i (1 .. $form->{paidaccounts}) {
if ($form->{"acc_trans_id_$i"}
&& $payments_only
- && ($::lx_office_conf{features}->{payments_changeable} == 0)) {
+ && (SL::DB::Default->get->payments_changeable == 0)) {
next;
}
'table' => 'ap',);
# safety check datev export
- if ($::lx_office_conf{datev_check}{check_on_purchase_invoice}) {
+ if ($::instance_conf->get_datev_check_on_purchase_invoice) {
my $transdate = $::form->{invdate} ? DateTime->from_lxoffice($::form->{invdate}) : undef;
$transdate ||= DateTime->today;
$old_form = save_form();
# Delete all entries in acc_trans from prior payments.
- if ($::lx_office_conf{features}->{payments_changeable} != 0) {
+ if (SL::DB::Default->get->payments_changeable != 0) {
$self->_delete_payments($form, $dbh);
}
use SL::IC;
use SL::IO;
use SL::TransNumber;
+use SL::DB::Default;
use Data::Dumper;
use strict;
my ($dec) = ($sellprice =~ /\.(\d+)/);
my $decimalplaces = max 2, length($dec);
- my $parsed_discount = $form->parse_amount($myconfig, $form->{"discount_$i"});
- my $linetotal_exact = $form->{"qty_$i"} * $sellprice * (100 - $parsed_discount) / 100 / $price_factor->{factor};
- my $linetotal = $form->round_amount($linetotal_exact, 2);
- my $discount = $form->round_amount($form->{"qty_$i"} * $sellprice * $parsed_discount / 100 / $price_factor->{factor} - ($linetotal - $linetotal_exact),
- $decimalplaces);
- my $nodiscount_linetotal = $form->round_amount($form->{"qty_$i"} * $sellprice / $price_factor->{factor}, 2);
+ my $parsed_discount = $form->parse_amount($myconfig, $form->{"discount_$i"});
+
+ my $linetotal_exact = $form->{"qty_$i"} * $sellprice * (100 - $parsed_discount) / 100 / $price_factor->{factor};
+ my $linetotal = $form->round_amount($linetotal_exact, 2);
+
+ my $nodiscount_exact_linetotal = $form->{"qty_$i"} * $sellprice / $price_factor->{factor};
+ my $nodiscount_linetotal = $form->round_amount($nodiscount_exact_linetotal,2);
+
+ my $discount = $nodiscount_linetotal - $linetotal; # is always rounded because $nodiscount_linetotal and $linetotal are rounded
+
+ my $discount_round_error = $discount + ($linetotal_exact - $nodiscount_exact_linetotal); # not used
+
$form->{"netprice_$i"} = $form->round_amount($form->{"qty_$i"} ? ($linetotal / $form->{"qty_$i"}) : 0, 2);
push @{ $form->{TEMPLATE_ARRAYS}->{netprice} }, ($form->{"netprice_$i"} != 0) ? $form->format_amount($myconfig, $form->{"netprice_$i"}, $decimalplaces) : '';
if ($form->{"acc_trans_id_$i"}
&& $payments_only
- && ($::lx_office_conf{features}->{payments_changeable} == 0)) {
+ && (SL::DB::Default->get->payments_changeable == 0)) {
next;
}
'table' => 'ar',);
# safety check datev export
- if ($::lx_office_conf{datev_check}{check_on_sales_invoice}) {
+ if ($::instance_conf->get_datev_check_on_sales_invoice) {
my $transdate = $::form->{invdate} ? DateTime->from_lxoffice($::form->{invdate}) : undef;
$transdate ||= DateTime->today;
$old_form = save_form();
# Delete all entries in acc_trans from prior payments.
- if ($::lx_office_conf{features}->{payments_changeable} != 0) {
+ if (SL::DB::Default->get->payments_changeable != 0) {
$self->_delete_payments($form, $dbh);
}
my $pricegroup_old = $form->{"pricegroup_old_$i"};
- # sellprice has format 13,0000 or 0,00000, can't check for 0 numerically
+ # sellprice has format 13,0000 or 0,00000, can't check for 0 numerically
my $sellprice = $form->{"sellprice_$i"};
my $pricegroup_id = $form->{"pricegroup_id_$i"};
$form->{"new_pricegroup_$i"} = $selectedpricegroup_id;
$pkr->{selected} = ' selected'; # unless $form->{selected};
# no customer pricesgroup set
- if ($pkr->{price_unfmt} == $pkr->{default_sellprice}) {
+ if ($pkr->{price_unfmt} == $pkr->{default_sellprice} || $form->{'sellprice_'.$i} * 1 > 1) {
$pkr->{price} = $form->{"sellprice_$i"};
} else {
-# this sub should not set anything and only return. --sschoeling, 20090506
-# is this correct? put in again... -- grichardson 20110119
$form->{"sellprice_$i"} = $pkr->{price};
}
{ name => "DBI", version => '1.50', url => "http://search.cpan.org/~timb/", debian => 'libdbi-perl' },
{ name => "DBD::Pg", version => '1.49', url => "http://search.cpan.org/~dbdpg/", debian => 'libdbd-pg-perl' },
{ name => "Email::Address", url => "http://search.cpan.org/~rjbs/", debian => 'libemail-address-perl' },
+ { name => "Email::MIME", url => "http://search.cpan.org/~rjbs/", debian => 'libemail-mime-perl' },
{ name => "FCGI", version => '0.72', url => "http://search.cpan.org/~mstrout/", debian => 'libfcgi-perl' },
{ name => "JSON", url => "http://search.cpan.org/~makamaka", debian => 'libjson-perl' },
{ name => "List::MoreUtils", version => '0.21', url => "http://search.cpan.org/~vparseval/", debian => 'liblist-moreutils-perl' },
{ name => "Rose::DB::Object", url => "http://search.cpan.org/~jsiracusa/", debian => 'librose-db-object-perl' },
{ name => "String::ShellQuote", version => 1.01, url => "http://search.cpan.org/~rosch/", debian => 'libstring-shellquote-perl' },
{ name => "Sort::Naturally", url => "http://search.cpan.org/~sburke/", debian => 'libsort-naturally-perl' },
+ # Test::Harness is core, so no Debian packages. Test::Harness 3.00 was first packaged in 5.10.1
+ { name => "Test::Harness", version => '3.00', url => "http://search.cpan.org/~petdance/", },
{ name => "Template", version => '2.18', url => "http://search.cpan.org/~abw/", debian => 'libtemplate-perl' },
{ name => "Text::CSV_XS", version => '0.23', url => "http://search.cpan.org/~hmbrand/", debian => 'libtext-csv-xs-perl' },
{ name => "Text::Iconv", version => '1.2', url => "http://search.cpan.org/~mpiotr/", debian => 'libtext-iconv-perl' },
{ name => "Net::LDAP", url => "http://search.cpan.org/~gbarr/", debian => 'libnet-ldap-perl' },
# Net::SMTP is core since 5.7.3
{ name => "Net::SMTP::SSL", version => '1.01', url => "http://search.cpan.org/~cwest/", debian => 'libnet-smtp-ssl-perl' },
- { name => "Net::SMTP::TLS", version => '0.12', url => "http://search.cpan.org/~awestholm/", debian => 'libnet-smtp-tls-perl' },
+ { name => "Net::SSLGlue", version => '1.01', url => "http://search.cpan.org/~sullr/", debian => 'libnet-sslglue-perl' },
);
@developer_modules = (
return $self->{data}->{profit_determination};
}
+sub get_is_changeable {
+ my ($self) = @_;
+ return $self->{data}->{is_changeable};
+}
+
+sub get_ir_changeable {
+ my ($self) = @_;
+ return $self->{data}->{ir_changeable};
+}
+
+sub get_ar_changeable {
+ my ($self) = @_;
+ return $self->{data}->{ar_changeable};
+}
+
+sub get_ap_changeable {
+ my ($self) = @_;
+ return $self->{data}->{ap_changeable};
+}
+
+sub get_gl_changeable {
+ my ($self) = @_;
+ return $self->{data}->{gl_changeable};
+}
+
+sub get_datev_check_on_sales_invoice {
+ my ($self) = @_;
+ return $self->{data}->{datev_check_on_sales_invoice};
+}
+
+sub get_datev_check_on_purchase_invoice {
+ my ($self) = @_;
+ return $self->{data}->{datev_check_on_purchase_invoice};
+}
+
+sub get_datev_check_on_ar_transaction {
+ my ($self) = @_;
+ return $self->{data}->{datev_check_on_ar_transaction};
+}
+
+sub get_datev_check_on_ap_transaction {
+ my ($self) = @_;
+ return $self->{data}->{datev_check_on_ap_transaction};
+}
+
+sub get_datev_check_on_gl_transaction {
+ my ($self) = @_;
+ return $self->{data}->{datev_check_on_gl_transaction};
+}
+
+sub get_show_bestbefore {
+ my ($self) = @_;
+ return $self->{data}->{show_bestbefore};
+}
+
+sub get_is_show_mark_as_paid {
+ my ($self) = @_;
+ return $self->{data}->{is_show_mark_as_paid};
+}
+
+sub get_ir_show_mark_as_paid {
+ my ($self) = @_;
+ return $self->{data}->{ir_show_mark_as_paid};
+}
+
+sub get_ar_show_mark_as_paid {
+ my ($self) = @_;
+ return $self->{data}->{ar_show_mark_as_paid};
+}
+
+sub get_ap_show_mark_as_paid {
+ my ($self) = @_;
+ return $self->{data}->{ap_show_mark_as_paid};
+}
+
+sub get_sales_order_show_delete {
+ my ($self) = @_;
+ return $self->{data}->{sales_order_show_delete};
+}
+
+sub get_purchase_order_show_delete {
+ my ($self) = @_;
+ return $self->{data}->{purchase_order_show_delete};
+}
+
+sub get_sales_delivery_order_show_delete {
+ my ($self) = @_;
+ return $self->{data}->{sales_delivery_order_show_delete};
+}
+
+sub get_purchase_delivery_order_show_delete {
+ my ($self) = @_;
+ return $self->{data}->{purchase_delivery_order_show_delete};
+}
+
1;
__END__
Returns the default profit determination method, balance or income
+
+=item C<get_is_changeable>
+
+=item C<get_ir_changeable>
+
+=item C<get_ar_changeable>
+
+=item C<get_ap_changeable>
+
+=item C<get_gl_changeable>
+
+Returns if and when these record types are changeable or deleteable after
+posting. 0 means never, 1 means always and 2 means on the same day.
+
+=item C<get_datev_check_on_sales_invoice>
+
+Returns true if datev check should be performed on sales invoices
+
+=item C<get_datev_check_on_purchase_invoice>
+
+Returns true if datev check should be performed on purchase invoices
+
+=item C<get_datev_check_on_ar_transaction>
+
+Returns true if datev check should be performed on ar transactions
+
+=item C<get_datev_check_on_ap_transaction>
+
+Returns true if datev check should be performed on ap transactions
+
+=item C<get_datev_check_on_gl_transaction>
+
+Returns true if datev check should be performed on gl transactions
+
+=item C<get_show_bestbefore>
+
+Returns the default behavior for showing best before date, true or false
+
+=item C<get_is_show_mark_as_paid>
+
+=item C<get_ir_show_mark_as_paid>
+
+=item C<get_ar_show_mark_as_paid>
+
+=item C<get_ap_show_mark_as_paid>
+
+Returns the default behavior for showing the mark as paid button for the
+corresponding record type (true or false).
+
+=item C<get_sales_order_show_delete>
+
+=item C<get_purchase_order_show_delete>
+
+=item C<get_sales_delivery_order_show_delete>
+
+=item C<get_purchase_delivery_order_show_delete>
+
+Returns the default behavior for showing the delete button for the
+corresponding record type (true or false).
+
=back
=head1 BUGS
=head1 CONFIGURATION
C<SL::LXDebug> gets its configuration from the C<[debug]> section of
-the C<config/lx_office.conf> configuration file. The available options
+the C<config/kivitendo.conf> configuration file. The available options
are:
=over 4
}
sub _setup_focus {
- if ($::request->{layout}->focus || $::form->{fokus}) {
+ if ($::request->{layout}->focus) {
return $::form->parse_html_template('layout/focus_setup', {
focus => $::request->{layout}->focus,
- fokus => $::form->{fokus},
})
} else {
return ();
# Web http://www.lx-office.org
#
#=====================================================================
-# SQL-Ledger Accounting
-# Copyright (C) 2001
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors:
#
# This program is free software; you can redistribute it and/or modify
# it under the terms of the GNU General Public License as published by
package Mailer;
use Email::Address;
-use Encode;
+use Email::MIME::Creator;
+use File::Slurp;
use SL::Common;
use SL::MIME;
my $num_sent = 0;
sub new {
- $main::lxdebug->enter_sub();
-
my ($type, %params) = @_;
my $self = { %params };
- $main::lxdebug->leave_sub();
-
bless $self, $type;
}
myconfig => \%::myconfig,
);
- my $cfg = $::lx_office_conf{mail_delivery};
- if (($cfg->{method} || 'smtp') ne 'smtp') {
- require SL::Mailer::Sendmail;
- return SL::Mailer::Sendmail->new(%params);
- } else {
- require SL::Mailer::SMTP;
- return SL::Mailer::SMTP->new(%params);
- }
-}
-
-sub mime_quote_text {
- $main::lxdebug->enter_sub();
-
- my ($self, $text, $chars_left) = @_;
-
- my $q_start = "=?$self->{charset}?Q?";
- my $l_start = length($q_start);
+ my $module = ($::lx_office_conf{mail_delivery}->{method} || 'smtp') ne 'smtp' ? 'SL::Mailer::Sendmail' : 'SL::Mailer::SMTP';
+ eval "require $module" or return undef;
- my $new_text = "$q_start";
- $chars_left -= $l_start if (defined $chars_left);
-
- for (my $i = 0; $i < length($text); $i++) {
- my $char = ord(substr($text, $i, 1));
-
- if (($char < 32) || ($char > 127) || ($char == ord('?')) || ($char == ord('_'))) {
- if ((defined $chars_left) && ($chars_left < 5)) {
- $new_text .= "?=\n $q_start";
- $chars_left = 75 - $l_start;
- }
-
- $new_text .= sprintf("=%02X", $char);
- $chars_left -= 3 if (defined $chars_left);
-
- } else {
- $char = ord('_') if ($char == ord(' '));
- if ((defined $chars_left) && ($chars_left < 5)) {
- $new_text .= "?=\n $q_start";
- $chars_left = 75 - $l_start;
- }
-
- $new_text .= chr($char);
- $chars_left-- if (defined $chars_left);
- }
- }
-
- $new_text .= "?=";
-
- $main::lxdebug->leave_sub();
-
- return $new_text;
+ return $module->new(%params);
}
-sub send {
- $main::lxdebug->enter_sub();
-
+sub _cleanup_addresses {
my ($self) = @_;
- local (*IN);
-
- $num_sent++;
- my $boundary = time() . "-$$-${num_sent}";
- $boundary = "LxOffice-$self->{version}-$boundary";
- my $domain = $self->recode($self->{from});
- $domain =~ s/(.*?\@|>)//g;
- my $msgid = "$boundary\@$domain";
-
- my $form = $main::form;
- my $myconfig = \%main::myconfig;
-
- my $driver = eval { $self->_create_driver };
- if (!$driver) {
- $main::lxdebug->leave_sub();
- return "send email : $@";
- }
-
- $self->{charset} ||= Common::DEFAULT_CHARSET;
- $self->{contenttype} ||= "text/plain";
-
foreach my $item (qw(to cc bcc)) {
- next unless ($self->{$item});
- $self->{$item} = $self->recode($self->{$item});
+ next unless $self->{$item};
+
$self->{$item} =~ s/\</</g;
$self->{$item} =~ s/\$<\$/</g;
$self->{$item} =~ s/\>/>/g;
$self->{$item} =~ s/\$>\$/>/g;
}
+}
- $self->{from} = $self->recode($self->{from});
+sub _create_message_id {
+ my ($self) = @_;
+
+ $num_sent += 1;
+ my $domain = $self->{from};
+ $domain =~ s/.*\@//;
+ $domain =~ s/>.*//;
+
+ return "kivitendo-$self->{version}-" . time() . "-${$}-${num_sent}\@$domain";
+}
+
+sub _create_address_headers {
+ my ($self) = @_;
+
+ $self->{addresses} = {};
- my %addresses;
- my $headers = '';
foreach my $item (qw(from to cc bcc)) {
- $addresses{$item} = [];
- next unless ($self->{$item});
+ $self->{addresses}->{$item} = [];
+ next if !$self->{$item} || $self->{driver}->keep_from_header($item);
- my (@addr_objects) = Email::Address->parse($self->{$item});
- next unless (scalar @addr_objects);
+ my @header_addresses;
- foreach my $addr_obj (@addr_objects) {
- push @{ $addresses{$item} }, $addr_obj->address;
+ foreach my $addr_obj (Email::Address->parse($self->{$item})) {
+ push @{ $self->{addresses}->{$item} }, $addr_obj->address;
my $phrase = $addr_obj->phrase();
if ($phrase) {
$phrase =~ s/^\"//;
$phrase =~ s/\"$//;
- $addr_obj->phrase($self->mime_quote_text($phrase));
+ $addr_obj->phrase($phrase);
}
- $headers .= sprintf("%s: %s\n", ucfirst($item), $addr_obj->format()) unless $driver->keep_from_header($item);
- }
- }
-
- $headers .= sprintf("Subject: %s\n", $self->mime_quote_text($self->recode($self->{subject}), 60));
-
- $driver->start_mail(from => $self->{from}, to => [ map { @{ $addresses{$_} } } qw(to cc bcc) ]);
-
- $driver->print(qq|${headers}Message-ID: <$msgid>
-X-Mailer: Lx-Office $self->{version}
-MIME-Version: 1.0
-|);
-
- if ($self->{attachments}) {
- $driver->print(qq|Content-Type: multipart/mixed; boundary="$boundary"\n\n|);
- if ($self->{message}) {
- $driver->print(qq|--${boundary}
-Content-Type: $self->{contenttype}; charset="$self->{charset}"
-
-| . $self->recode($self->{message}) . qq|
-
-|);
+ push @header_addresses, $addr_obj->format;
}
- foreach my $attachment (@{ $self->{attachments} }) {
-
- my $filename;
-
- if (ref($attachment) eq "HASH") {
- $filename = $attachment->{"name"};
- $attachment = $attachment->{"filename"};
- } else {
- $filename = $attachment;
- # strip path
- $filename =~ s/(.*\/|\Q$self->{fileid}\E)//g;
- }
-
- my $application = ($attachment =~ /(^\w+$)|\.(html|text|txt|sql)$/) ? "text" : "application";
- my $content_type = SL::MIME->mime_type_from_ext($filename);
- $content_type = "${application}/$self->{format}" if (!$content_type && $self->{format});
- $content_type ||= 'application/octet-stream';
-
- open(IN, $attachment);
- if ($?) {
- $main::lxdebug->leave_sub();
- return "$attachment : $!";
- }
-
- # only set charset for attachements of type text. every other type should not have this field
- # refer to bug 883 for detailed information
- my $attachment_charset;
- if (lc $application eq 'text' && $self->{charset}) {
- $attachment_charset = qq|; charset="$self->{charset}" |;
- }
+ push @{ $self->{headers} }, ( ucfirst($item) => join(', ', @header_addresses) ) if @header_addresses;
+ }
+}
- $driver->print(qq|--${boundary}
-Content-Type: ${content_type}; name="$filename"$attachment_charset
-Content-Transfer-Encoding: BASE64
-Content-Disposition: attachment; filename="$filename"\n\n|);
+sub _create_attachment_part {
+ my ($self, $attachment) = @_;
- my $msg = "";
- while (<IN>) {
- ;
- $msg .= $_;
- }
- $driver->print(encode_base64($msg));
+ my $source_file_name;
- close(IN);
+ my %attributes = (
+ disposition => 'attachment',
+ encoding => 'base64',
+ );
- }
- $driver->print(qq|--${boundary}--\n|);
+ if (ref($attachment) eq "HASH") {
+ $attributes{filename} = $attachment->{name};
+ $source_file_name = $attachment->{filename};
} else {
- $driver->print(qq|Content-Type: $self->{contenttype}; charset="$self->{charset}"
-
-| . $self->recode($self->{message}) . qq|
-|);
+ # strip path
+ $attributes{filename} = $attachment;
+ $attributes{filename} =~ s:.*\Q$self->{fileid}\E:: if $self->{fileid};
+ $attributes{filename} =~ s:.*/::g;
+ $source_file_name = $attachment;
}
- $driver->send;
+ my $attachment_content = eval { read_file($source_file_name) };
+ return undef if !defined $attachment_content;
- $main::lxdebug->leave_sub();
+ my $application = ($attachment =~ /(^\w+$)|\.(html|text|txt|sql)$/) ? 'text' : 'application';
+ $attributes{content_type} = SL::MIME->mime_type_from_ext($attributes{filename});
+ $attributes{content_type} ||= "${application}/$self->{format}" if $self->{format};
+ $attributes{content_type} ||= 'application/octet-stream';
+ $attributes{charset} = $self->{charset} if lc $application eq 'text' && $self->{charset};
- return "";
+ return Email::MIME->create(
+ attributes => \%attributes,
+ body => $attachment_content,
+ );
}
-sub encode_base64 ($;$) {
- $main::lxdebug->enter_sub();
+sub _create_message {
+ my ($self) = @_;
- # this code is from the MIME-Base64-2.12 package
- # Copyright 1995-1999,2001 Gisle Aas <gisle@ActiveState.com>
+ my @parts;
+
+ if ($self->{message}) {
+ push @parts, Email::MIME->create(
+ attributes => {
+ content_type => $self->{contenttype},
+ charset => $self->{charset},
+ encoding => 'quoted-printable',
+ },
+ body_str => $self->{message},
+ );
+
+ push @{ $self->{headers} }, (
+ 'Content-Type' => qq|$self->{contenttype}; charset="$self->{charset}"|,
+ );
+ }
- my $res = "";
- my $eol = $_[1];
- $eol = "\n" unless defined $eol;
- pos($_[0]) = 0; # ensure start at the beginning
+ push @parts, grep { $_ } map { $self->_create_attachment_part($_) } @{ $self->{attachments} || [] };
- $res = join '', map(pack('u', $_) =~ /^.(\S*)/, ($_[0] =~ /(.{1,45})/gs));
+ return Email::MIME->create(
+ header_str => $self->{headers},
+ parts => \@parts,
+ );
+}
- $res =~ tr|` -_|AA-Za-z0-9+/|; # `# help emacs
- # fix padding at the end
- my $padding = (3 - length($_[0]) % 3) % 3;
- $res =~ s/.{$padding}$/'=' x $padding/e if $padding;
+sub send {
+ my ($self) = @_;
- # break encoded string into lines of no more than 60 characters each
- if (length $eol) {
- $res =~ s/(.{1,60})/$1$eol/g;
+ # Create driver for delivery method (sendmail/SMTP)
+ $self->{driver} = eval { $self->_create_driver };
+ if (!$self->{driver}) {
+ $::lxdebug->leave_sub();
+ return "send email : $@";
}
- $main::lxdebug->leave_sub();
+ # Set defaults & headers
+ $self->{charset} ||= Common::DEFAULT_CHARSET;
+ $self->{contenttype} ||= "text/plain";
+ $self->{headers} = [
+ Subject => $self->{subject},
+ 'Message-ID' => $self->_create_message_id,
+ 'X-Mailer' => "kivitendo $self->{version}",
+ ];
- return $res;
-}
+ # Clean up To/Cc/Bcc address fields
+ $self->_cleanup_addresses;
+ $self->_create_address_headers;
+
+ my $email = $self->_create_message;
+
+ # $::lxdebug->message(0, "message: " . $email->as_string);
+ # return "boom";
-sub recode {
- my $self = shift;
- my $text = shift;
+ $self->{driver}->start_mail(from => $self->{from}, to => [ map { @{ $self->{addresses}->{$_} } } qw(to cc bcc) ]);
+ $self->{driver}->print($email->as_string);
+ $self->{driver}->send;
- return $::locale->is_utf8 ? Encode::encode('utf-8-strict', $text) : $text;
+ return '';
}
1;
scalar => [ qw(myconfig mailer form) ]
);
+my %security_config = (
+ none => { require_module => 'Net::SMTP', package => 'Net::SMTP', port => 25 },
+ tls => { require_module => 'Net::SSLGlue::SMTP', package => 'Net::SMTP', port => 25 },
+ ssl => { require_module => 'Net::SMTP::SSL', package => 'Net::SMTP::SSL', port => 465 },
+);
+
sub init {
my ($self) = @_;
Rose::Object::init(@_);
my $cfg = $::lx_office_conf{mail_delivery} || {};
- $self->{security} = lc($cfg->{security} || 'none');
-
- if ($self->{security} eq 'tls') {
- require Net::SMTP::TLS;
- my %params;
- if ($cfg->{login}) {
- $params{User} = $cfg->{user};
- $params{Password} = $cfg->{password};
- }
- $self->{smtp} = Net::SMTP::TLS->new($cfg->{host} || 'localhost', Port => $cfg->{port} || 25, %params);
-
- } else {
- my $module = $self->{security} eq 'ssl' ? 'Net::SMTP::SSL' : 'Net::SMTP';
- my $default_port = $self->{security} eq 'ssl' ? 465 : 25;
- eval "require $module" or die $@;
-
- $self->{smtp} = $module->new($cfg->{host} || 'localhost', Port => $cfg->{port} || $default_port);
- $self->{smtp}->auth($cfg->{user}, $cfg->{password}) if $cfg->{login};
- }
+ $self->{security} = exists $security_config{lc $cfg->{security}} ? lc $cfg->{security} : 'none';
+ my $sec_cfg = $security_config{ $self->{security} };
+
+ eval "require $sec_cfg->{require_module}" or die "$@";
+ $self->{smtp} = $sec_cfg->{package}->new($cfg->{host} || 'localhost', Port => $cfg->{port} || $sec_cfg->{port});
die unless $self->{smtp};
+
+ $self->{smtp}->starttls(SSL_verify_mode => 0) || die if $self->{security} eq 'tls';
+
+ return 1 unless $cfg->{login};
+
+ $self->{smtp}->auth($cfg->{user}, $cfg->{password}) or die;
}
sub start_mail {
use strict;
+use Encode;
use IO::File;
use SL::Template;
Rose::Object::init(@_);
- my $email = $self->mailer->recode($self->myconfig->{email});
+ my $email = $::locale->is_utf8 ? Encode::encode('utf-8', $self->myconfig->{email}) : $self->myconfig->{email};
$email =~ s/[^\w\.\-\+=@]//ig;
my %temp_form = ( %{ $self->form }, myconfig_email => $email );
$sendmail = $template->parse_block($sendmail);
$self->{sendmail} = IO::File->new("|$sendmail") || die "sendmail($sendmail): $!";
+ $self->{sendmail}->binmode(':utf8') if $::locale->is_utf8;
}
sub start_mail {
}
sub menuitem_new {
- $main::lxdebug->enter_sub();
+ $main::lxdebug->enter_sub(LXDebug::DEBUG2());
my ($self, $name, $item) = @_;
$item->{href} .= "&" . $form->escape($key) . "=" . $form->escape($value);
}
- $main::lxdebug->leave_sub();
+ $main::lxdebug->leave_sub(LXDebug::DEBUG2());
}
sub access_control {
my ($dec) = ($sellprice =~ /\.(\d+)/);
my $decimalplaces = max 2, length($dec);
- my $parsed_discount = $form->parse_amount($myconfig, $form->{"discount_$i"});
- my $linetotal_exact = $form->{"qty_$i"} * $sellprice * (100 - $parsed_discount) / 100 / $price_factor->{factor};
- my $linetotal = $form->round_amount($linetotal_exact, 2);
- my $discount = $form->round_amount($form->{"qty_$i"} * $sellprice * $parsed_discount / 100 / $price_factor->{factor} - ($linetotal - $linetotal_exact),
- $decimalplaces);
- my $nodiscount_linetotal = $form->round_amount($form->{"qty_$i"} * $sellprice / $price_factor->{factor}, 2);
+ my $parsed_discount = $form->parse_amount($myconfig, $form->{"discount_$i"});
+
+ my $linetotal_exact = $form->{"qty_$i"} * $sellprice * (100 - $parsed_discount) / 100 / $price_factor->{factor};
+ my $linetotal = $form->round_amount($linetotal_exact, 2);
+
+ my $nodiscount_exact_linetotal = $form->{"qty_$i"} * $sellprice / $price_factor->{factor};
+ my $nodiscount_linetotal = $form->round_amount($nodiscount_exact_linetotal,2);
+
+ my $discount = $nodiscount_linetotal - $linetotal; # is always rounded because $nodiscount_linetotal and $linetotal are rounded
+
+ my $discount_round_error = $discount + ($linetotal_exact - $nodiscount_exact_linetotal); # not used
+
$form->{"netprice_$i"} = $form->round_amount($form->{"qty_$i"} ? ($linetotal / $form->{"qty_$i"}) : 0, 2);
push @{ $form->{TEMPLATE_ARRAYS}->{netprice} }, ($form->{"netprice_$i"} != 0) ? $form->format_amount($myconfig, $form->{"netprice_$i"}, $decimalplaces) : '';
my ($invoice, $arap, $buysell, $ct, $ct_id, $ml);
+ # falls customer ziehen wir die offene forderungsliste
+ # anderfalls für die lieferanten die offenen verbindlichkeitne
if ($form->{ct} eq "customer") {
$invoice = "is";
$arap = "ar";
}
$ct_id = "${ct}_id";
- $form->{todate} = $form->current_date($myconfig) unless ($form->{todate});
- my $todate = conv_dateq($form->{todate});
- my $fromdate = conv_dateq($form->{fromdate});
+ # erweiterung um einen freien zeitraum oder einen stichtag
+ # mit entsprechender altersstrukturliste (s.a. Bug 1842)
+ # eine neue variable an der oberfläche eingeführt, somit ist
+ # todate == freier zeitrau und fordate == stichtag
- my $fromwhere = ($form->{fromdate} ne "") ? " AND (transdate >= (date $fromdate)) " : "";
+ my ($review_of_aging_list, $todate, $fromdate, $fromwhere, $fordate);
+ if ($form->{reporttype} eq 'custom') { # altersstrukturliste
+
+ # explizit rausschmeissen was man für diesen bericht nicht braucht
+ delete $form->{fromdate};
+ delete $form->{todate};
+
+ # an der oberfläche ist das tagesaktuelle datum vorausgewählt
+ # falls es dennoch per Benutzereingabe gelöscht wird, lieber wieder vorbelegen
+ # ferner muss für die spätere DB-Abfrage muss todate gesetzt sein.
+ $form->{fordate} = $form->current_date($myconfig) unless ($form->{fordate});
+ $fordate = conv_dateq($form->{fordate});
+ $todate = $fordate;
+
+ if ($form->{review_of_aging_list}) { # falls die liste leer ist, alles anzeigen
+ if ($form->{review_of_aging_list} =~ m "-") { # .. periode von bis
+ my @period = split(/-/, $form->{review_of_aging_list}); # ... von periode bis periode
+ $review_of_aging_list = " AND $period[0] < (date $fordate) - duedate
+ AND (date $fordate) - duedate < $period[1]";
+ } else {
+ $form->{review_of_aging_list} =~ s/[^0-9]//g; # größer 120 das substitute ist nur für das '>' zeichen
+ $review_of_aging_list = " AND $form->{review_of_aging_list} < (date $fordate) - duedate";
+ }
+ }
+ } else { # freier zeitraum OHNE review_of_aging_list
+ $form->{todate} = $form->current_date($myconfig) unless ($form->{todate});
+ $todate = conv_dateq($form->{todate});
+ $fromdate = conv_dateq($form->{fromdate});
+ $fromwhere = ($form->{fromdate} ne "") ? " AND (transdate >= (date $fromdate)) " : "";
+ }
my $where = " 1 = 1 ";
my ($name, $null);
$where .= qq| AND (a.department_id = | . conv_i($department_id, 'NULL') . qq|)|;
$where_dpt = qq| AND (${arap}.department_id = | . conv_i($department_id, 'NULL') . qq|)|;
}
- my $review_of_aging_list;
- if ($form->{review_of_aging_list}) {
- if ($form->{review_of_aging_list} =~ m "-"){
- my @period = split(/-/, $form->{review_of_aging_list});
- $review_of_aging_list = " AND $period[0] < date_part('days', now() - duedate)
- AND date_part('days', now() - duedate) < $period[1]";
- } else {
- $form->{review_of_aging_list} =~ s/[^0-9]//g;
- $review_of_aging_list = " AND $form->{review_of_aging_list} < date_part('days', now() - duedate)";
- }
- }
-
- my $q_details = qq|
+ my $q_details = qq|
SELECT ${ct}.id AS ctid, ${ct}.name,
street, zipcode, city, country, contact, email,
my @periods = qw(jetzt kumm);
my @gesamtleistung = qw(1 3);
- my @gesamtkosten = qw (10 11 12 13 14 15 16 17 18 19 20);
+ my @gesamtkosten = qw (10 11 12 13 14 15 16 17 18 20);
my @ergebnisse =
qw (rohertrag betriebrohertrag betriebsergebnis neutraleraufwand neutralerertrag ergebnisvorsteuern ergebnis gesamtleistung gesamtkosten);
$form->{ "$key" . "betriebrohertrag" } -
$form->{ "$key" . "gesamtkosten" };
$form->{ "$key" . "neutraleraufwand" } =
- $form->{30}{$key} + $form->{31}{$key};
- $form->{ "$key" . "neutralertrag" } =
+ $form->{19}{$key} + $form->{30}{$key} + $form->{31}{$key};
+ $form->{ "$key" . "neutralerertrag" } =
$form->{32}{$key} + $form->{33}{$key} + $form->{34}{$key};
$form->{ "$key" . "ergebnisvorsteuern" } =
$form->{ "$key" . "betriebsergebnis" } -
$form->{ "$key" . "neutraleraufwand" } +
- $form->{ "$key" . "neutralertrag" };
+ $form->{ "$key" . "neutralerertrag" };
$form->{ "$key" . "ergebnis" } =
$form->{ "$key" . "ergebnisvorsteuern" } - $form->{35}{$key};
=head1 SYNOPSIS
- # Get base path to Kivitendo scripts
+ # Get base path to kivitendo scripts
my $path = SL::System::Process->exe_dir;
=head1 FUNCTIONS
=item C<exe_dir>
-Returns the absolute path to the directory the Kivitendo executables
+Returns the absolute path to the directory the kivitendo executables
(C<login.pl> etc.) and modules (sub-directory C<SL/> etc.) are located
in.
$zip->contents("content.xml", Encode::encode('utf-8-strict', $new_contents));
- my $styles = $zip->contents("styles.xml");
+ my $styles = Encode::decode('utf-8-strict', $zip->contents("styles.xml"));
if ($contents) {
my $new_styles = $self->parse_block($styles);
if (!defined($new_contents)) {
$main::lxdebug->leave_sub();
return 0;
}
- $zip->contents("styles.xml", $new_styles);
+ $zip->contents("styles.xml", Encode::encode('utf-8-strict', $new_styles));
}
$zip->writeToFileNamed($form->{"tmpfile"}, 1);
}
my $value = $self->_get_loop_variable($var, 0, @indices);
+ $value = scalar(@{ $value }) if (ref($value) || '') eq 'ARRAY';
my $hit = 0;
if ($operator_type) {
use File::Find;
use File::Spec;
use Cwd;
+use IO::Dir;
use IO::File;
use POSIX qw(strftime);
use Sys::Hostname;
"countrycode" => "de",
"numberformat" => "1.000,00",
"dateformat" => "dd.mm.yy",
- "stylesheet" => "lx-office-erp.css",
+ "stylesheet" => "kivitendo.css",
"menustyle" => "old",
dbport => $::auth->{DB_config}->{port} || 5432,
dbuser => $::auth->{DB_config}->{user} || 'lxoffice',
$form->{CHARTS} = [];
- opendir SQLDIR, "sql/." or $form->error($ERRNO);
- foreach my $item (sort grep /-chart\.sql\z/, readdir SQLDIR) {
- next if ($item eq 'Default-chart.sql');
- $item =~ s/-chart\.sql//;
- push @{ $form->{CHARTS} }, { "name" => $item,
- "selected" => $item eq "Germany-DATEV-SKR03EU" };
+ tie my %dir_h, 'IO::Dir', 'sql/';
+ foreach my $item (map { s/-chart\.sql$//; $_ } sort grep { /-chart\.sql\z/ && !/Default-chart.sql\z/ } keys %dir_h) {
+ push @{ $form->{CHARTS} }, { name => $item,
+ selected => $item eq "Germany-DATEV-SKR03EU" };
}
- closedir SQLDIR;
- $form->{ACCOUNTING_METHODS} = [];
- foreach my $item ( qw(accrual cash) ) {
- push @{ $form->{ACCOUNTING_METHODS} }, { "name" => $item,
- "selected" => $item eq "cash" };
- };
-
- $form->{INVENTORY_SYSTEMS} = [];
- foreach my $item ( qw(perpetual periodic) ) {
- push @{ $form->{INVENTORY_SYSTEMS} }, { "name" => $item,
- "selected" => $item eq "periodic" };
- };
-
- $form->{PROFIT_DETERMINATIONS} = [];
- foreach my $item ( qw(balance income) ) {
- push @{ $form->{PROFIT_DETERMINATIONS} }, { "name" => $item,
- "selected" => $item eq "income" };
- };
+ $form->{ACCOUNTING_METHODS} = [ map { { name => $_, selected => $_ eq 'cash' } } qw(accrual cash) ];
+ $form->{INVENTORY_SYSTEMS} = [ map { { name => $_, selected => $_ eq 'periodic' } } qw(perpetual periodic) ];
+ $form->{PROFIT_DETERMINATIONS} = [ map { { name => $_, selected => $_ eq 'income' } } qw(balance income) ];
- my $default_charset = $::lx_office_conf{system}->{dbcharset};
- $default_charset ||= Common::DEFAULT_CHARSET;
+ my $default_charset = $::lx_office_conf{system}->{dbcharset} || Common::DEFAULT_CHARSET;
my $cluster_encoding = User->dbclusterencoding($form);
if ($cluster_encoding && ($cluster_encoding =~ m/^(?:UTF-?8|UNICODE)$/i)) {
$form->{FORCE_DBENCODING} = 'UNICODE';
} else {
- $form->{DBENCODINGS} = [];
-
- foreach my $encoding (@Common::db_encodings) {
- push @{ $form->{DBENCODINGS} }, { "dbencoding" => $encoding->{dbencoding},
- "label" => $encoding->{label},
- "selected" => $encoding->{charset} eq $default_charset };
- }
+ $form->{DBENCODINGS} = [ map { { %{$_}, selected => $_->{charset} eq $default_charset } } @Common::db_encodings ];
}
$form->{title} = "kivitendo " . $locale->text('Database Administration') . " / " . $locale->text('Create Dataset');
$::form->error(sprintf($::locale->text("The directory %s does not exist."), $::lx_office_conf{paths}->{templates}));
}
- opendir TEMPLATEDIR, $::lx_office_conf{paths}->{templates} or $::form->error($::lx_office_conf{paths}->{templates} . " : $ERRNO");
- my @all = readdir(TEMPLATEDIR);
- my @alldir = sort grep { -d ($::lx_office_conf{paths}->{templates} . "/$_") && !/^\.\.?$/ } @all;
- closedir TEMPLATEDIR;
-
- @alldir = grep !/\.(html|tex|sty|odt|xml|txb)$/, @alldir;
- @alldir = grep !/^(webpages|print|\.svn)$/, @alldir;
+ tie my %dir_h, 'IO::Dir', $::lx_office_conf{paths}->{templates};
- # mastertemplates
- opendir TEMPLATEDIR, "$::lx_office_conf{paths}->{templates}/print" or $::form->error("$::lx_office_conf{paths}->{templates}/print" . " : $ERRNO");
- my @allmaster = readdir(TEMPLATEDIR);
- closedir TEMPLATEDIR;
+ my @alldir = sort grep {
+ -d ($::lx_office_conf{paths}->{templates} . "/$_")
+ && !/^\.\.?$/
+ && !m/\.(?:html|tex|sty|odt|xml|txb)$/
+ && !m/^(?:webpages$|print$|\.)/
+ } keys %dir_h;
- @allmaster = sort grep { -d ("$::lx_office_conf{paths}->{templates}/print" . "/$_") && !/^\.\.?$/ } @allmaster;
- @allmaster = reverse grep !/Default/, @allmaster;
- push @allmaster, 'Default';
- @allmaster = reverse @allmaster;
+ tie %dir_h, 'IO::Dir', "$::lx_office_conf{paths}->{templates}/print";
+ my @allmaster = ('Standard', sort grep { -d ("$::lx_office_conf{paths}->{templates}/print" . "/$_") && !/^\.\.?$/ && !/^Standard$/ } keys %dir_h);
return \@alldir, \@allmaster;
}
}
$form->{id} = 0;
- if ($form->{"original_accno"} &&
- ($form->{"accno"} eq $form->{"original_accno"})) {
- $form->error($locale->text('Account Number already used!'));
- }
$form->redirect($locale->text('Account saved!'))
if (AM->save_account(\%myconfig, \%$form));
$form->error($locale->text('Cannot save account!'));
# default language
my $all_languages = SL::DB::Manager::Language->get_all;
-# EÜR = cash, Bilanzierung = accrual
+# cash = IST-Versteuerung, accrual = SOLL-Versteuerung
foreach my $key (keys %{ $form->{IC} }) {
foreach my $accno (sort keys %{ $form->{IC}->{$key} }) {
$form->{title} = $locale->text('Add Price Factor');
$form->{callback} ||= build_std_url('action=add_price_factor');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_price_factor');
$form->{title} = $locale->text('Edit Price Factor');
$form->{callback} ||= build_std_url('action=add_price_factor');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
AM->get_price_factor(\%myconfig, $form);
$form->{title} = $locale->text('Add Warehouse');
$form->{callback} ||= build_std_url('action=add_warehouse');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_warehouse');
$form->{title} = $locale->text('Edit Warehouse');
$form->{callback} ||= build_std_url('action=list_warehouses');
- $form->{fokus} = 'description';
+ $::request->{layout}->focus('#description');
$form->header();
print $form->parse_html_template('am/edit_warehouse');
$options{"CAN_EDIT"} = $form->{"edit"};
if ($form->{edit}) {
- $form->{fokus} = "Form.content";
+ $::request->{layout}->focus("#edit_content");
} else {
$options{"content"} = "\n\n" if (!$options{"content"});
use SL::IS;
use SL::PE;
use SL::ReportGenerator;
+use SL::DB::Default;
require "bin/mozilla/arap.pl";
require "bin/mozilla/common.pl";
# build the popup menus
$form->{taxincluded} = ($form->{id}) ? $form->{taxincluded} : "checked";
- # notes
- $form->{notes} = $form->{intnotes} unless $form->{notes};
-
# currencies
$form->{defaultcurrency} = $form->get_default_currency(\%myconfig);
}
my $readonly = ($form->{id}) ? "readonly" : "";
- $form->{radier} = ($form->current_date(\%myconfig) eq $form->{gldate}) ? 1 : 0;
+ $form->{radier} = ($::instance_conf->get_ap_changeable == 2)
+ ? ($form->current_date(\%myconfig) eq $form->{gldate})
+ : ($::instance_conf->get_ap_changeable == 1);
$readonly = ($form->{radier}) ? "" : $readonly;
$form->{forex} = $form->check_exchangerate( \%myconfig, $form->{currency}, $form->{transdate}, 'sell');
}
my $notes =
qq|<textarea name=notes rows=$rows cols=50 wrap=soft $readonly>$form->{notes}</textarea>|;
+ my $intnotes = qq|<textarea name=intnotes rows=$rows cols=50 wrap=soft readonly>$form->{intnotes}</textarea>|;
my $department;
$department = qq|
<tr>
<th align=left width=1%>| . $locale->text('Notes') . qq|</th>
<td align=left>$notes</td>
+
+ <th align=left width=1%>| . $locale->text('Notes for vendor') . qq|</th>
+ <td align=left>$intnotes</td>
</tr>
</table>
</td>
print qq|<input type=hidden name="acc_trans_id_$i" value=$form->{"acc_trans_id_$i"}>\n|;
print qq|<input type=hidden name="gldate_$i" value=$form->{"gldate_$i"}>\n|;
my $changeable = 1;
- if ($::lx_office_conf{features}->{payments_changeable} == 0) {
+ if (SL::DB::Default->get->payments_changeable == 0) {
# never
$changeable = ($form->{"acc_trans_id_$i"})? 0 : 1;
}
- if ($::lx_office_conf{features}->{payments_changeable} == 2) {
+ if (SL::DB::Default->get->payments_changeable == 2) {
# on the same day
$changeable = (($form->{"gldate_$i"} eq '') || $form->current_date(\%myconfig) eq $form->{"gldate_$i"});
}
$::form->header;
print $::form->parse_html_template('ap/form_footer', {
- num_due => $num_due,
- num_follow_ups => $num_follow_ups,
- show_post_draft => ($transdate > $closedto) && !$::form->{id},
- show_storno => $storno,
+ num_due => $num_due,
+ num_follow_ups => $num_follow_ups,
+ show_post_draft => ($transdate > $closedto) && !$::form->{id},
+ show_storno => $storno,
});
$::lxdebug->leave_sub;
$form->{exchangerate} = $form->{forex} if $form->{forex};
$form->{invdate} = $form->{transdate};
- my %saved_variables = map +( $_ => $form->{$_} ), qw(AP AP_amount_1 taxchart_1);
+ my %saved_variables = map +( $_ => $form->{$_} ), qw(AP AP_amount_1 taxchart_1 notes);
my $vendor_changed = &check_name("vendor");
$form->{oldinvtotal} = $form->{invtotal};
$form->{oldtotalpaid} = $totalpaid;
- # notes
- $form->{notes} = $form->{intnotes} if $vendor_changed;
-
&display_form;
$main::lxdebug->leave_sub();
$form->all_vc(\%myconfig, "vendor", "AP");
$form->{title} = $locale->text('AP Transactions');
- $form->{fokus} = "search.vendor";
+ $::request->{layout}->focus('#vendor');
$form->{jsscript} = 1;
$form->get_lists("projects" => { "key" => "ALL_PROJECTS", "all" => 1 },
use SL::FU;
use SL::IS;
use SL::PE;
+use SL::DB::Default;
use SL::ReportGenerator;
require "bin/mozilla/arap.pl";
$form->{oldcustomer} = "$form->{customer}--$form->{customer_id}";
$form->{rowcount} = 1;
- # notes
- $form->{notes} = $form->{intnotes} unless $form->{notes};
-
# currencies
$form->{defaultcurrency} = $form->get_default_currency(\%myconfig);
#/show history button js
$readonly = ($form->{id}) ? "readonly" : "";
- $form->{radier} = ($form->current_date(\%myconfig) eq $form->{gldate}) ? 1 : 0;
+ $form->{radier} = ($::instance_conf->get_ar_changeable == 2)
+ ? ($form->current_date(\%myconfig) eq $form->{gldate})
+ : ($::instance_conf->get_ar_changeable == 1);
$readonly = ($form->{radier}) ? "" : $readonly;
# set option selected
$taxcharts{$item->{id}} = $item;
}
- $form->{fokus} = "arledger.customer";
+ $::request->{layout}->focus("#customer");
my $follow_up_vc = $form->{customer};
$follow_up_vc =~ s/--.*?//;
$payment->{changeable} =
- $::lx_office_conf{features}->{payments_changeable} == 0 ? !$payment->{acc_trans_id} # never
- : $::lx_office_conf{features}->{payments_changeable} == 2 ? $payment->{gldate} eq '' || $payment->{gldate} eq $now
+ SL::DB::Default->get->payments_changeable == 0 ? !$payment->{acc_trans_id} # never
+ : SL::DB::Default->get->payments_changeable == 2 ? $payment->{gldate} eq '' || $payment->{gldate} eq $now
: 1;
push @payments, $payment;
}
# /button for saving history
# mark_as_paid button
- if($form->{id} ne "") {
+ if(($form->{id} ne "") && $::instance_conf->get_ar_show_mark_as_paid) {
print qq|<input type="submit" class="submit" name="action" value="|
. $locale->text('mark as paid') . qq|">|;
}
$form->{invdate} = $form->{transdate};
- my %saved_variables = map +( $_ => $form->{$_} ), qw(AR AR_amount_1 taxchart_1 customer_id);
+ my %saved_variables = map +( $_ => $form->{$_} ), qw(AR AR_amount_1 taxchart_1 customer_id notes);
&check_name("customer");
- # check_name loads customer notes into notes, but ar only knows intnotes, so copy them
- $form->{notes} = $form->{intnotes} if $saved_variables{customer_id} != $form->{customer_id};
-
$form->{AR} = $saved_variables{AR};
if ($saved_variables{AR_amount_1} =~ m/.--./) {
map { $form->{$_} = $saved_variables{$_} } qw(AR_amount_1 taxchart_1);
$form->{"${name}_id"} = $new_id;
+ _reset_salesman_id();
IS->get_customer(\%myconfig, \%$form) if ($name eq 'customer');
IR->get_vendor(\%myconfig, \%$form) if ($name eq 'vendor');
$form->{$name} = $form->{name_list}[0]->{name};
$form->{"old$name"} = qq|$form->{$name}--$form->{"${name}_id"}|;
+ _reset_salesman_id();
IS->get_customer(\%myconfig, \%$form) if ($name eq 'customer');
IR->get_vendor(\%myconfig, \%$form) if ($name eq 'vendor');
# index for new item
my $i = $form->{ndx};
+ _reset_salesman_id();
+
$form->{ $form->{vc} } = $form->{"new_name_$i"};
$form->{"$form->{vc}_id"} = $form->{"new_id_$i"};
$form->{"old$form->{vc}"} =
$main::lxdebug->leave_sub();
}
+# Reset the $::form field 'salesman_id' to the ID of the currently
+# logged in user. Useful when changing to a customer/vendor that has
+# no salesman listed in their master data.
+sub _reset_salesman_id {
+ my $current_employee = SL::DB::Manager::Employee->current;
+ $::form->{salesman_id} = $current_employee->id if $current_employee && exists $::form->{salesman_id};
+}
+
sub check_project {
$main::lxdebug->enter_sub();
$::form->header;
print $::form->parse_html_template('ca/list', {
year => DateTime->today->year,
- cash => $::instance_conf->get_accounting_method eq 'cash',
});
$::lxdebug->leave_sub;
$form->error($locale->text('Date missing!')) unless $form->{datepaid};
my $selected_check = 1;
for my $i (1 .. $form->{rowcount}) {
- if ($form->{"checked_$i"}) {
- if ($form->parse_amount(\%myconfig, $form->{"paid_$i"}, 2) <= 0) { # negativen Betrag eingegeben
- $form->error($locale->text('Amount has to be greater then zero! Wrong row number: ') . $i);
- }
- undef($selected_check);
- # last; # ich muss doch über alle buchungen laufen, da ich noch
- # die freitext-eingabe der werte prüfen will
+ next unless $form->{"checked_$i"};
+ if (abs($form->parse_amount(\%myconfig, $form->{"paid_$i"}, 2)) < 0.01) {
+ $form->error($locale->text('Row #1: amount has to be different from zero.', $i));
}
+ undef $selected_check;
}
$form->error($locale->text('No transaction selected!')) if $selected_check;
$form->{jsscript} = 1;
$form->{title} = $form->{IS_CUSTOMER} ? $locale->text('Customers') : $locale->text('Vendors');
- $form->{fokus} = 'Form.name';
+ $::request->{layout}->focus('#name');
$form->header();
print $form->parse_html_template('ct/search');
$form->{contacts_label} = \&_contacts_label;
$form->{taxzone_id} = 0 if !$form->{id};
$form->{jsscript} = 1;
- $form->{fokus} = "ct.greeting";
$form->{SHIPTO_ALL} = [ +{ shipto_id => '0', shiptoname => $::locale->text('All') }, @{ $form->{SHIPTO} } ];
+ $::request->{layout}->focus("#greeting");
$form->{title} = $form->{title_save}
|| $locale->text("$form->{title} " . ucfirst $form->{db}) . ($form->{title} eq "Edit" ? " $form->{name}" : '');
$form->{title} = $locale->text('Start Dunning Process');
$form->{jsscript} = 1;
- $form->{fokus} = "search.customer";
+ $::request->{layout}->focus('#customer');
$form->header();
print $form->parse_html_template("dunning/add");
# emulate click for resubmitting actions
$dispatch_to_popup .= "document.do.${_}.click(); " for grep { /^action_/ } keys %$form;
$dispatch_to_popup .= "document.do.submit();";
- $::request->{layout}->add_javascripts_inline("\$(function(){$dispatch_to_popup)");
+ $::request->{layout}->add_javascripts_inline("\$(function(){$dispatch_to_popup})");
}
my $follow_up_vc = $form->{ $form->{vc} eq 'customer' ? 'customer' : 'vendor' };
my $pinfo = $part_info_map{$request->{parts_id}};
my $binfo = $bin_info_map{$request->{bin_id}};
- if ($::lx_office_conf{features}->{show_best_before}) {
+ if ($::instance_conf->get_show_bestbefore) {
push @{ $form->{ERRORS} }, $locale->text("There is not enough available of '#1' at warehouse '#2', bin '#3', #4, #5, for the transfer of #6.",
$pinfo->{description},
$binfo->{warehouse_description},
s/option>\Q$::form->{department}\E/option selected>$::form->{department}/;
if ($init) {
- $::form->{fokus} = "gl.reference";
+ $::request->{layout}->focus("#reference");
$::form->{taxincluded} = "1";
} else {
- $::form->{fokus} = qq|gl.accno_$::form->{rowcount}|;
+ $::request->{layout}->focus("#accno_$::form->{rowcount}");
}
$::form->{previous_id} ||= "--";
$follow_ups_due = sum map { $_->{due} * 1 } @{ $follow_ups || [] };
}
- my $radieren = $::form->current_date(\%::myconfig) eq $::form->{gldate};
+ my $radieren = ($::instance_conf->get_gl_changeable == 2)
+ ? ($::form->current_date(\%::myconfig) eq $::form->{gldate})
+ : ($::instance_conf->get_gl_changeable == 1);
print $::form->parse_html_template('gl/form_footer', {
radieren => $radieren,
use SL::AM;
use SL::CVar;
use SL::IC;
+use SL::Helper::Flash;
use SL::ReportGenerator;
#use SL::PE;
IC->retrieve_buchungsgruppen(\%myconfig, $form);
@{ $form->{BUCHUNGSGRUPPEN} } = grep { $_->{id} eq $form->{buchungsgruppen_id} || ($form->{id} && $form->{orphaned}) || !$form->{id} } @{ $form->{BUCHUNGSGRUPPEN} };
+ if (($form->{partnumber} ne '') && !SL::TransNumber->new(number => $form->{partnumber}, type => $form->{item}, id => $form->{id})->is_unique) {
+ flash('info', $::locale->text('This partnumber is not unique. You should change it.'));
+ }
+
# use JavaScript Calendar or not (yes!)
$form->{jsscript} = 1;
$form->{defaults} = AM->get_defaults();
- $form->{fokus} = "ic.partnumber";
+ $::request->{layout}->focus("#partnumber");
$form->{CUSTOM_VARIABLES} = CVar->get_custom_variables('module' => 'IC', 'trans_id' => $form->{id});
$form->{"qty_$i"} = $form->format_amount(\%myconfig, $form->{"qty_$i"});
$linetotal = $form->format_amount(\%myconfig, $linetotal, 2);
$line_purchase_price = $form->format_amount(\%myconfig, $line_purchase_price, 2);
- $href = qq|$form->{script}?action=edit&id=$form->{"id_$i"}&rowcount=$i&previousform=$previousform|;
+ $href = build_std_url("action=edit", qq|id=$form->{"id_$i"}|, "rowcount=$numrows", "currow=$i", "previousform=$previousform");
map { $row{$_}{data} = "" } qw(qty unit partnumber description bom partsgroup runningnumber);
# last row
$row{bom}{data} = $form->{"bom_$i"} ? "x" : " ";
$row{qty}{align} = 'right';
} else {
- $row{partnumber}{data} = qq|<a href=$href>$form->{"partnumber_$i"}</a>|;
+ $row{partnumber}{data} = qq|$form->{"partnumber_$i"}|;
+ $row{partnumber}{link} = $href;
$row{qty}{data} = qq|<input name="qty_$i" size=5 value="$form->{"qty_$i"}">|;
$row{runningnumber}{data} = qq|<input name="runningnumber_$i" size=3 value="$i">|;
$row{bom}{data} = sprintf qq|<input name="bom_$i" type=checkbox class=checkbox value=1 %s>|,
qw(weight listprice sellprice rop);
$form->{assembly_rows}--;
- $i = $form->{assembly_rows};
+ if ($newform{currow}) {
+ $i = $newform{currow};
+ } else {
+ $i = $form->{assembly_rows};
+ }
$form->{"qty_$i"} = 1 unless ($form->{"qty_$i"});
$form->{sellprice} -= $form->{"sellprice_$i"} * $form->{"qty_$i"};
use SL::DB::Language;
use SL::DB::Printer;
+use SL::Helper::Flash;
require "bin/mozilla/common.pl";
# check if items are valid
if ($form->{rowcount} == 1) {
+ flash('warning', $::locale->text('The action you\'ve chosen has not been executed because the document does not contain any item yet.'));
&update;
::end_of_request();
}
my $attachment_filename = $form->generate_attachment_filename();
my $subject = $form->{subject} || $form->generate_email_subject();
- $form->{"fokus"} = $form->{"email"} ? "Form.subject" : "Form.email";
+ $::request->{layout}->focus($form->{"email"} ? "#subject" : "#email");
$form->header;
my (@dont_hide_key_list, %dont_hide_key, @hidden_keys);
reformat_numbers($output_numberformat, 2,
qw(invtotal ordtotal quototal subtotal linetotal
listprice sellprice netprice discount
- tax taxbase total paid),
+ tax taxbase total paid payment),
grep({ /^(?:linetotal|nodiscount_linetotal|listprice|sellprice|netprice|taxbase|discount|p_discount|discount_sub|nodiscount_sub|paid|subtotal|total|tax)_\d+$/ } keys(%{$form})));
reformat_numbers($output_numberformat, undef,
my $emailed = $form->{emailed};
if ($form->{media} eq 'queue') {
- my %queued = map { s|.*/|| } split / /, $form->{queued};
+ my %queued = map { s|.*[/\\]||; $_ } split / /, $form->{queued};
my $filename;
my $suffix = ($form->{postscript}) ? '.ps' : '.pdf';
if ($filename = $queued{ $form->{formname} }) {
- $form->{queued} =~ s/\Q$form->{formname} $filename\E//;
unlink $::lx_office_conf{paths}->{spool} . "/$filename";
- $filename =~ s/\..*$//g;
- $filename .= $suffix;
- $form->{OUT} = $::lx_office_conf{paths}->{spool} . "/$filename";
- $form->{OUT_MODE} = '>';
+ delete $queued{ $form->{formname} };
+
+ $form->{queued} = join ' ', %queued;
+ $filename =~ s/\..*$//g;
+ $filename .= $suffix;
+ $form->{OUT} = $::lx_office_conf{paths}->{spool} . "/$filename";
+ $form->{OUT_MODE} = '>';
+
} else {
my $temp_fh;
($temp_fh, $filename) = File::Temp::tempfile(
'kivitendo-spoolXXXXXX',
SUFFIX => "$suffix",
- DIR => $::lx_office_conf{paths}->{spool},
+ DIR => $::lx_office_conf{paths}->{spool},
+ UNLINK => 0,
);
close $temp_fh;
$form->{OUT} = "$filename";
use SL::IR;
use SL::IS;
use SL::PE;
+use SL::DB::Default;
use List::Util qw(max sum);
require "bin/mozilla/io.pl";
$TMPL_VAR{creditwarning} = ($form->{creditlimit} != 0) && ($form->{creditremaining} < 0) && !$form->{update};
$TMPL_VAR{is_credit_remaining_negativ} = $form->{creditremaining} =~ /-/;
- $form->{fokus} = "invoice.vendor";
+ $::request->{layout}->focus('#vendor');
my $follow_up_vc = $form->{vendor};
$follow_up_vc =~ s/--\d*\s*$//;
for my $i (1 .. $form->{paidaccounts}) {
$form->{"changeable_$i"} = 1;
- if ($::lx_office_conf{features}->{payments_changeable} == 0) {
+ if (SL::DB::Default->get->payments_changeable == 0) {
# never
$form->{"changeable_$i"} = ($form->{"acc_trans_id_$i"})? 0 : 1;
- } elsif ($::lx_office_conf{features}->{payments_changeable} == 2) {
+ } elsif (SL::DB::Default->get->payments_changeable == 2) {
# on the same day
$form->{"changeable_$i"} = (($form->{"gldate_$i"} eq '') ||
($form->current_date(\%myconfig) eq $form->{"gldate_$i"}));
totalpaid => $totalpaid,
paid_missing => $form->{invtotal} - $totalpaid,
show_storno => $form->{id} && !$form->{storno} && !IS->has_storno(\%myconfig, $form, "ap") && !$totalpaid,
- show_delete => ($form->current_date(\%myconfig) eq $form->{gldate}),
+ show_delete => ($::instance_conf->get_ir_changeable == 2)
+ ? ($form->current_date(\%myconfig) eq $form->{gldate})
+ : ($::instance_conf->get_ir_changeable == 1),
});
##print $form->parse_html_template('ir/_payments'); # parser
##print $form->parse_html_template('webdav/_list'); # parser
use SL::IS;
use SL::PE;
use SL::OE;
+use SL::DB::Default;
use Data::Dumper;
use List::Util qw(max sum);
$TMPL_VAR{creditwarning} = ($form->{creditlimit} != 0) && ($form->{creditremaining} < 0) && !$form->{update};
$TMPL_VAR{is_credit_remaining_negativ} = $form->{creditremaining} =~ /-/;
- $form->{fokus} = "invoice.customer";
+ $::request->{layout}->focus('#customer');
my $follow_up_vc = $form->{customer};
$follow_up_vc =~ s/--\d*\s*$//;
for my $i (1 .. $form->{paidaccounts}) {
$form->{"changeable_$i"} = 1;
- if ($::lx_office_conf{features}->{payments_changeable} == 0) {
+ if (SL::DB::Default->get->payments_changeable == 0) {
# never
$form->{"changeable_$i"} = ($form->{"acc_trans_id_$i"})? 0 : 1;
- } elsif ($::lx_office_conf{features}->{payments_changeable} == 2) {
+ } elsif (SL::DB::Default->get->payments_changeable == 2) {
# on the same day
$form->{"changeable_$i"} = (($form->{"gldate_$i"} eq '') ||
($form->current_date(\%myconfig) eq $form->{"gldate_$i"}));
paid_missing => $form->{invtotal} - $totalpaid,
print_options => print_options(inline => 1),
show_storno => $form->{id} && !$form->{storno} && !IS->has_storno(\%myconfig, $form, "ar") && !$totalpaid,
- show_delete => ($form->current_date(\%myconfig) eq $form->{gldate}),
+ show_delete => ($::instance_conf->get_is_changeable == 2)
+ ? ($form->current_date(\%myconfig) eq $form->{gldate})
+ : ($::instance_conf->get_is_changeable == 1),
});
##print $form->parse_html_template('is/_payments'); # parser
##print $form->parse_html_template('webdav/_list'); # parser
$main::auth->assert('invoice_edit');
- map { delete $form->{$_} } qw(printed emailed queued invnumber invdate deliverydate id datepaid_1 gldate_1 acc_trans_id_1 source_1 memo_1 paid_1 exchangerate_1 AP_paid_1 storno);
+ map { delete $form->{$_} } qw(printed emailed queued invnumber invdate deliverydate id datepaid_1 gldate_1 acc_trans_id_1 source_1 memo_1 paid_1 exchangerate_1 AP_paid_1 storno locked);
$form->{paidaccounts} = 1;
$form->{rowcount}--;
$form->{invdate} = $form->current_date(\%myconfig);
} elsif ($form->{resubmit}) {
# emulate click for resubmitting actions
$dispatch_to_popup = "document.oe.${_}.click(); " for grep { /^action_/ } keys %$form;
- $dispatch_to_popup .= "document.oe.submit();";
} elsif ($creditwarning) {
$::request->{layout}->add_javascripts_inline("alert('$credittext')");
}
$form->{cp_id} *= 1;
+ my $source_type = $form->{type};
$form->{title} = $locale->text('Add Purchase Order');
$form->{vc} = "vendor";
$form->{type} = "purchase_order";
$form->get_employee();
- &poso;
+ poso(source_type => $form->{type});
delete $form->{sales_order_to_purchase_order};
$form->{cp_id} *= 1;
+ my $source_type = $form->{type};
$form->{title} = $locale->text('Add Sales Order');
$form->{vc} = "customer";
$form->{type} = "sales_order";
$form->get_employee();
- &poso;
+ poso(source_type => $source_type);
$main::lxdebug->leave_sub();
}
sub poso {
$main::lxdebug->enter_sub();
+ my %param = @_;
my $form = $main::form;
my %myconfig = %main::myconfig;
$form->{transdate} = $form->current_date(\%myconfig);
delete $form->{duedate};
+ # "reqdate" is the validity date for a quotation and the delivery
+ # date for an order. Therefore it makes no sense to keep the value
+ # when converting from one into the other.
+ delete $form->{reqdate} if ($param{source_type} =~ /_quotation$/) == ($form->{type} =~ /_quotation$/);
+
$form->{convert_from_oe_ids} = $form->{id};
$form->{closed} = 0;
$form->{CUSTOM_VARIABLES_INCLUSION_CODE}) = CVar->render_search_options('variables' => $form->{CUSTOM_VARIABLES},
'include_prefix' => 'l_',
'include_value' => 'Y');
- $form->{fokus} = 'Form.projectnumber';
+ $::request->{layout}->focus('#projectnumber');
$form->header();
print $form->parse_html_template('projects/search');
vc => $vc,
label => $label,
year => DateTime->today->year,
+ today => DateTime->today,
nextsub => $nextsub,
accrual => $::instance_conf->get_accounting_method ne 'cash',
cash => $::instance_conf->get_accounting_method eq 'cash',
use SL::OE;
use SL::ReportGenerator;
+use SL::DB::Part;
+
use Data::Dumper;
require "bin/mozilla/common.pl";
show_no_warehouses_error() if (!scalar @{ $form->{WAREHOUSES} });
my $units = AM->retrieve_units(\%myconfig, $form);
+
+ my $part = 0;
+ if ( $form->{parts_id} ) {
+ $part = SL::DB::Part->new();
+ $part->id($form->{parts_id});
+ $part->load();
+ }
+
# der zweite Parameter von unit_select_data gibt den default-Namen (selected) vor
- $form->{UNITS} = AM->unit_select_data($units, $form->{unit}, 0, $form->{unit});
+ $form->{UNITS} = AM->unit_select_data($units, $form->{unit}, 0, $part ? $part->unit : 0);
if (scalar @{ $form->{WAREHOUSES} }) {
$form->{warehouse_id} ||= $form->{WAREHOUSES}->[0]->{id};
$form->error($locale->text('The warehouse or the bin is missing.'));
}
- if (!$::lx_office_conf{features}->{show_best_before}) {
+ if (!$::instance_conf->get_show_bestbefore) {
$form->{bestbefore} = '';
}
$form->{jsscript} = 1;
-# $form->{fokus} = "partnumber";
$form->{title} = $locale->text("Report about warehouse contents");
$form->header();
bind_password =
[system]
-# Set language for login and admin forms. Currently "de" (German),
-# "de_DE" (new German) and "en" (English, not perfect) are available.
+# Set language for login and admin forms. Currently "de" (German)
+# and "en" (English, not perfect) are available.
language = de
# The database charset. Must match the encoding of the database cluster you want to
webdav = 0
vertreter = 0
-# Show fields used for the best before date
-# ATTENTION! If you enabled this feature you can not simply turn it off again
-# without taking care that best_before fields are emptied in the database.
-# This can be done with the following query:
-#
-# UPDATE inventory SET bestbefore = NULL;
-#
-# Any stock contents containing a best before date will be impossible to stock
-# out otherwise.
-show_best_before = 0
-
## Pictures for parts
# Show the picture in the part form
parts_show_image = 1
# Show the picture in the results when you search for parts
parts_listing_images = 0
-# Should payments be changeable after posting (0 = never; 1 = every time; 2 = on the same day)
-payments_changeable = 0
-
[paths]
# path to temporary files (must be writeable by the web server)
userspath = users
method = smtp
# Location of sendmail for 'method = sendmail'
sendmail = /usr/sbin/sendmail -t<%if myconfig_email%> -f <%myconfig_email%><%end%>
-# Settings for 'method = smtp'.
+# Settings for 'method = smtp'. Only set 'port' if your SMTP server
+# runs on a non-standard port (25 for 'security=none' or
+# 'security=tls', 465 for 'security=ssl').
host = localhost
-port = 25
+#port = 25
# Security can be 'tls', 'ssl' or 'none'. Unset equals 'none'. This
# determines whether or not encryption is used and which kind. For
-# 'tls' the module 'Net::SMTP::TLS' is required; for 'ssl'
-# 'Net::SMTP::TLS' is required and 'none' only uses 'Net::SMTP'.
+# 'tls' the module 'Net::SSLGlue' is required; for 'ssl'
+# 'Net::SMTP::SSL' is required and 'none' only uses 'Net::SMTP'.
security = none
# Authentication is only used if 'login' is set. You should only use
# that with 'tls' or 'ssl' encryption.
# template. currently txt and html templates are recognized and correctly mime send.
email_template = templates/mail/self_test/status_mail.txt
-[datev_check]
-# it is possible to make a quick DATEV export everytime you post a record to ensure things
-# work nicely with their data requirements. This will result in a slight overhead though
-# you can enable this for each type of record independantly.
-
-# check when a sales invoice or a payment for a sales invoice is posted
-check_on_sales_invoice = 1
-# check when a purchase invoice or a payment for a purchase invoice is posted
-check_on_purchase_invoice = 1
-# check when an ar transaction is posted
-check_on_ar_transaction = 1
-# check when an ap transaction is posted
-check_on_ap_transaction = 1
-# check when a gl transaction is posted
-check_on_gl_transaction = 1
-
-# not implemented yet:
-#check_on_cash_and_receipt = 0
-#check_on_dunning = 0
-#check_on_sepa_import = 0
-
[console]
# autologin to use if none is given
login =
margin: 0;
padding: 0.3em 1em;
}
-#menuv4 h2:before {
- content: " ";
-}
-#menuv4 h2:after {
- content: " ";
-}
#menuv4 h2 {
background-color: #ffffff;
color: #000000;
#html-menu div.s2 { padding-left: 16px }
body { margin: 0 }
+
+@media print {
+ #menuv3, #menuv4, #html-menu, #frame-header, #js-menu { /* items with this class won't print */
+ display: none;
+ }
+ #content.html-menu { margin-left: 0; }
+}
z-index:500;
top:auto;
display:none;
-background:#000;
}
#menuv3 ul ul ul {
top:0;
left:100%;
-background:#000;
}
/* Begin non-anchor hover selectors */
padding:1px 0 1px 3px;
}
-#menuv4 h2:before {
- content:" ";
-}
-#menuv4 h2:after {
- content:" ";
-}
#menuv4 h2 {
color:#fff;
padding:2px 10px;
border:0;
}
-#menuv4 li.sub {
-left:-25px;
-top:-3px;
-}
-
/* IE6 spacing bug fix, <li>s without a bottom border get spaced to far
* correction: the bug will change the height of the parent element! this will also cause the whole menu to grow
* so the only method to get this pile of crap going is to add a bottom border to the <li>s, where the enclosing <ul> already has
#menuv4 ul ul ul {
top:0;
-left:100%;
+left:90%;
}
/* Begin non-anchor hover selectors */
div#menuv4 li li:hover ul,
div#menuv4 li li li:hover ul,
div#menuv4 li li li li:hover ul
-{display:block; left:10px;}
+{display:block;}
/* End of non-anchor hover selectors */
#html-menu div.s2 { padding-left: 16px }
body { margin: 0 }
+
+
+@media print {
+ #menuv3, #menuv4, #html-menu, #frame-header, #js-menu { /* items with this class won't print */
+ display: none;
+ }
+ #content.html-menu { margin-left: 0; }
+}
** BITTE FERTIGEN SIE VOR DEM UPGRADE EIN BACKUP IHRER DATENBANK(EN) AN! **
+
+Upgrade auf v2.7.1
+==================
+
+* Neue Abhängigkeiten
+
+ * Clone 1.16
+ * Email::MIME
+ * FCGI jetzt min Version 0.72
+ * Test::Harness 3.00
+ * IO::Socket::SSL
+ * Net::LDAP
+ * Met::SMTP::SSL 1.01
+ * Met::SSLGlue 1.01
+
+ Wie immer bitte vor dem ersten Aufrufen einmal die Pakete überprüfen:
+
+ $ scripts/installation_check.pl -ro
+
+* Neue Entwicklerabhängigkeiten
+
+ * Test::Deep
+ * GD 2.00
+
+* Diverse umstrittene Features zum nicht standardkonformen Umgang mit gebuchten
+ Rechnungen sind jetzt standardmässig deaktiviert, und müssen unter System
+ -> Mandantenkonfiguration aktiviert werden.
+
+* Die Übersetzungen "de_DE" und "fr" für die alternative deutsche Version und
+ französische Version respektive wurden entfernt. Es bleiben offiziell
+ unterstützt die deutsche "de" und englische "en" Übersetzung.
+
+* Dieses ist die letzte Version die perl Versionen vor 5.10.1 unterstützen wird.
+ Ab dem nächsten Release werden Sprachkonstrukte verwendet werden, die nicht mehr
+ in 5.8 kompilieren, und es werden alle Coremodule bis einschließlich 5.10.1
+ nicht mehr als Abhängigkeiten gelistet.
+
+
Upgrade auf v2.7.0
==================
-####################################
-# Veränderungen von Lx-Office ERP #
-###################################
+###############################
+# Veränderungen von kivitendo #
+###############################
-2012-03-01 - Release 2.7.1-unstable
+2012-11-12 - Release 2.7.1-beta
Größere neue Features:
-- Automatischer DATEV Konsistenzcheck bei Buchungen.
+- kivitendo rebranding und Stylesheet
+ Der Name Lx-Office war irreführund und wenig einprägsam, und ist ausserdem
+ mit anderen Produktnamen kollidiert. Zur Einführung gibt es ein passdendes
+ Stylesheet in weiß/grün gehalten.
+
+- Mandantenkonfiguration
+ Mit dem Recht "Administration (Für die Verwaltung der aktuellen Instanz aus
+ einem Userlogin heraus)" gibt es nun den Menüpnunkt
+ System->Mandantenkonfiguration, unter dem sich verschiedene
+ mandantenspezifische Einstellungen vornehmen lassen, die vorher entweder gar
+ nicht, nur beim Anlegen einer Mandantendatenbank oder in der
+ Konfigurationsdatei einstellbar waren. Es folgende Einstellungen:
+ * Änderbarkeit von Rechnungen/Zahlungen/Buchungen immer, nie oder am selben
+ Tag
+ * Durchführung des automatischen DATEV Konsistenzcheck bei Buchungen.
+ * Löschbarkeit von Aufträgen und Lieferscheinen
+ * Anzeige bzw. Eingabe des Mindeshaltbarkeitsdatums
+
+ Die Einstellungen show_best_before und payments_changeable (Abschnitt
+ [features]) sowie die Einstellungen unter im Abschnitt [datev_check] in der
+ Konfigurationsdatei werden bei einem Datenbank-Upgrade übernommen und können
+ danach aus der Konfigurationsdatei gelöscht werden.
+
+- Automatischer DATEV Konsistenzcheck bei Buchungen
Es ist jetzt möglich Buchungen aus den fünf Hauptmasken Verkaufsrechnung,
Einkaufsrechnung, Kreditorenbuchung, Debitorenbuchung und Dialogbuchen
automatisch auf korrekten DATEV Export zu prüfen. Wenn ein Problem beim
Export auftreten sollte, wird die Buchung abgebrochen, so dass die Datenbank
- konsistent bleibt und eine Fehlermeldung ausgegeben. Das Feature kann in der
- Konfiguration unter [datev_check] angeschaltet werden.
+ konsistent bleibt und eine Fehlermeldung ausgegeben. Das Feature kann unter
+ "System->Mandantenkonfiguration" angeschaltet werden.
-- Verkaufsbericht: Sortierung um Land, Warengruppen, Kundentyp, Verkäufer und
- Monat erweitert, sowie benutzerdefinierte Variablen eingebunden.
- Warengewicht kann angezeigt werden und damit eignet sich der Verkaufsbericht
- auch als Grundlage für die Intrastat-Meldung.
+- Verkaufsbericht:
+ Sortierung um Land, Warengruppen, Kundentyp, Verkäufer und Monat erweitert,
+ sowie benutzerdefinierte Variablen eingebunden. Warengewicht kann angezeigt
+ werden und damit eignet sich der Verkaufsbericht auch als Grundlage für die
+ Intrastat-Meldung.
+
+- Verkaufspreisinformationen
+ In Warenstammdaten ist jetzt ein Überblick über die Verkaufshistorie des
+ Artikels verfügbar, in dem vergangene Preise gelistet sind.
+
+- Lieferplan
+ Im Verkauf ist ein neuer Bericht "Lieferplan" verfügbar, der zu liefernde
+ Artikel in Aufträgen listet, die nocht nicht in einem Lieferschein erfasst
+ sind.
+
+Kleinere neue Features und Detailverbesserungen
+
+- neue xtCommerce Schnittstelle
+ Die Schnittstelle wurde auf Basis der PepperShop Schnittstelle neu gebaut
+
+- Benutzerdefinierte Variablen sind jetzt in Ansprechpartnern verfügbar
+
+- Mailversand über SMTP
+ Es ist jetzt möglich statt einem sendmail kompatiblen Mailer ein SMTP Konto
+ anzugeben, an das Mails versendet werden.
+
+- Taskserver Steuerung
+ Es ist jetzt möglich den Taskserver aus der Weboberfläche zu steuern. Im Menü
+ unter "System" -> "Hintergrund-Jobs und Task-Server"
+
+API-Änderungen
+
+- Benutzerdefinierte Variablen vom Typ "Lieferant" und "Ware"
+ Für die Auswahl in den webpages steht ein L.vendor_selector und
+ ein L.part_selector zur Verfügung, der einfach das select_tag verwendet.
+ Diese selectoren können/sollen später durch picker ersetzt werden.
+ Die Details werden sich wahrscheinlich noch ändern.
+
+- Die Funktion L.options_for_select wurde entfernt und in L.select_tag integriert
+ Siehe Doku in SL::Template::Plguns::L
+
+- Die Engine beherrscht jetzt Layouts
+ Das Layout wurde von Frames mit einem Contentframe auf ein Layout umgestellt, bei
+ dem die Menüelemente im Request eingepflegt werden. Siehe SL::Layout für Details.
+
+- Printtemplates
+ Wenn in einem <%if var%> die variable eine Referenz auf ein Array ist, wird
+ genau dann wahr zurückgegeben, wenn das Array nicht leer ist.
+
+Entfernte Features:
+
+- Die französische Programmübersetzung wurde entfernt, weil sie nicht gepflegt wurde.
+
+- Die deutsche Programmübersetzung "de_DE" wurde entfernt.
+
+- Die Supportstrukturen für Debian Pakete wurden entfernt.
+ Es wurde auf dem Bugsprint entschieden, dass Support von Debian Paketen zu
+ komplex ist, und eine Einfachheit suggeriert, die wir nicht erfüllen können.
+
+Zukünftig zu entfernende Features:
+
+- Die Unterstützung für perl Versionen vor 5.10.1 wird entfernt werden.
+ Insbesondere ist dies das letzte geplante Release mit Unterstützung für perl
+ 5.8.x und 5.10.0.
Experimentelle Features:
Zur Demonstration gibt es einen Selbsttest Transactions, der die Datenbank
auf Fehlbuchungen untersucht.
-- Es ist möglich benutzerdefinierte Variablen vom Typ "Lieferant" und "Ware"
- anzulegen. Für die Auswahl in den webpages steht ein L.vendor_selector und
- ein L.part_selector zur Verfügung, der einfach das select_tag verwendet.
- Diese selectoren können/sollen später durch picker ersetzt werden.
- Die Details werden sich wahrscheinlich noch ändern.
+Liste gefixter Bugs us dem Bugtracker
+
+ - Bugfix #456: Preisgruppen werden nicht richtig gespeichert
+ - Bugfix #798: Cursor-Positions-Fix
+ - Bugfix #1692: Gelöschter Auftrag erscheint bei Auflisten des entsprechenden Lieferscheins erneut
+ - Bugfix #1697: Produktivität -> Wiedervorlage erstellen -> Speichern -> Übersicht (?)
+ - Bugfix #1814: Bei Gutschrift buchen erhält man die Statusmeldung "Rechnung XXX gebucht"
+ - Bugfix #1819: CVar Auswahl funktioniert nicht mit leading/trailing whitespace
+ - Bugfix #1828: Erzeugen neuer Preisgruppen muendet in Fehler
+ - Bugfix #1829: Lieferanten zu Dienstleistungen werden nicht gespeichert
+ - Bugfix #1834: Buchungsliste - Bilanzspalte
+ - Bugfix #1837: Lieferant auf ungültig setzen, verfälscht Kreditorenbuchungsmaske (mulitbox <-> obsolete?)
+ - Bugfix #1841: falsche Finanzamtnummern
+ - Bugfix #1842: Offene Posten Alterstrukturliste prüft nur auf tagesaktuellem Datum
+ - Bugfix #1849: Buttons "Loeschen" und "Buchen" bei frischen Rechnungen verschwindet nach "Erneuern"
+ - Bugfix #1851: Spaltenueberschriften Export auf Import abgleichen
+ - Bugfix #1853: Administrationsoberflaeche - aktive User anzeigen
+ - Bugfix #1858: Debitorenbuchung: Bereits beschriebenes Kommentarfeld wird bei Kundenwechsel geloescht
+ - Bugfix #1859: Nicht gespeichertes Angebot/Auftrag/Rechnung... -> Drucken -> "Keine Aktion definiert"
+ - Bugfix #1861: Umlaute in Rechnungen fehlerhaft bei <%employee..%>
+ - Bugfix #1863: report_generator parst bei dateiausgabe keine Leerzeichen
+ - Bugfix #1865: templatesystem $form{'tmpfile'} und chdir
+ - Bugfix #1866: Menüs und neues CSS
+ - Bugfix #1867: Debitorenbuchung erfassen nicht möglich
+ - Bugfix #1868: Debitorenbuchung: Kundendetails werden nicht angezeigt
+ - Bugfix #1869: Artikel: Inkonsistente Zustände bzgl. eindeutige Artikelnummern (war: Dienstleistung: neuer Preis lässt sich nicht speichern)
+ - Bugfix #1871: Datumsformat dd-mm-yy verursacht Fehler in Rose::DB::Object
+ - Bugfix #1872: CSVImport verliert die erste Spalte, wenn die Importdatei UTF8 mit BOM ist
+ - Bugfix #1877: Installations Check preuft nicht gegen Net::LDAP
+ - Bugfix #1878: Programm Icon kivitendo
+ - Bugfix #1889: Fälligkeitsdatum aus Rechnungsdatum
+ - Bugfix #1890: Kontenabgleich: Spaltenüberschrift vertauscht
+ - Bugfix #1892: Nach Update Can't use string ("Form") as a HASH....
+ - Bugfix #1894: Stammdaten - Berichte - Kunden: Auswahl Rechnungen, Aufträge, Angebote wirkt als Filter
+ - Bugfix #1895: Negative Beträge bei Zahlungseingang für Gutschriften
+ - Bugfix #1900: Warenbericht: Projekt in Bericht aufnhemen ergibt SQL-Fehler
+ - Bugfix #1901: Warenimport (csv): Bei Update werden make_X etc nicht beruecksichtigt
+ - Bugfix #1904: Fehler bei Artikelmenge über 999999
+ - Bugfix #1907: CSV-Import: Projekte
+ - Bugfix #1921: JS-Menü unterscheidet nicht Links- vs Mittel-Klick
+ - Bugfix #1922: Link "Springe zu Rechnungsadresse" macht so keinen Sinn
+ - Bugfix #1924: CSV-Import Kunde mit benutzerdefinierter Variable geht nur "halb"
+ - Bugfix #1926: Zufälliger Dateiname für PDF Spooldateien
+ - Bugfix #1930: Bearbeitung eines bestehenden Buchungsbeleges: Enter loest Storno aus
+ - Bugfix #1931: Bericht Ansprechpartner lässt Straße auswählen/anzeigen, das Feld existiert aber nicht
+ - Bugfix #1934: Umstellung von keine Währung auf Währung
+ - Bugfix #1936: Autom. Update des Faelligkeitsdatums bei Kreditorenbuchungen funktioniert nicht zuverlaessig
+ - Bugfix #1939: Kreditorenbuchungen: Projektnummer wird nicht autom. in Zeilen uebernommen
+ - Bugfix #1940: Sprung von Wiedervorlage zu Kreditorenbuchung in Kreditorenbuchung funktioniert nicht
+ - Bugfix #1949: Falsche Zuordnung Verkäufer/-in bei Kunden-Stammdaten
+ - Bugfix #1950: Abteilung wird aus ausgelagerten Lieferscheinen nicht in Rechnung übernommen.
+ - Bugfix #1952: Lieferscheine werden nicht nach Abteilung gefiltert
+ - Bugfix #1954: CSV-Import benutzerdef. Variablen mit Großbuchstaben geht nicht
+ - Bugfix #1956: Erzeugnis-Anzeigefehler nach Einzelkomponentenbearbeitung
+ - Bugfix #1959: Lieferdatum verschwindet bei "Workflow Auftrag -> als neu speichern"
+ - Bugfix #1960: Bei CSV-Import wird listprice mit 0 überschrieben
+ - Bugfix #1961: Stammdaten-EK wird bei Eingangsrechnung bei Einheitenumrechnung im Beleg
+ - Bugfix #1964: CsvImport::Parts prüft Duplikate inkonsistent
+ - Bugfix #1965: CsvImport::Parts - Es fehlt eine Option Artiekl mit existierender Nummer zu überspringen
+ - Bugfix #1967: Doc: SL::SessionFile POD ist outdated
+ - Bugfix #1969: oe.reqdate Funktion uneindeutig
+ - Bugfix #1972: CSV-Kundenimport berücksichtigt kundentyp-Spezifischen Nummernkreis nicht
+ - Bugfix #1973: CSS-Menue: Aufklappen ueber aktuell offenen Zweig verhindert Zugriff auf Menuepunkte
+ - Bugfix #1975: SKR03: Gewährte Skonti (8731, 8735) sollten Erlös- statt Aufwandskonten sein
+ - Bugfix #1976: BWA: Übrige Steuern (19) gehören nicht auf Gesamtkosten sondern auf neutralen Aufwand
+ - Bugfix #1978: Keine CVars beim Export von Projekten
+ - Bugfix #1979: BWA: Neutraler Ertrag wird nicht angezeigt
+ - Bugfix #1981: Wiedervorlagen fuer Lieferscheine
+ - Bugfix #1982: Form::format_amount ist für sehr kleine Zahlen bei hoher Präzision kaputt
+ - Bugfix #1983: Einlagern mit anderer Einheit benutzt Grundeinheit
+ - Bugfix #1985: Stammdateneinstellung um immer Bruttorechnungen auszustellen fehlt (Checkbox "Steuer im Preis inbegriffen" als Default setzen)
+ - Bugfix #1987: lxerp_auth wird nach Inst. nicht erstellt
+ - Bugfix #1999: Gewählte Einheit wird nicht übernommen beim Erneuern
+ - Bugfix #2000: Fehler beim Aufrufen bestehender/alter Lieferscheine aus Berichten
+ - Bugfix #2002: In Lieferscheinen werden die Mitarbeiter-IDs statt namen nun angezeigt
+ - Bugfix #2004: Berichte - Dienstleistungen: Bericht zeigt auch uneditierbare Felder
+ - Bugfix #2008: Lieferdatum in Gutschrift / Umsatzsteuererhöhung
+ - Bugfix #2009: Falsche Menge bei Lager»Erzeugnis fertigen
+ - Bugfix #2015: Zahlungsbedingungen lassen sich nicht mehr ändern
+ - Bugfix #2016: Benutzerdefinierte Variablen/Ansprechpersonen werden nicht gespeichert
+ - Bugfix #2018: Lieferplan nicht vollständig
+ - Bugfix #2020: Ansprechpartner wird gelöscht, wenn Eingabetaste gedrückt
+ - Bugfix #2021: Geburtstags Datum als Datumsfeld
+ - Bugfix #2025: Kein Datepicker im Wiedervorlagen-Popup
+ - Bugfix #2027: Menüvariante "Oben (mit CSS, neu)" (v4) seit Abschaffung der Frames kaputt
+ - Bugfix #2028: Seit No Frames gibt es kein HTML-Menü (Links) mehr bei einigen Masken
+ - Bugfix #2030: Unverständliche Fehlermeldung
+ - Bugfix #2031: Anlegen der Tabellen zur Benutzerauthentifizierung: Hinweis auf lx_office.conf ersetzen
+ - Bugfix #2035: Probleme mit Zeichenkodierung beim Mailversand
+ - Bugfix #2038: Unroutable request -- inavlid controller/action. nach Datenbankaktualisierung des Mandanten
+ - Bugfix #2039: No-Frames bedeutet f. HTML-Druckvorlagen immer das Menü mitzudrucken
+ - Bugfix #2041: 'Konto schon vorhanden' beim Speichern eines bestehenden Kontos nach Änderung
+ - Bugfix #2044: fehlender Benutzername bei Menue CSS (v4)
+ - Bugfix #2048: Menu verschwindet
2012-03-01 - Release 2.7.0
<para>im kivitendo-Forum: <ulink
url="https://forum.kivitendo.org/">https://forum.kivitendo.org/</ulink></para>
</listitem>
-
- <listitem>
- <para>im alten Lx-Office-Wiki unter Dokumentation (<ulink
- url="http://wiki.lx-office.org/index.php?title=Installation_Lx-Office_ERP">http://wiki.lx-office.org/index.php?title=Installation_Lx-Office_ERP</ulink>)</para>
- </listitem>
</itemizedlist>
</chapter>
dass kivitendo auf ihnen läuft:</para>
<itemizedlist>
+
<listitem>
- <para>Ubuntu 10.04 LTS Lucid Lynx bis 12.04 Precise Pangolin</para>
+ <para>Debian</para>
+ <itemizedlist>
+ <listitem>
+ <para>6.0 Squeeze (hier muss allerdings das Modul FCGI in der Version >= 0.72 compiled werden)</para>
+ </listitem>
+ <listitem>
+ <para>7.0 Wheezy</para>
+ </listitem>
+ </itemizedlist>
</listitem>
<listitem>
- <para>Debian 5.0 Lenny und 6.0 Squeeze</para>
+ <para>Ubuntu 10.04 LTS Lucid Lynx bis 12.10 Oneiric Ocelot</para>
</listitem>
<listitem>
nicht Bestandteil einer Standard-Perl-Installation sind:</para>
<itemizedlist>
- <listitem>
- <para>parent</para>
- </listitem>
+ <listitem><para><literal>parent</literal></para></listitem>
- <listitem>
- <para>Archive::Zip</para>
- </listitem>
+ <listitem><para><literal>Archive::Zip</literal></para></listitem>
- <listitem>
- <para>Config::Std</para>
- </listitem>
+ <listitem><para><literal>Config::Std</literal></para></listitem>
- <listitem>
- <para>DateTime</para>
- </listitem>
+ <listitem><para><literal>DateTime</literal></para></listitem>
- <listitem>
- <para>DBI</para>
- </listitem>
+ <listitem><para><literal>DBI</literal></para></listitem>
- <listitem>
- <para>DBD::Pg</para>
- </listitem>
+ <listitem><para><literal>DBD::Pg</literal></para></listitem>
- <listitem>
- <para>Email::Address</para>
- </listitem>
+ <listitem><para><literal>Email::Address</literal></para></listitem>
- <listitem>
- <para>JSON</para>
- </listitem>
+ <listitem><para><literal>Email::MIME</literal></para></listitem>
- <listitem>
- <para>List::MoreUtils</para>
- </listitem>
+ <listitem><para><literal>JSON</literal></para></listitem>
- <listitem>
- <para>Params::Validate</para>
- </listitem>
+ <listitem><para><literal>List::MoreUtils</literal></para></listitem>
- <listitem>
- <para>PDF::API2</para>
- </listitem>
+ <listitem><para><literal>Net::SMTP::SSL</literal> (optional, bei E-Mail-Versand über SSL; siehe Abschnitt "<xref
+ linkend="config.sending-email.smtp"/>")</para></listitem>
- <listitem>
- <para>Rose::Object</para>
- </listitem>
+ <listitem><para><literal>Net::SSLGlue</literal> (optional, bei E-Mail-Versand über TLS; siehe Abschnitt "<xref
+ linkend="config.sending-email.smtp"/>")</para></listitem>
- <listitem>
- <para>Rose::DB</para>
- </listitem>
+ <listitem><para><literal>Params::Validate</literal></para></listitem>
- <listitem>
- <para>Rose::DB::Object</para>
- </listitem>
+ <listitem><para><literal>PDF::API2</literal></para></listitem>
- <listitem>
- <para>Template</para>
- </listitem>
+ <listitem><para><literal>Rose::Object</literal></para></listitem>
- <listitem>
- <para>Text::CSV_XS</para>
- </listitem>
+ <listitem><para><literal>Rose::DB</literal></para></listitem>
- <listitem>
- <para>Text::Iconv</para>
- </listitem>
+ <listitem><para><literal>Rose::DB::Object</literal></para></listitem>
- <listitem>
- <para>URI</para>
- </listitem>
+ <listitem><para><literal>Template</literal></para></listitem>
- <listitem>
- <para>XML::Writer</para>
- </listitem>
+ <listitem><para><literal>Text::CSV_XS</literal></para></listitem>
- <listitem>
- <para>YAML</para>
- </listitem>
+ <listitem><para><literal>Text::Iconv</literal></para></listitem>
+
+ <listitem><para><literal>URI</literal></para></listitem>
+
+ <listitem><para><literal>XML::Writer</literal></para></listitem>
+
+ <listitem><para><literal>YAML</literal></para></listitem>
</itemizedlist>
+ <para>Seit v2.7.0 sind die folgenden Pakete hinzugekommen: <literal>Email::MIME</literal>, <literal>Net::SMTP::SSL</literal>,
+ <literal>Net::SSLGlue</literal>.</para>
+
<para>Gegenüber Version 2.6.0 sind zu dieser Liste 2 Pakete
hinzugekommen, <literal>URI</literal> und
<literal>XML::Writer</literal> sind notwendig. Ohne startet kivitendo
<programlisting>apt-get install apache2 postgresql libparent-perl libarchive-zip-perl \
libdatetime-perl libdbi-perl libdbd-pg-perl libpg-perl \
- libemail-address-perl liblist-moreutils-perl libpdf-api2-perl \
+ libemail-address-perl libemail-mime-perl liblist-moreutils-perl libpdf-api2-perl \
librose-object-perl librose-db-perl librose-db-object-perl \
libtemplate-perl libtext-csv-xs-perl libtext-iconv-perl liburi-perl \
libxml-writer-perl libyaml-perl libconfig-std-perl \
- libparams-validate-perl libjson-perl libclass-accessor-perl</programlisting>
+ libparams-validate-perl libjson-perl libclass-accessor-perl \
+ libnet-sslglue-perl libnet-smtp-ssl-perl</programlisting>
<para>Für Fedora Core benötigen Sie diese Pakete:</para>
<programlisting>yum install httpd postgresql-server perl-parent perl-DateTime \
- perl-DBI perl-DBD-Pg perl-Email-Address perl-List-MoreUtils \
+ perl-DBI perl-DBD-Pg perl-Email-Address perl-Email-MIME perl-List-MoreUtils \
perl-PDF-API2 perl-Rose-Object perl-Rose-DB perl-Rose-DB-Object \
perl-Template-Toolkit perl-Text-CSV_XS perl-Text-Iconv perl-URI \
- perl-XML-Writer perl-YAML</programlisting>
+ perl-XML-Writer perl-YAML perl-Net-SSLGlue perl-Net-SMTP-SSL</programlisting>
<para>Für OpenSuSE benötigen Sie diese Pakete:</para>
<programlisting>zypper install apache2 postgresql-server perl-Archive-Zip \
- perl-DateTime perl-DBI perl-DBD-Pg perl-MailTools perl-List-MoreUtils \
+ perl-DateTime perl-DBI perl-DBD-Pg perl-Email-MIME perl-MailTools perl-List-MoreUtils \
perl-PDF-API2 perl-Template-Toolkit perl-Text-CSV_XS perl-Text-Iconv \
- perl-URI perl-XML-Writer perl-YAML</programlisting>
-
- <para>Bei openSuSE 11 ist <literal>parent</literal> bereits enthalten,
- und braucht nicht nachinstalliert werden. Die
- <literal>Rose::*</literal> Pakete sind derzeit nicht für SuSE gepackt,
- und müssen anderweitig nachinstalliert werden.</para>
+ perl-URI perl-XML-Writer perl-YAML perl-Net-SSLGlue perl-Net-SMTP-SSL</programlisting>
<para>kivitendo enthält ein Script, mit dem überprüft werden kann, ob
alle benötigten Perl-Module installiert sind. Der Aufruf lautet wie
entsprechend kommentiert sind:</para>
<itemizedlist>
- <listitem>
- <para><literal>authentication</literal></para>
- </listitem>
+ <listitem><para><literal>authentication</literal> (siehe Abschnitt "<xref
+ linkend="Benutzerauthentifizierung-und-Administratorpasswort"/>" in diesem Kapitel)</para></listitem>
- <listitem>
- <para><literal>authentication/database</literal></para>
- </listitem>
+ <listitem><para><literal>authentication/database</literal></para></listitem>
- <listitem>
- <para><literal>authentication/ldap</literal></para>
- </listitem>
+ <listitem><para><literal>authentication/ldap</literal></para></listitem>
- <listitem>
- <para><literal>system</literal></para>
- </listitem>
+ <listitem><para><literal>system</literal></para></listitem>
- <listitem>
- <para><literal>features</literal></para>
- </listitem>
+ <listitem><para><literal>features</literal> (siehe Kapitel "<xref linkend="features"/>")</para></listitem>
- <listitem>
- <para><literal>paths</literal></para>
- </listitem>
+ <listitem><para><literal>paths</literal></para></listitem>
- <listitem>
- <para><literal>applications</literal></para>
- </listitem>
+ <listitem><para><literal>applications</literal></para></listitem>
- <listitem>
- <para><literal>environment</literal></para>
- </listitem>
+ <listitem><para><literal>environment</literal></para></listitem>
- <listitem>
- <para><literal>print_templates</literal></para>
- </listitem>
+ <listitem><para><literal>mail_delivery</literal> (siehe Abschnitt "<xref linkend="config.sending-email.smtp"/>)</para></listitem>
- <listitem>
- <para><literal>task_server</literal></para>
- </listitem>
+ <listitem><para><literal>print_templates</literal></para></listitem>
- <listitem>
- <para><literal>periodic_invoices</literal></para>
- </listitem>
+ <listitem><para><literal>task_server</literal></para></listitem>
- <listitem>
- <para><literal>console</literal></para>
- </listitem>
+ <listitem><para><literal>periodic_invoices</literal></para></listitem>
- <listitem>
- <para><literal>debug</literal></para>
- </listitem>
+ <listitem><para><literal>console</literal></para></listitem>
+
+ <listitem><para><literal>debug</literal></para></listitem>
</itemizedlist>
<para>Die üblicherweise wichtigsten Parameter, die am Anfang
<sect2 id="Zeichensätze-die-Verwendung-von-UTF-8">
<title>Zeichensätze/die Verwendung von UTF-8</title>
- <para>kivitendo kann komplett mit UTF-8 als Zeichensatz verwendet
- werden. Dabei gibt es zwei Punkte zu beachten: PostgreSQL muss in
- Version 8.2 oder neuer benutzt werden, und der
- PostgreSQL-Datenbankcluster muss ebenfalls mit UTF-8 als Locale
- angelegt worden sein.</para>
+ <para>Bei aktuellen Serverinstallationen braucht man hier meist nicht
+ eingreifen</para>
+
+ <para>Dieses kann überprüft werden: ist das Encoding der Datenbank
+ “template1” “UTF8”, so braucht man nichts weiteres diesbezüglich
+ unternehmen. Zum Testen:
+
+ <programlisting>su postgres
+echo '\l' | psql
+exit </programlisting>
- <para>Dieses ist kann überprüft werden: ist das Encoding der Datenbank
- “template1” “UTF8”, so kann auch kivitendo mit UTF-8 betrieben werden.
Andernfalls ist es notwendig, einen neuen Datenbankcluster mit
UTF-8-Encoding anzulegen und diesen zu verwenden. Unter Debian und
Ubuntu kann dies z.B. für PostgreSQL 8.2 mit dem folgenden Befehl
<para>In der Datei <filename>pg_hba.conf</filename>, die im gleichen
Verzeichnis wie die <filename>postgresql.conf</filename> zu finden
sein sollte, müssen die Berichtigungen für den Zugriff geändert
- werden. Hier gibt es mehrere Möglichkeiten. Eine besteht darin, lokale
- Verbindungen immer zuzulassen:</para>
-
- <programlisting>local all all trust
-host all all 127.0.0.1 255.0.0.0 trust</programlisting>
-
- <para>Besser ist es, für eine bestimmte Datenbank Zugriff nur per
- Passwort zuzulassen. Beispielsweise:</para>
+ werden. Hier gibt es mehrere Möglichkeiten. sinnvoll ist es nur die
+ nögiten Verbindungen immer zuzulassen, für eine lokal laufenden
+ Datenbank zum Beispiel:</para>
<programlisting>local all kivitendo password
host all kivitendo 127.0.0.1 255.255.255.255 password</programlisting>
<para>In der Datenbank <literal>template1</literal> muss die
Unterstützung für servergespeicherte Prozeduren eingerichet werden.
- Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an, und
+ Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an:
+ <programlisting>su - postgres
+psql template1</programlisting>
+
führen Sie die folgenden Kommandos aus:</para>
- <programlisting>create language 'plpgsql';</programlisting>
+ <programlisting>create language 'plpgsql';
+\q</programlisting>
</sect2>
<sect2 id="Datenbankbenutzer-anlegen">
anlegen. Ein Beispiel, wie Sie einen neuen Benutzer anlegen
können:</para>
- <programlisting>su - postgres createuser -d -P kivitendo</programlisting>
+ <para>Die Frage, ob der neue User Superuser sein soll, können Sie mit nein
+ beantworten, genauso ist die Berechtigung neue User (Roles) zu
+ generieren nicht nötig.</para>
+ <programlisting>su - postgres
+createuser -d -P kivitendo
+exit</programlisting>
<para>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
Sie den evtl. voreingestellten Benutzer “postgres” auf “kivitendo” bzw.
verwendet.</para>
<warning>
- <para>FCGI 0.69 und höher ist extrem strict in der Behandlung von
- Unicode, und verweigert bestimmte Eingaben von kivitendo. Falls es
- Probleme mit Umlauten in Ihrere Installation gibt, muss auf die
- Vorgängerversion FCGI 0.68 ausgewichen werden.</para>
+ <para>FCGI-Versionen ab 0.69 und bis zu 0.71 inklusive sind extrem strict in der Behandlung von Unicode, und verweigern
+ bestimmte Eingaben von kivitendo. Falls es Probleme mit Umlauten in Ihrere Installation gibt, muss zwingend Version 0.68 oder
+ aber Version 0.72 und neuer eingesetzt werden.</para>
- <para>Mit CPAN lässt sie sich die Vorgängerversion wie folgt
+ <para>Mit <ulink url="http://www.cpan.org">CPAN</ulink> lässt sie sich die Vorgängerversion wie folgt
installieren:</para>
<programlisting>force install M/MS/MSTROUT/FCGI-0.68.tar.gz</programlisting>
</sect2>
</sect1>
+ <sect1 id="config.sending-email" xreflabel="E-Mail-Versand aus kivitendo heraus">
+ <title>E-Mail-Versand aus kivitendo heraus</title>
+
+ <para>kivitendo kann direkt aus dem Programm heraus E-Mails versenden, z.B. um ein Angebot direkt an einen Kunden zu
+ verschicken. Damit dies funktioniert, muss eingestellt werden, über welchen Server die E-Mails verschickt werden sollen. kivitendo
+ unterstützt dabei zwei Mechanismen: Versand über einen lokalen E-Mail-Server (z.B. mit <productname>Postfix</productname> oder
+ <productname>Exim</productname>, was auch die standardmäßig aktive Methode ist) sowie Versand über einen SMTP-Server (z.B. der des
+ eigenen Internet-Providers).</para>
+
+ <para>Welche Methode und welcher Server verwendet werden, wird über die Konfigurationsdatei <filename>config/kivitendo.conf</filename>
+ festgelegt. Dort befinden sich alle Einstellungen zu diesem Thema im Abschnitt '<literal>[mail_delivery]</literal>'.</para>
+
+ <sect2 id="config.sending-email.sendmail" xreflabel="E-Mail-Versand über lokalen E-Mail-Server">
+ <title>Versand über lokalen E-Mail-Server</title>
+
+ <para>Diese Methode bietet sich an, wenn auf dem Server, auf dem kivitendo läuft, bereits ein funktionsfähiger E-Mail-Server wie
+ z.B. <productname>Postfix</productname>, <productname>Exim</productname> oder <productname>Sendmail</productname> läuft.</para>
+
+ <para>Um diese Methode auszuwählen, muss der Konfigurationsparameter '<literal>method = sendmail</literal>' gesetzt sein. Dies ist
+ gleichzeitig der Standardwert, falls er nicht verändert wird.</para>
+
+ <para>Um zu kontrollieren, wie das Programm zum Einliefern gestartet wird, dient der Parameter '<literal>sendmail =
+ ...</literal>'. Der Standardwert verweist auf das Programm <filename>/usr/bin/sendmail</filename>, das bei allen oben genannten
+ E-Mail-Serverprodukten für diesen Zweck funktionieren sollte.</para>
+
+ <para>Die Konfiguration des E-Mail-Servers selber würde den Rahmen dieses sprengen. Hierfür sei auf die Dokumentation des
+ E-Mail-Servers verwiesen.</para>
+ </sect2>
+
+ <sect2 id="config.sending-email.smtp" xreflabel="E-Mail-Versand über einen SMTP-Server">
+ <title>Versand über einen SMTP-Server</title>
+
+ <para>Diese Methode bietet sich an, wenn kein lokaler E-Mail-Server vorhanden oder zwar einer vorhanden, dieser aber nicht
+ konfiguriert ist.</para>
+
+ <para>Um diese Methode auszuwählen, muss der Konfigurationsparameter '<literal>method = smtp</literal>' gesetzt sein. Die folgenden
+ Parameter dienen dabei der weiteren Konfiguration:</para>
+
+ <variablelist>
+ <varlistentry>
+ <term><varname>hostname</varname></term>
+
+ <listitem><para>Name oder IP-Adresse des SMTP-Servers. Standardwert: '<literal>localhost</literal>'</para></listitem>
+ </varlistentry>
+
+ <varlistentry>
+ <term><varname>port</varname></term>
+
+ <listitem><para>Portnummer. Der Standardwert hängt von der verwendeten Verschlüsselungsmethode ab. Gilt '<literal>security =
+ none</literal>' oder '<literal>security = tls</literal>', so ist 25 die Standardportnummer. Für '<literal>security =
+ ssl</literal>' ist 465 die Portnummer. Muss normalerweise nicht geändert werden.</para></listitem>
+ </varlistentry>
+
+ <varlistentry>
+ <term><varname>security</varname></term>
+
+ <listitem><para>Wahl der zu verwendenden Verschlüsselung der Verbindung mit dem Server. Standardwert ist
+ '<literal>none</literal>', wodurch keine Verschlüsselung verwendet wird. Mit '<literal>tls</literal>' wird TLS-Verschlüsselung
+ eingeschaltet, und mit '<literal>ssl</literal>' wird Verschlüsselung via SSL eingeschaltet. Achtung: Für
+ '<literal>tls</literal>' und '<literal>ssl</literal>' werden zusätzliche Perl-Module benötigt (siehe unten).</para></listitem>
+ </varlistentry>
+
+ <varlistentry>
+ <term><varname>login</varname> und <varname>password</varname></term>
+
+ <listitem><para>Falls der E-Mail-Server eine Authentifizierung verlangt, so können mit diesen zwei Parametern der Benutzername
+ und das Passwort angegeben werden. Wird Authentifizierung verwendet, so sollte aus Sicherheitsgründen auch eine Form von
+ Verschlüsselung aktiviert werden.</para></listitem>
+ </varlistentry>
+ </variablelist>
+
+ <para>Wird Verschlüsselung über TLS oder SSL aktiviert, so werden zusätzliche Perl-Module benötigt. Diese sind:</para>
+
+ <itemizedlist>
+ <listitem><para>TLS-Verschlüsselung: Modul <literal>Net::SSLGlue</literal> (Debian-Paketname
+ <literal>libnet-sslglue-perl</literal>, Fedora Core: <literal>perl-Net-SSLGlue</literal>, openSuSE:
+ <literal>perl-Net-SSLGlue</literal></para></listitem>
+
+ <listitem><para>SSL-Verschlüsselung: Modul <literal>Net::SMTP::SSL</literal> (Debian-Paketname
+ <literal>libnet-smtp-ssl-perl</literal>, Fedora Core: <literal>perl-Net-SMTP-SSL</literal>, openSuSE:
+ <literal>perl-Net-SMTP-SSL</literal></para></listitem>
+ </itemizedlist>
+ </sect2>
+ </sect1>
+
<sect1 id="Drucken-mit-kivitendo">
<title>Drucken mit kivitendo</title>
- <para>Das Drucksystem von kivitendo benutzt von Haus aus LaTeX Vorlagen.
- Um drucken zu können, braucht der Server ein geeignetes LaTeX System. Am
- einfachsten ist dazu eine <literal>texlive</literal> Installation. Unter
- Debianoiden Betriebssystemen sind das die Pakete:</para>
+ <para>Das Drucksystem von kivitendo benutzt von Haus aus LaTeX-Vorlagen. Um drucken zu können, braucht der Server ein geeignetes
+ LaTeX System. Am einfachsten ist dazu eine <literal>texlive</literal> Installation. Unter Debianoiden Betriebssystemen installiert man
+ die Pakete mit:</para>
- <para><literal>texlive-latex-base texlive-latex-extra
- texlive-fonts-recommended</literal></para>
+ <para><programlisting>aptitude install texlive-base-bin texlive-latex-recommended texlive-fonts-recommended \
+ texlive-latex-extra texlive-lang-german texlive-generic-extra</programlisting></para>
- <para>Diese hinteren beiden enthalten Bibliotheken und Schriftarten die
- von den Standardvorlagen verwendet werden.</para>
+ <para>TODO: RPM-Pakete.</para>
- <para>TODO: rpm Pakete.</para>
+ <para>kivitendo bringt drei alternative Vorlagensätze mit:</para>
+ <itemizedlist>
+ <listitem><para>Standard</para></listitem>
+ <listitem><para>f-tex</para></listitem>
+ <listitem><para>RB</para></listitem>
+ </itemizedlist>
- <para>In den allermeisten Installationen sollte drucken jetzt schon
- funktionieren. Sollte ein Fehler auftreten wirft TeX sehr lange
- Fehlerbeschreibungen, der eigentliche Fehler ist immer die erste Zeite
- die mit einem Ausrufezeichen anfängt. Häufig auftretende Fehler sind zum
- Beispiel:</para>
+ <sect2 id="Vorlagenverzeichnis-anlegen" xreflabel="Vorlagenverzeichnis anlegen">
+ <title>Vorlagenverzeichnis anlegen</title>
+ <para>Im Administrationsbereich lässt sich bei einem Benutzer/Mandanten einer dieser Vorlagensätze als Basis für die zu
+ druckenden Dokumente auswählen. Rufen Sie dazu die <guimenu>Benutzerverwaltung</guimenu> auf.</para>
- <itemizedlist>
- <listitem>
- <para>! LaTeX Error: File `eurosym.sty' not found. Die entsprechende
- LaTeX-Bibliothek wurde nicht gefunden. Das tritt vor allem bei
- Vorlagen aus der Community auf. Installieren Sie die entsprechenden
- Pakete.</para>
- </listitem>
+ <para>Wählen Sie dort einen Benutzer aus oder legen Sie einen neuen an. In der Benutzerbearbeiten-Maske müssen Sie zwei Dinge
+ angeben:</para>
- <listitem>
- <para>! Package inputenc Error: Unicode char \u8:æ¡\9c not set up for
- use with LaTeX. Dieser Fehler tritt auf, wenn sie versuchen mit
- einer Standardinstallation exotische utf8 Zeichen zu drucken.
- TeXLive unterstützt von Haus nur romanische Schriften und muss mit
- diversen Tricks dazu gebracht werden andere Zeichen zu akzeptieren.
- Adere TeX Systeme wie XeTeX schaffen hier Abhilfe.</para>
- </listitem>
- </itemizedlist>
+ <orderedlist>
+ <listitem><para><option>Name</option>: Der Verzeichnisname für den neuen Vorlagensatz. Dieser kann im Rahmen der üblichen
+ Bedingungen für Verzeichnisnamen frei gewählt werden.</para></listitem>
+ <listitem><para><option>Vorlagen auswählen</option>: Wählen Sie hier den Vorlagensatz aus, der kopiert werden soll
+ (<filename>Standard</filename>, <filename>f-tex</filename> oder <filename>RB</filename>.)</para></listitem>
+ </orderedlist>
+
+ <para>Der gleiche Vorlagensatz kann, wenn er mal angelegt ist, bei mehreren Benutzern verwendet werden.</para>
+
+ <para>Die Abhängigkeiten kann man prüfen mit:</para>
+
+ <programlisting>/scripts/installation_check.pl -l</programlisting>
+
+ </sect2>
+ <sect2 id="Vorlagen-Standard">
+ <title>Standard</title>
+
+ <para>Der Standard-Vorlagensatz von Kivitendo. Wie unter <ulink url="http://demo.kivitendo.org">http://demo.kivitendo.org</ulink> zu
+ sehen.</para>
+
+ </sect2>
+
+ <sect2 id="f-tex">
+ <title>f-tex</title>
+
+ <para>Ein Vorlagensatz, der in wenigen Minuten alle Dokumente zur Verfügung stellt.</para>
+
+ <sect3 id="f-tex-Feature-Übersicht">
+ <title>Feature-Übersicht</title>
+ <itemizedlist>
+ <listitem><para>Keine Redundanz. Es wird ein- und dieselbe LaTeX-Vorlage für alle briefartigen Dokumente verwendet. Also
+ Angebot, Rechnung, Performarechnung, Lieferschein, aber eben nicht für Paketaufkleber etc..</para></listitem>
+
+ <listitem><para>Leichte Anpassung an das Firmen-Layout durch verwendung eines Hintergrund-PDF. Dieses kann leicht mit dem
+ eigenen Lieblingsprogramm erstellt werden (Openoffice, Inkscape, Gimp, Adobe*)</para></listitem>
- <para>Wird garkein Fehler angezeigt sondern nur der Name des Templates,
- heißt das normalerweise, dass das LaTeX Binary nicht gefunden wurde.
- Prüfen Sie den Namen in der Konfiguration (Standard:
- <literal>pdflatex</literal>), und stellen Sie sicher, dass pdflatex
- (oder das von Ihnen verwendete System) vom Webserver ausgeführt werden
- darf.</para>
+ <listitem><para>Hintergrund-PDF umschaltbar auf "nur erste Seite" (Standard) oder "alle Seiten" (Option
+ "<option>bgPdfFirstPageOnly</option>" in Datei <filename>letter.lco</filename>)</para></listitem>
+
+ <listitem><para>Hintergrund-PDF für Ausdruck auf bereits bedrucktem Briefpapier abschaltbar. Es wird dann nur bei per E-Mail
+ versendeten Dokumenten eingebunden (Option "<option>bgPdfEmailOnly</option>" in Datei
+ <filename>letter.lco</filename>).</para></listitem>
+
+ <listitem><para>Nutzung der Layout-Funktionen von LaTeX für Seitenumbruch, Wiederholung von Kopfzeilen, Zwischensummen
+ etc. (danke an Kai-Martin Knaak für die Vorarbeit)</para></listitem>
+
+ <listitem><para>Anzeige des Empfängerlandes im Adressfeld nur, wenn es vom Land des eigenen Unternehmens abweicht (also die
+ Rechnung das Land verlässt).</para></listitem>
+
+ <listitem><para>Multisprachfähig leicht um weitere Sprachen zu erweitern, alle Übersetzungen in der Datei
+ <filename>translatinos.tex</filename>.</para></listitem>
+
+ <listitem><para>Auflistung von Bruttopreisen für Endverbraucher.</para></listitem>
+ </itemizedlist>
+ </sect3>
+
+ <sect3 id="f-tex-Installation">
+ <title>Die Installation</title>
+ <itemizedlist>
+ <listitem><para>Vorlagenverzeichnis mit Option f-tex anlegen, siehe: <xref linkend="Vorlagenverzeichnis-anlegen"/>. Das
+ Vorlagensystem funktioniert jetzt schon, hat allerdings noch einen Beispiel-Briefkopf.</para></listitem>
+
+ <listitem><para>Erstelle eine pdf-Hintergrund Datei und verlinke sie nach <filename>./letter_head.pdf</filename>.</para></listitem>
+ <listitem><para>Editiere den Bereich "<option>settings</option>" in der datei <filename>letter.lco</filename>.</para></listitem>
+ </itemizedlist>
+
+ <para>oder etwas Detaillierter:</para>
+
+ <para>
+ Es wird eine Datei <filename>sample.lco</filename> erstellt und diese nach <filename>letter.lco</filename> verlinkt. Eigentlich
+ ist dies die Datei die für die Firmenspezifischen Anpassungen gedacht ist. Da die Einstiegshürde in LaTeX nicht ganz niedrig
+ ist, wird in dieser Datei auf ein Hintergrundpdf verwiesen. Ich empfehle über dieses PDF die persönlichen Layoutanpassungen
+ vorzunehmen und <filename>sample.lco</filename> unverändert zu lassen. Die die Anpassung über eine
+ <filename>*.lco</filename>-Datei die letztlich auf <filename>letter.lco</filename> verlinkt ist ist aber auch möglich.
+ </para>
+
+ <para>
+ Es wird eine Datei <filename>sample_head.pdf</filename> mit ausgeliefert, diese wird nach <filename>letter_head.pdf</filename>
+ verlinkt. Damit gibt es schon mal eine Funktionsfähige Vorlage. Schau Dir nach Abschluss der Installation die Datei
+ <filename>sample_haed.pdf</filename> an und erstelle ein entsprechendes PDF passend zum Briefkopf Deiner Firma, diese dann im
+ Template Verzeichniss ablegen und statt <filename>sample_head.pdf</filename> nach <filename>letter_head.pdf</filename>
+ verlinken.
+ </para>
+
+ <para>
+ letzlich muss <filename>letter_head.pdf</filename> auf das passende Hintergrund-PDF verweisen, welches gewünschten Briefkopf
+ enthält. Bei Updates oder nach erneutem
+ </para>
+
+ <para>
+ Es wird eine Datei <filename>mydata.tex.example</filename> ausgeliefert, die nach <filename>mytdata.tex</filename> verlinkt
+ ist. Bei verwendetem Hintergrund-PDF wird nur der Eintrag für das Land verwendet. Die Datei muss also nicht angefasst
+ werden. Die Anderen Werte sind für das Modul 'lp' (Label Print in erp - zur Zeit nicht im öffentlichen Zweig).
+ </para>
+ <para>
+ Alle Anpassungen zum Briefkopf, Fusszeilen, Firmenlogos, etc. sollten über die Hintergrund-PDF-Datei oder die
+ <filename>*.lco</filename>-Datei erfolgen.
+ </para>
+ </sect3>
+
+ <sect3 id="f-tex-Funktionsübersicht">
+ <title>f-tex Funktionsübersicht</title>
+ <para>
+ Das Konzept von kivitendo sieht vor, für jedes Dokument (Auftragsbestätigung, Lieferschein, Rechnung, etc.) eine LaTeX-Vorlage
+ vorzuhalten, dies ist sehr Wartungsunfreundlich. Auch das Einlesen einer einheitlichen Quelle für den Briefkopf bringt nur
+ bedingte Vorteile, da hier leicht die Pflege der Artikel-Tabellen aus dem Ruder läuft. Bei dem vorliegenden Ansatz wird für alle
+ briefartigen Dokumente mit Artikel-Tabellen eine einheitliche LaTeX-Vorlage verwendet, welche über Codeweichen die
+ Besonderheiten der jeweiligen Dokumente Berücksichtigt.
+ </para>
+
+ <itemizedlist>
+ <listitem><para>Tabellen mit oder ohne Preis</para></listitem>
+ <listitem><para>Sprache der Tabellenüberschriften etc.</para></listitem>
+ <listitem><para>Anpassung der Bezugs-Zeile (z.B. Rechnungsnummer versus Angebotsnummer)</para></listitem>
+ <listitem><para>Darstellung von Brutto oder Netto-Preisen in der Auflistung (Endverbraucher versus Gewerblicher
+ Kunde)</para></listitem>
+ </itemizedlist>
+
+ <para>Nachteil:</para>
+
+ <para>
+ LaTeX hat ohnehin eine sehr steile Lehrnkurve. Die Datei <filename>letter.tex</filename> ist sehr komplex und verstärkt damit
+ diesen Effekt noch einmal erheblich. Wer LaTeX-Erfahrung hat, oder geübt ist Scriptsparachen nachzuvollziehen kann natürlich
+ auch innerhalb der Tabellendarstellung gut persönliche Anpassungen vornehmen. Aber man kann sich hier bei Veränderungen sehr
+ schnell häftig in den Fuss schiessen.
+ </para>
+
+ <para>Wer nicht so tief in die Materie einsteigen will oder leicht zu frustrieren ist, sollte sein Hintergrund PDF auf Basis der
+ mitglieferten Datei <filename>sample_head.pdf</filename> erstellen, und sich an der Form der dargestellten Tabellen wie sie
+ ausgeliefert werden, erfreuen.
+ </para>
+
+ <para>Kleiner Tipp: Nicht zu viel auf einmal wollen, lieber kleine kontinuierliche Schritte gehen.</para>
+
+ </sect3>
+
+ <sect3 id="f-tex-Bruttopreise">
+ <title>Bruttopreise für Endverbraucher</title>
+
+ <para>Der auszuweisende Bruttopreis wird innerhalb der LaTeX-Umgebung berechnet. Es gibt zwar ein Feld, um bei Aufträgen "alle
+ Preise Brutto" auszuwählen, aber:</para>
+ <itemizedlist>
+ <listitem>
+ <para>hierfür müssen die Preise auch in Brutto in der Datenbank stehen (ja - das lässt sich über die Preisgruppen und die
+ Zuordung einer Default-Preisgruppe handhaben)</para>
+ </listitem>
+ <listitem>
+ <para>man darf beim Anlegen des Vorgangs nicht vergessen Dieses Häkchen zu setzen. (das ist in der Praxis wenn man sowohl
+ Endverbraucher- wie Gewerbekunden beliefert der eigentliche Knackpunkt)</para>
+ </listitem>
+ </itemizedlist>
+
+ <para>
+ Es gibt mit f-tex eine weitere Alternative. Die Information ob Brutto oder Nettorechnung wird mit den Zahlarten
+ verknüpft. Zahlarten bei denen Rechnungen, Angebote, etc, in Brutto ausgegeben werden sollen, enden mit "_E" (für
+ Endverbraucher). Falls identische Zahlarten für Gewerbekunden und Endverbraucher vorhanden sind, legt man diese einfach doppelt
+ an (einmal mit der Namensendung "_E"). Gewinn:</para>
+
+ <itemizedlist>
+ <listitem><para>Die Entscheidung, ob Netopreise ausgewiesen werden, ist nicht mehr fix mit einer Preisliste Verbunden.</para></listitem>
+ <listitem><para>Die Default-Zahlart kann im Kundendatensatz hinterlegt werden, und man muss nicht mehr daran denken, "alle Preise
+ Netto" auszuwählen.</para></listitem>
+ <listitem><para>Die Entscheidung, ob Netto- oder Bruttopreise ausgewiesen werden, kann direkt beim Drucken reviediert werden,
+ ohne dass sich der Auftragswert ändert.</para></listitem>
+ </itemizedlist>
+ </sect3>
+
+ <sect3 id="f-tex-lieferadressen">
+ <title>Lieferadressen</title>
+
+ <para>In Lieferscheinen kommen <varname>shipto*</varname>-Variablen im Adressfeld zum Einsatz. Wenn die
+ <varname>shipto*</varname>-Variable leer ist, wird die entsprechende Adressvariable eingesetzt. Wenn also die Lieferadresse in
+ Straße, Hausnummer und Ort abweicht, müssen auch nur diese Felder in der Lieferadresse ausgefüllt werden. Für den Firmenname wird
+ der Wert der Hauptadresse angezeigt.
+ </para>
+ </sect3>
+ </sect2>
+
+ <sect2 id="Vorlagen-RB">
+ <title>RB</title>
+
+ <para>Vollständiger Dokumentensatz mit alternativem Design</para>
+
+ </sect2>
+
+ <sect2 id="allgemeine-hinweise-zu-latex">
+ <title>Allgemeine Hinweise zu LaTeX Vorlagen</title>
+ <para>In den allermeisten Installationen sollte drucken jetzt schon
+ funktionieren. Sollte ein Fehler auftreten wirft TeX sehr lange
+ Fehlerbeschreibungen, der eigentliche Fehler ist immer die erste Zeite
+ die mit einem Ausrufezeichen anfängt. Häufig auftretende Fehler sind zum
+ Beispiel:</para>
+
+ <itemizedlist>
+ <listitem>
+ <para>! LaTeX Error: File `eurosym.sty' not found. Die entsprechende
+ LaTeX-Bibliothek wurde nicht gefunden. Das tritt vor allem bei
+ Vorlagen aus der Community auf. Installieren Sie die entsprechenden
+ Pakete.</para>
+ </listitem>
+ <listitem>
+ <para>! Package inputenc Error: Unicode char \u8:... set up for
+ use with LaTeX. Dieser Fehler tritt auf, wenn sie versuchen mit
+ einer Standardinstallation exotische utf8 Zeichen zu drucken.
+ TeXLive unterstützt von Haus nur romanische Schriften und muss mit
+ diversen Tricks dazu gebracht werden andere Zeichen zu akzeptieren.
+ Adere TeX Systeme wie XeTeX schaffen hier Abhilfe.</para>
+ </listitem>
+ </itemizedlist>
+
+ <para>Wird garkein Fehler angezeigt sondern nur der Name des Templates,
+ heißt das normalerweise, dass das LaTeX Binary nicht gefunden wurde.
+ Prüfen Sie den Namen in der Konfiguration (Standard:
+ <literal>pdflatex</literal>), und stellen Sie sicher, dass pdflatex
+ (oder das von Ihnen verwendete System) vom Webserver ausgeführt werden
+ darf.</para>
+
+ <para>Wenn sich das Problem nicht auf Grund der ausgabe im Webbrowser verifizieren lässt:</para>
+ <itemizedlist>
+ <listitem>
+ <para> editiere [kivitendo-home]/config/kivitendo.conf und ändere "keep_tmp_files" auf 1</para>
+ <para><programlisting>keep_temp_files = 1;</programlisting></para>
+ </listitem>
+ <listitem>
+ <para>bei fastcgi oder mod_perl den Webserver neu Starten</para>
+ </listitem>
+ <listitem>
+ <para>Nochmal einen Druckversuch im Webfrontend auslösen</para>
+ </listitem>
+ <listitem>
+ <para>wechsele in das users Verzeichnis von kivitendo</para>
+ <para><programlisting>cd [kivitendo-home]/users</programlisting></para>
+ </listitem>
+ <listitem>
+ <para>LaTeX Suchpfad anpassen:</para>
+ <para><programlisting>export TEXINPUTS=".:[kivitendo-home]/templates/[aktuelles_template_verzeichniss]:"</programlisting></para>
+ </listitem>
+ <listitem>
+ <para>Finde herraus welche Datei kivitendo beim letzten Durchlauf erstellt hat</para>
+ <para><programlisting>ls -lahtr ./1*.tex</programlisting></para>
+ <para>Es sollte die letzte Datei ganz unten sein</para>
+ </listitem>
+ <listitem>
+ <para>für besseren Hinweis auf Fehler texdatei nochmals übersetzen</para>
+ <para><programlisting>pdflatex ./1*.tex</programlisting></para>
+ <para>in der *.tex datei nach dem Fehler suchen.</para>
+ </listitem>
+ </itemizedlist>
+ </sect2>
</sect1>
<sect1 id="OpenDocument-Vorlagen">
xreflabel="Einführung in die Konfiguration zur EUR">
<title>Einführung</title>
- <para>kivitendo besaß bis inklusive Version 2.6.3 einen
- Konfigurationsparameter namens <varname>eur</varname>, der sich in der
- Konfigurationsdatei <filename>config/lx_office.conf</filename>
- befand. Somit galt er für alle Mandanten, die in dieser Installation
- benutzt wurden.</para>
+ <para>kivitendo besaß bis inklusive Version 2.6.3 einen Konfigurationsparameter namens <varname>eur</varname>, der sich in der
+ Konfigurationsdatei <filename>config/kivitendo.conf</filename> (damals noch <filename>config/lx_office.conf</filename>)
+ befand. Somit galt er für alle Mandanten, die in dieser Installation benutzt wurden.</para>
<para>Mit der nachfolgenden Version wurde der Parameter zum Einen in
die Mandantendatenbank verschoben und dabei auch gleich in drei
ändert.</para>
<para>Die aktuelle Konfiguration wird unter Nummernkreise und
- Standardkonten unter dem neuen Punkt "Einstellungen" angezeigt
- (read-only). Eine spätere Änderung ist für einen bestehenden Mandanten
- nicht mehr möglich. Dies war auch vorher nicht möglich, bzw.
- vorhandene Daten wurden so belassen und haben damit die Ergebnisse
- verfälscht.</para>
+ Standardkonten unter dem neuen Punkt "Einstellungen" (read-only)
+ angezeigt. Unter <guimenu>System</guimenu>
+ -> <guisubmenu>Mandantenkonfiguration</guisubmenu> können
+ die Einstellungen auch geändert werden. Dabei ist zu beachten,
+ dass eine Änderung vorhandene Daten so belässt und damit
+ evtl. die Ergebnisse verfälscht. Dies gilt vor Allem für die
+ Warenbuchungsmethode (siehe auch
+ <link linkend="config.eur.inventory-system-perpetual">
+ Bemerkungen zu Bestandsmethode</link>).</para>
</sect2>
<sect2 id="config.eur.inventory-system-perpetual">
</sect2>
</sect1>
+ <sect1 id="config.client">
+ <title>Einstellungen pro Mandant</title>
+
+ <para>Einige Einstellungen können von einem Benutzer mit dem
+ <link linkend="Zusammenhänge">Recht</link> "Administration
+ (Für die Verwaltung der aktuellen Instanz aus einem Userlogin heraus)"
+ gemacht werden. Diese Einstellungen sind dann für die aktuellen
+ Mandanten-Datenbank gültig. Die Einstellungen sind
+ unter <guimenu>System</guimenu>
+ -> <guisubmenu>Mandantenkonfiguration</guisubmenu> erreichbar.</para>
+
+ <para>Bitte beachten Sie die Hinweise zu den einzelnen
+ Einstellungen. Einige Einstellungen sollten nicht ohne Weiteres
+ im laufenden Betrieb geändert werden (siehe
+ auch <link linkend="config.eur.inventory-system-perpetual">Bemerkungen zu
+ Bestandsmethode</link>).</para>
+
+ <para>Die Einstellungen <literal>show_bestbefore</literal>
+ und <literal>payments_changeable</literal> aus dem
+ Abschnitt <literal>features</literal> und die Einstellungen im
+ Abschnitt <literal>datev_check</literal> (sofern schon vorhanden)
+ der <link linkend="config.config-file">kivitendo-Konfigurationsdatei</link>
+ werden bei einem Datenbankupdate einer älteren Version automatisch
+ übernommen. Diese Einträge können danach aus der Konfigurationsdatei
+ entfernt werden.</para>
+ </sect1>
+
<sect1 id="kivitendo-ERP-verwenden">
<title>kivitendo ERP verwenden</title>
dem Kürzel das im Dateinamen verwendetet wird.</para>
</listitem>
</varlistentry>
+
+ <varlistentry>
+ <term><varname>template_meta.tmpfile</varname></term>
+
+ <listitem>
+ <para>Datei-Prefix für temporäre Dateien.</para>
+ </listitem>
+ </varlistentry>
</variablelist>
</sect3>
und dem "end" werden nur ausgegeben, wenn die Variable
<varname>variablenname</varname> gesetzt und ungleich 0 ist.</para>
+ <para>Handelt es sich bei der benannten Variable um ein Array, also um einen Variablennamen, über den man mit
+ <command><%foreach variablenname%></command> iteriert, so wird mit diesem Konstrukt darauf getestet, ob das Array Elemente
+ enthält. Somit würde im folgenden Beispiel nur dann eine Liste von Zahlungseingängen samt ihrer Überschrift "Zahlungseingänge"
+ ausgegeben, wenn tatsächlich welche getätigt wurden:</para>
+
+ <programlisting><%if payment%>
+Zahlungseingänge:
+ <%foreach payment%>
+ Am <%paymentdate%>: <%payment%> €
+ <%end foreach%>
+<%end if%></programlisting>
+
<para>Die Bedingung kann auch negiert werden, indem das Wort
<function>not</function> nach dem <filename>if</filename> verwendet
wird. Beispiel:</para>
</sect2>
</sect1>
+ <sect1 id="devel.testsuite">
+ <title>Die kivitendo-Test-Suite</title>
+
+ <sect2 id="devel.testsuite.intro">
+ <title>Einführung</title>
+
+ <para>kivitendo enthält eine Suite für automatisierte Tests. Sie basiert auf dem Standard-Perl-Modul <literal>Test::More</literal>.</para>
+
+ <para>Die grundlegenden Fakten sind:</para>
+
+ <itemizedlist>
+ <listitem><para>Alle Tests liegen im Unterverzeichnis <filename>t/</filename>.</para></listitem>
+
+ <listitem><para>Ein Script (bzw. ein Test) in <filename>f/</filename> enthält einen oder mehrere Testfälle.</para></listitem>
+
+ <listitem><para>Alle Dateinamen von Tests enden auf <literal>.t</literal>. Es sind selbstständig ausführbare Perl-Scripte.</para></listitem>
+
+ <listitem><para>Die Test-Suite besteht aus der Gesamtheit aller Tests, sprich aller Scripte in <filename>f/</filename>, deren
+ Dateiname auf <literal>.t</literal> endet.</para></listitem>
+ </itemizedlist>
+ </sect2>
+
+ <sect2 id="devel.testsuite.prerequisites">
+ <title>Voraussetzungen</title>
+
+ <para>Für die Ausführung werden neben den für kivitendo eh schon benötigten Module noch weitere Perl-Module benötigt. Diese sind:</para>
+
+ <itemizedlist>
+ <listitem><para><literal>Test::Deep</literal> (Debian-Paketname: <literal>libtest-deep-perl</literal>; Fedora Core:
+ <literal>perl-Test-Deep</literal>; openSuSE: <literal>perl-Test-Deep</literal>)</para></listitem>
+ <listitem><para><literal>Test::Harness</literal> 3.0.0 oder höher. Dieses Modul ist ab Perl 5.10.1 Bestandteil der
+ Perl-Distribution und kann für frühere Versionen aus dem <ulink url="http://www.cpan.org">CPAN</ulink> bezogen
+ werden.</para></listitem>
+ </itemizedlist>
+ </sect2>
+
+ <sect2 id="devel.testsuite.execution">
+ <title>
+ Existierende Tests ausführen
+ </title>
+
+ <para>Es gibt mehrere Möglichkeiten zum Ausführen der Tests: entweder, man lässt alle Tests auf einmal ausführen, oder man führt
+ gezielt einzelne Scripte aus. Für beide Fälle gibt es das Helferscript <filename>t/test.sh</filename>.</para>
+
+ <para>Will man die komplette Test-Suite ausführen, so muss man einfach nur <filename>t/test.sh</filename> ohne weitere Parameter aus
+ dem kivitendo-Basisverzeichnis heraus ausführen.</para>
+
+ <para>Um einzelne Test-Scripte auszuführen, übergibt man deren Namen an <filename>t/test.sh</filename>. Beispielsweise:</para>
+
+ <programlisting>t/test.sh t/form/format_amount.t t/background_job/known_jobs.t</programlisting>
+ </sect2>
+
+
+ <sect2 id="devel.testsuite.meaning_of_scripts">
+ <title>
+ Bedeutung der verschiedenen Test-Scripte
+ </title>
+
+ <para>Die Test-Suite umfasst Tests sowohl für Funktionen als auch für Programmierstil. Einige besonders zu erwähnende, weil auch
+ während der Entwicklung nützliche Tests sind:</para>
+
+ <itemizedlist>
+ <listitem><para><filename>t/001compile.t</filename> -- compiliert alle Quelldateien und bricht bei Fehlern sofort ab</para></listitem>
+ <listitem><para><filename>t/002goodperl.t</filename> -- überprüft alle Perl-Dateien auf Anwesenheit von '<literal>use strict</literal>'-Anweisungen</para></listitem>
+ <listitem><para><filename>t/003safesys.t</filename> -- überprüft Aufrufe von <function>system()</function> und <function>exec()</function> auf Gültigkeit</para></listitem>
+ <listitem><para><filename>t/005no_tabs.t</filename> -- überprüft, ob Dateien Tab-Zeichen enthalten</para></listitem>
+ <listitem><para><filename>t/006spelling.t</filename> -- sucht nach häufigen Rechtschreibfehlern</para></listitem>
+ <listitem><para><filename>t/011pod.t</filename> -- überprüft die Syntax von Dokumentation im POD-Format auf Gültigkeit</para></listitem>
+ </itemizedlist>
+
+ <para>Weitere Test-Scripte überprüfen primär die Funktionsweise einzelner Funktionen und Module.</para>
+ </sect2>
+
+ <sect2 id="devel.testsuite.create_new">
+ <title>
+ Neue Test-Scripte erstellen
+ </title>
+
+ <para>Es wird sehr gern gesehen, wenn neue Funktionalität auch gleich mit einem Test-Script abgesichert wird. Auch bestehende
+ Funktion darf und soll ausdrücklich nachträglich mit Test-Scripten abgesichert werden.</para>
+
+ <sect3 id="devel.testsuite.ideas_for_non_function_tests">
+ <title>
+ Ideen für neue Test-Scripte, die keine konkreten Funktionen testen
+ </title>
+
+ <para> Ideen, die abgesehen von Funktions noch nicht umgesetzt wurden:</para>
+
+ <itemizedlist>
+ <listitem><para>Überprüfung auf fehlende symbolische Links</para></listitem>
+ <listitem><para>Suche nach Nicht-ASCII-Zeichen in Perl-Code-Dateien (mit gewissen Einschränkungen wie das Erlauben von deutschen Umlauten)</para></listitem>
+ <listitem><para>Test auf DOS-Zeilenenden (\r\n anstelle von nur \n)</para></listitem>
+ <listitem><para>Überprüfung auf Leerzeichen am Ende von Zeilen</para></listitem>
+ <listitem><para>Test, ob alle zu übersetzenden Strings in <filename>locale/de/all</filename> vorhanden sind</para></listitem>
+ <listitem><para>Test, ob alle Webseiten-Templates in <filename>templates/webpages</filename> mit vom Perl-Modul <literal>Template</literal> compiliert werden können</para></listitem>
+ </itemizedlist>
+ </sect3>
+
+ <sect3 id="devel.testsuite.directory_and_test_names">
+ <title>
+ Konvention für Verzeichnis- und Dateinamen
+ </title>
+
+ <para>Es gibt momentan eine wenige Richtlinien, wie Test-Scripte zu benennen sind. Bitte die folgenden Punkte als Richtlinie betrachten und ihnen soweit es geht folgen:</para>
+
+ <itemizedlist>
+ <listitem><para>Die Dateiendung muss <filename>.t</filename> lauten.</para></listitem>
+
+ <listitem><para>Namen sind englisch, komplett klein geschrieben und einzelne Wörter mit Unterstrichten getrennt (beispielsweise
+ <filename>bad_function_params.t</filename>).</para></listitem>
+
+ <listitem><para>Unterverzeichnisse sollten grob nach dem Themenbereich benannt sind, mit dem sich die Scripte darin befassen
+ (beispielsweise <filename>background_jobs</filename> für Tests rund um Hintergrund-Jobs).</para></listitem>
+
+ <listitem><para>Test-Scripte sollten einen überschaubaren Bereich von Funktionalität testen, der logisch zusammenhängend ist
+ (z.B. nur Tests für eine einzelne Funktion in einem Modul). Lieber mehrere Test-Scripte schreiben.</para></listitem>
+ </itemizedlist>
+ </sect3>
+
+ <sect3 id="devel.testsuite.minimal_example">
+ <title>
+ Minimales Skelett für eigene Scripte
+ </title>
+
+ <para>Der folgenden Programmcode enthält das kleinstmögliche Testscript und kann als Ausgangspunkt für eigene Tests verwendet werden:</para>
+
+ <programlisting>use Test::More tests => 0;
+
+use lib 't';
+
+use Support::TestSetup;
+
+Support::TestSetup::login();</programlisting>
+
+ <para>Wird eine vollständig initialisierte kivitendo-Umgebung benötigt (Stichwort: alle globalen Variablen wie
+ <varname>$::auth</varname>, <varname>$::form</varname> oder <varname>$::lxdebug</varname>), so muss in der Konfigurationsdatei
+ <filename>config/kivitendo.conf</filename> im Abschnitt <literal>testing.login</literal> ein gültiger Login-Name eingetragen
+ sein. Dieser wird für die Datenbankverbindung benötigt.</para>
+
+ <para>Wir keine vollständig initialisierte Umgebung benötigt, so kann die letzte Zeile <code>Support::TestSetup::login();</code>
+ weggelassen werden, was die Ausführungszeit des Scripts leicht verringert.</para>
+ </sect3>
+ </sect2>
+ </sect1>
+
<sect1 id="devel.style-guide">
<title>Stil-Richtlinien</title>
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
<title>Kapitel 1. Aktuelle Hinweise</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="next" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 1. Aktuelle Hinweise</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="index.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 1. Aktuelle Hinweise"><div class="titlepage"><div><div><h2 class="title"><a name="Aktuelle-Hinweise"></a>Kapitel 1. Aktuelle Hinweise</h2></div></div></div><p>Aktuelle Installations- und Konfigurationshinweise gibt es:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>im kivitendo-Forum: <a class="ulink" href="https://forum.kivitendo.org/" target="_top">https://forum.kivitendo.org/</a>
- </p></li><li class="listitem"><p>im alten Lx-Office-Wiki unter Dokumentation (<a class="ulink" href="http://wiki.lx-office.org/index.php?title=Installation_Lx-Office_ERP" target="_top">http://wiki.lx-office.org/index.php?title=Installation_Lx-Office_ERP</a>)</p></li></ul></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="index.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">kivitendo: Installation, Konfiguration, Entwicklung </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> Kapitel 2. Installation und Grundkonfiguration</td></tr></table></div></body></html>
\ No newline at end of file
+ </p></li></ul></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="index.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">kivitendo: Installation, Konfiguration, Entwicklung </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> Kapitel 2. Installation und Grundkonfiguration</td></tr></table></div></body></html>
\ No newline at end of file
bei der Auswahl der Pakete aber darauf Rücksicht genommen, dass es
ohne große Probleme auf den derzeit aktuellen verbreiteten
Distributionen läuft.</p><p>Mitte 2012 sind das folgende Systeme, von denen bekannt ist,
- dass kivitendo auf ihnen läuft:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Ubuntu 10.04 LTS Lucid Lynx bis 12.04 Precise Pangolin</p></li><li class="listitem"><p>Debian 5.0 Lenny und 6.0 Squeeze</p></li><li class="listitem"><p>openSUSE 11.2 und 11.3</p></li><li class="listitem"><p>SuSE Linux Enterprice Server 11</p></li><li class="listitem"><p>Fedora 13 bis 16</p></li></ul></div></div><div class="sect2" title="2.1.2. Pakete"><div class="titlepage"><div><div><h3 class="title"><a name="Pakete"></a>2.1.2. Pakete</h3></div></div></div><p>Zum Betrieb von kivitendo werden zwingend ein Webserver (meist
+ dass kivitendo auf ihnen läuft:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Debian</p><div class="itemizedlist"><ul class="itemizedlist" type="circle"><li class="listitem"><p>6.0 Squeeze (hier muss allerdings das Modul FCGI in der Version >= 0.72 compiled werden)</p></li><li class="listitem"><p>7.0 Wheezy</p></li></ul></div></li><li class="listitem"><p>Ubuntu 10.04 LTS Lucid Lynx bis 12.10 Oneiric Ocelot</p></li><li class="listitem"><p>openSUSE 11.2 und 11.3</p></li><li class="listitem"><p>SuSE Linux Enterprice Server 11</p></li><li class="listitem"><p>Fedora 13 bis 16</p></li></ul></div></div><div class="sect2" title="2.1.2. Pakete"><div class="titlepage"><div><div><h3 class="title"><a name="Pakete"></a>2.1.2. Pakete</h3></div></div></div><p>Zum Betrieb von kivitendo werden zwingend ein Webserver (meist
Apache) und ein Datenbankserver (PostgreSQL, mindestens v8.2)
benötigt.</p><p>Zusätzlich benötigt kivitendo die folgenden Perl-Pakete, die
- nicht Bestandteil einer Standard-Perl-Installation sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>parent</p></li><li class="listitem"><p>Archive::Zip</p></li><li class="listitem"><p>Config::Std</p></li><li class="listitem"><p>DateTime</p></li><li class="listitem"><p>DBI</p></li><li class="listitem"><p>DBD::Pg</p></li><li class="listitem"><p>Email::Address</p></li><li class="listitem"><p>JSON</p></li><li class="listitem"><p>List::MoreUtils</p></li><li class="listitem"><p>Params::Validate</p></li><li class="listitem"><p>PDF::API2</p></li><li class="listitem"><p>Rose::Object</p></li><li class="listitem"><p>Rose::DB</p></li><li class="listitem"><p>Rose::DB::Object</p></li><li class="listitem"><p>Template</p></li><li class="listitem"><p>Text::CSV_XS</p></li><li class="listitem"><p>Text::Iconv</p></li><li class="listitem"><p>URI</p></li><li class="listitem"><p>XML::Writer</p></li><li class="listitem"><p>YAML</p></li></ul></div><p>Gegenüber Version 2.6.0 sind zu dieser Liste 2 Pakete
+ nicht Bestandteil einer Standard-Perl-Installation sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
+ <code class="literal">parent</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Archive::Zip</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Config::Std</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">DateTime</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">DBI</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">DBD::Pg</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Email::Address</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Email::MIME</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">JSON</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">List::MoreUtils</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Net::SMTP::SSL</code> (optional, bei E-Mail-Versand über SSL; siehe Abschnitt "<a class="xref" href="ch02s09.html#config.sending-email.smtp" title="2.9.2. Versand über einen SMTP-Server">E-Mail-Versand über einen SMTP-Server</a>")</p></li><li class="listitem"><p>
+ <code class="literal">Net::SSLGlue</code> (optional, bei E-Mail-Versand über TLS; siehe Abschnitt "<a class="xref" href="ch02s09.html#config.sending-email.smtp" title="2.9.2. Versand über einen SMTP-Server">E-Mail-Versand über einen SMTP-Server</a>")</p></li><li class="listitem"><p>
+ <code class="literal">Params::Validate</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">PDF::API2</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Rose::Object</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Rose::DB</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Rose::DB::Object</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Template</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Text::CSV_XS</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">Text::Iconv</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">URI</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">XML::Writer</code>
+ </p></li><li class="listitem"><p>
+ <code class="literal">YAML</code>
+ </p></li></ul></div><p>Seit v2.7.0 sind die folgenden Pakete hinzugekommen: <code class="literal">Email::MIME</code>, <code class="literal">Net::SMTP::SSL</code>,
+ <code class="literal">Net::SSLGlue</code>.</p><p>Gegenüber Version 2.6.0 sind zu dieser Liste 2 Pakete
hinzugekommen, <code class="literal">URI</code> und
<code class="literal">XML::Writer</code> sind notwendig. Ohne startet kivitendo
nicht.</p><p>Gegenüber Version 2.6.1 sind <code class="literal">parent</code>,
installieren.</p><p>Die zu installierenden Pakete können in den verschiedenen
Distributionen unterschiedlich heißen.</p><p>Für Debian oder Ubuntu benötigen Sie diese Pakete:</p><pre class="programlisting">apt-get install apache2 postgresql libparent-perl libarchive-zip-perl \
libdatetime-perl libdbi-perl libdbd-pg-perl libpg-perl \
- libemail-address-perl liblist-moreutils-perl libpdf-api2-perl \
+ libemail-address-perl libemail-mime-perl liblist-moreutils-perl libpdf-api2-perl \
librose-object-perl librose-db-perl librose-db-object-perl \
libtemplate-perl libtext-csv-xs-perl libtext-iconv-perl liburi-perl \
libxml-writer-perl libyaml-perl libconfig-std-perl \
- libparams-validate-perl libjson-perl libclass-accessor-perl</pre><p>Für Fedora Core benötigen Sie diese Pakete:</p><pre class="programlisting">yum install httpd postgresql-server perl-parent perl-DateTime \
- perl-DBI perl-DBD-Pg perl-Email-Address perl-List-MoreUtils \
+ libparams-validate-perl libjson-perl libclass-accessor-perl \
+ libnet-sslglue-perl libnet-smtp-ssl-perl</pre><p>Für Fedora Core benötigen Sie diese Pakete:</p><pre class="programlisting">yum install httpd postgresql-server perl-parent perl-DateTime \
+ perl-DBI perl-DBD-Pg perl-Email-Address perl-Email-MIME perl-List-MoreUtils \
perl-PDF-API2 perl-Rose-Object perl-Rose-DB perl-Rose-DB-Object \
perl-Template-Toolkit perl-Text-CSV_XS perl-Text-Iconv perl-URI \
- perl-XML-Writer perl-YAML</pre><p>Für OpenSuSE benötigen Sie diese Pakete:</p><pre class="programlisting">zypper install apache2 postgresql-server perl-Archive-Zip \
- perl-DateTime perl-DBI perl-DBD-Pg perl-MailTools perl-List-MoreUtils \
+ perl-XML-Writer perl-YAML perl-Net-SSLGlue perl-Net-SMTP-SSL</pre><p>Für OpenSuSE benötigen Sie diese Pakete:</p><pre class="programlisting">zypper install apache2 postgresql-server perl-Archive-Zip \
+ perl-DateTime perl-DBI perl-DBD-Pg perl-Email-MIME perl-MailTools perl-List-MoreUtils \
perl-PDF-API2 perl-Template-Toolkit perl-Text-CSV_XS perl-Text-Iconv \
- perl-URI perl-XML-Writer perl-YAML</pre><p>Bei openSuSE 11 ist <code class="literal">parent</code> bereits enthalten,
- und braucht nicht nachinstalliert werden. Die
- <code class="literal">Rose::*</code> Pakete sind derzeit nicht für SuSE gepackt,
- und müssen anderweitig nachinstalliert werden.</p><p>kivitendo enthält ein Script, mit dem überprüft werden kann, ob
+ perl-URI perl-XML-Writer perl-YAML perl-Net-SSLGlue perl-Net-SMTP-SSL</pre><p>kivitendo enthält ein Script, mit dem überprüft werden kann, ob
alle benötigten Perl-Module installiert sind. Der Aufruf lautet wie
folgt:</p><pre class="programlisting">./scripts/installation_check.pl</pre></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch01.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch02s02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">Kapitel 1. Aktuelle Hinweise </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.2. Manuelle Installation des Programmpaketes</td></tr></table></div></body></html>
\ No newline at end of file
verwaltet.</p><p>Die Konfiguration ist ferner serverabhängig, d.h. für alle
Mandaten, bzw. Datenbanken gleich.</p></div><div class="sect2" title="2.3.2. Abschnitte und Parameter"><div class="titlepage"><div><div><h3 class="title"><a name="config.config-file.sections-parameters"></a>2.3.2. Abschnitte und Parameter</h3></div></div></div><p>Die Konfigurationsdatei besteht aus mehreren Teilen, die
entsprechend kommentiert sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
- <code class="literal">authentication</code>
- </p></li><li class="listitem"><p>
+ <code class="literal">authentication</code> (siehe Abschnitt "<a class="xref" href="ch02s07.html" title="2.7. Benutzerauthentifizierung und Administratorpasswort">Abschnitt 2.7, „Benutzerauthentifizierung und Administratorpasswort“</a>" in diesem Kapitel)</p></li><li class="listitem"><p>
<code class="literal">authentication/database</code>
</p></li><li class="listitem"><p>
<code class="literal">authentication/ldap</code>
</p></li><li class="listitem"><p>
<code class="literal">system</code>
</p></li><li class="listitem"><p>
- <code class="literal">features</code>
- </p></li><li class="listitem"><p>
+ <code class="literal">features</code> (siehe Kapitel "<a class="xref" href="ch03.html" title="Kapitel 3. Features und Funktionen">Features und Funktionen</a>")</p></li><li class="listitem"><p>
<code class="literal">paths</code>
</p></li><li class="listitem"><p>
<code class="literal">applications</code>
</p></li><li class="listitem"><p>
<code class="literal">environment</code>
</p></li><li class="listitem"><p>
+ <code class="literal">mail_delivery</code> (siehe Abschnitt "<a class="xref" href="ch02s09.html#config.sending-email.smtp" title="2.9.2. Versand über einen SMTP-Server">E-Mail-Versand über einen SMTP-Server</a>)</p></li><li class="listitem"><p>
<code class="literal">print_templates</code>
</p></li><li class="listitem"><p>
<code class="literal">task_server</code>
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.4. Anpassung der PostgreSQL-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei"><link rel="next" href="ch02s05.html" title="2.5. Webserver-Konfiguration"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.4. Anpassung der PostgreSQL-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.4. Anpassung der PostgreSQL-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Anpassung-der-PostgreSQL-Konfiguration"></a>2.4. Anpassung der PostgreSQL-Konfiguration</h2></div></div></div><p>PostgreSQL muss auf verschiedene Weisen angepasst werden.</p><div class="sect2" title="2.4.1. Zeichensätze/die Verwendung von UTF-8"><div class="titlepage"><div><div><h3 class="title"><a name="Zeichens%C3%A4tze-die-Verwendung-von-UTF-8"></a>2.4.1. Zeichensätze/die Verwendung von UTF-8</h3></div></div></div><p>kivitendo kann komplett mit UTF-8 als Zeichensatz verwendet
- werden. Dabei gibt es zwei Punkte zu beachten: PostgreSQL muss in
- Version 8.2 oder neuer benutzt werden, und der
- PostgreSQL-Datenbankcluster muss ebenfalls mit UTF-8 als Locale
- angelegt worden sein.</p><p>Dieses ist kann überprüft werden: ist das Encoding der Datenbank
- “template1” “UTF8”, so kann auch kivitendo mit UTF-8 betrieben werden.
+ <title>2.4. Anpassung der PostgreSQL-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei"><link rel="next" href="ch02s05.html" title="2.5. Webserver-Konfiguration"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.4. Anpassung der PostgreSQL-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.4. Anpassung der PostgreSQL-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Anpassung-der-PostgreSQL-Konfiguration"></a>2.4. Anpassung der PostgreSQL-Konfiguration</h2></div></div></div><p>PostgreSQL muss auf verschiedene Weisen angepasst werden.</p><div class="sect2" title="2.4.1. Zeichensätze/die Verwendung von UTF-8"><div class="titlepage"><div><div><h3 class="title"><a name="Zeichens%C3%A4tze-die-Verwendung-von-UTF-8"></a>2.4.1. Zeichensätze/die Verwendung von UTF-8</h3></div></div></div><p>Bei aktuellen Serverinstallationen braucht man hier meist nicht
+ eingreifen</p><p>Dieses kann überprüft werden: ist das Encoding der Datenbank
+ “template1” “UTF8”, so braucht man nichts weiteres diesbezüglich
+ unternehmen. Zum Testen:
+
+ </p><pre class="programlisting">su postgres
+echo '\l' | psql
+exit </pre><p>
+
Andernfalls ist es notwendig, einen neuen Datenbankcluster mit
UTF-8-Encoding anzulegen und diesen zu verwenden. Unter Debian und
Ubuntu kann dies z.B. für PostgreSQL 8.2 mit dem folgenden Befehl
was mit dem Wert <code class="literal">*</code> geschieht.</p><p>In der Datei <code class="filename">pg_hba.conf</code>, die im gleichen
Verzeichnis wie die <code class="filename">postgresql.conf</code> zu finden
sein sollte, müssen die Berichtigungen für den Zugriff geändert
- werden. Hier gibt es mehrere Möglichkeiten. Eine besteht darin, lokale
- Verbindungen immer zuzulassen:</p><pre class="programlisting">local all all trust
-host all all 127.0.0.1 255.0.0.0 trust</pre><p>Besser ist es, für eine bestimmte Datenbank Zugriff nur per
- Passwort zuzulassen. Beispielsweise:</p><pre class="programlisting">local all kivitendo password
+ werden. Hier gibt es mehrere Möglichkeiten. sinnvoll ist es nur die
+ nögiten Verbindungen immer zuzulassen, für eine lokal laufenden
+ Datenbank zum Beispiel:</p><pre class="programlisting">local all kivitendo password
host all kivitendo 127.0.0.1 255.255.255.255 password</pre></div><div class="sect2" title="2.4.3. Erweiterung für servergespeicherte Prozeduren"><div class="titlepage"><div><div><h3 class="title"><a name="Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren"></a>2.4.3. Erweiterung für servergespeicherte Prozeduren</h3></div></div></div><p>In der Datenbank <code class="literal">template1</code> muss die
Unterstützung für servergespeicherte Prozeduren eingerichet werden.
- Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an, und
- führen Sie die folgenden Kommandos aus:</p><pre class="programlisting">create language 'plpgsql';</pre></div><div class="sect2" title="2.4.4. Datenbankbenutzer anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="Datenbankbenutzer-anlegen"></a>2.4.4. Datenbankbenutzer anlegen</h3></div></div></div><p>Wenn Sie nicht den Datenbanksuperuser “postgres” zum Zugriff
+ Melden Sie sich dafür als Benutzer “postgres” an der Datenbank an:
+ </p><pre class="programlisting">su - postgres
+psql template1</pre><p>
+
+ führen Sie die folgenden Kommandos aus:</p><pre class="programlisting">create language 'plpgsql';
+\q</pre></div><div class="sect2" title="2.4.4. Datenbankbenutzer anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="Datenbankbenutzer-anlegen"></a>2.4.4. Datenbankbenutzer anlegen</h3></div></div></div><p>Wenn Sie nicht den Datenbanksuperuser “postgres” zum Zugriff
benutzen wollen, so sollten Sie bei PostgreSQL einen neuen Benutzer
anlegen. Ein Beispiel, wie Sie einen neuen Benutzer anlegen
- können:</p><pre class="programlisting">su - postgres createuser -d -P kivitendo</pre><p>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
+ können:</p><p>Die Frage, ob der neue User Superuser sein soll, können Sie mit nein
+ beantworten, genauso ist die Berechtigung neue User (Roles) zu
+ generieren nicht nötig.</p><pre class="programlisting">su - postgres
+createuser -d -P kivitendo
+exit</pre><p>Wenn Sie später einen Datenbankzugriff konfigurieren, verändern
Sie den evtl. voreingestellten Benutzer “postgres” auf “kivitendo” bzw.
den hier gewählten Benutzernamen.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s03.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s05.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.3. kivitendo-Konfigurationsdatei </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.5. Webserver-Konfiguration</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.5. Webserver-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s04.html" title="2.4. Anpassung der PostgreSQL-Konfiguration"><link rel="next" href="ch02s06.html" title="2.6. Der Task-Server"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.5. Webserver-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.5. Webserver-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Apache-Konfiguration"></a>2.5. Webserver-Konfiguration</h2></div></div></div><div class="sect2" title="2.5.1. Grundkonfiguration mittels CGI"><div class="titlepage"><div><div><h3 class="title"><a name="d0e490"></a>2.5.1. Grundkonfiguration mittels CGI</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Für einen deutlichen Performanceschub sorgt die Ausführung
+ <title>2.5. Webserver-Konfiguration</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s04.html" title="2.4. Anpassung der PostgreSQL-Konfiguration"><link rel="next" href="ch02s06.html" title="2.6. Der Task-Server"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.5. Webserver-Konfiguration</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.5. Webserver-Konfiguration"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Apache-Konfiguration"></a>2.5. Webserver-Konfiguration</h2></div></div></div><div class="sect2" title="2.5.1. Grundkonfiguration mittels CGI"><div class="titlepage"><div><div><h3 class="title"><a name="d0e592"></a>2.5.1. Grundkonfiguration mittels CGI</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Für einen deutlichen Performanceschub sorgt die Ausführung
mittels FastCGI/FCGI. Die Einrichtung wird ausführlich im Abschnitt
<a class="xref" href="ch02s05.html#Apache-Konfiguration.FCGI" title="2.5.2. Konfiguration für FastCGI/FCGI">Konfiguration für FastCGI/FCGI</a> beschrieben.</p></td></tr></table></div><p>Der Zugriff auf das Programmverzeichnis muss in der Apache
Webserverkonfigurationsdatei <code class="literal">httpd.conf</code> eingestellt
wird nur die eigentliche Programmlogik ausgeführt.</p></div><div class="sect3" title="2.5.2.3. Getestete Kombinationen aus Webservern und Plugin"><div class="titlepage"><div><div><h4 class="title"><a name="Apache-Konfiguration.FCGI.WebserverUndPlugin"></a>2.5.2.3. Getestete Kombinationen aus Webservern und Plugin</h4></div></div></div><p>Folgende Kombinationen sind getestet:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Apache 2.2.11 (Ubuntu) und mod_fcgid.</p></li><li class="listitem"><p>Apache 2.2.11 (Ubuntu) und mod_fastcgi.</p></li></ul></div><p>Dabei wird mod_fcgid empfohlen, weil mod_fastcgi seit geraumer
Zeit nicht mehr weiter entwickelt wird. Im Folgenden wird auf
mod_fastcgi nicht mehr explizit eingegangen.</p><p>Als Perl Backend wird das Modul <code class="filename">FCGI.pm</code>
- verwendet.</p><div class="warning" title="Warnung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Warning"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Warnung]" src="../../../../system/docbook-xsl/images/warning.png"></td><th align="left">Warnung</th></tr><tr><td align="left" valign="top"><p>FCGI 0.69 und höher ist extrem strict in der Behandlung von
- Unicode, und verweigert bestimmte Eingaben von kivitendo. Falls es
- Probleme mit Umlauten in Ihrere Installation gibt, muss auf die
- Vorgängerversion FCGI 0.68 ausgewichen werden.</p><p>Mit CPAN lässt sie sich die Vorgängerversion wie folgt
+ verwendet.</p><div class="warning" title="Warnung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Warning"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Warnung]" src="../../../../system/docbook-xsl/images/warning.png"></td><th align="left">Warnung</th></tr><tr><td align="left" valign="top"><p>FCGI-Versionen ab 0.69 und bis zu 0.71 inklusive sind extrem strict in der Behandlung von Unicode, und verweigern
+ bestimmte Eingaben von kivitendo. Falls es Probleme mit Umlauten in Ihrere Installation gibt, muss zwingend Version 0.68 oder
+ aber Version 0.72 und neuer eingesetzt werden.</p><p>Mit <a class="ulink" href="http://www.cpan.org" target="_top">CPAN</a> lässt sie sich die Vorgängerversion wie folgt
installieren:</p><pre class="programlisting">force install M/MS/MSTROUT/FCGI-0.68.tar.gz</pre></td></tr></table></div></div><div class="sect3" title="2.5.2.4. Konfiguration des Webservers"><div class="titlepage"><div><div><h4 class="title"><a name="Apache-Konfiguration.FCGI.Konfiguration"></a>2.5.2.4. Konfiguration des Webservers</h4></div></div></div><p>Bevor Sie versuchen, eine kivitendo Installation unter FCGI
laufen zu lassen, empfliehlt es sich die Installation ersteinmal
unter CGI aufzusetzen. FCGI macht es nicht einfach Fehler zu
Links aus einem der Runlevel-Verzeichnisse heraus in den Boot-Prozess
einzubinden. Da das bei neueren Linux-Distributionen aber nicht
zwangsläufig funktioniert, werden auch Start-Scripte mitgeliefert, die
- anstelle eines symbolischen Links verwendet werden können.</p><div class="sect3" title="2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora Core)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e674"></a>2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora
+ anstelle eines symbolischen Links verwendet werden können.</p><div class="sect3" title="2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora Core)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e779"></a>2.6.2.1. SystemV-basierende Systeme (z.B. Debian, OpenSuSE, Fedora
Core)</h4></div></div></div><p>Kopieren Sie die Datei
<code class="filename">scripts/boot/system-v/kivitendo-server</code>
nach <code class="filename">/etc/init.d/kivitendo-server</code>. Passen
insserv kivitendo-task-server</pre></li><li class="listitem"><p>OpenSuSE und Fedora Core:</p><pre class="programlisting">chkconfig --add kivitendo-task-server</pre></li></ul></div><p>Danach kann der Task-Server mit dem folgenden Befehl gestartet
werden: <span class="command"><strong>/etc/init.d/kivitendo-task-server
start</strong></span>
- </p></div><div class="sect3" title="2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e704"></a>2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)</h4></div></div></div><p>Kopieren Sie die Datei
+ </p></div><div class="sect3" title="2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)"><div class="titlepage"><div><div><h4 class="title"><a name="d0e809"></a>2.6.2.2. Upstart-basierende Systeme (z.B. Ubuntu)</h4></div></div></div><p>Kopieren Sie die Datei
<code class="filename">scripts/boot/upstart/kivitendo-task-server.conf</code>
nach <code class="filename">/etc/init/kivitendo-task-server.conf</code>.
Passen Sie in der kopierten Datei den Pfad zum Task-Server an (Zeile
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.8. Benutzer- und Gruppenverwaltung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s07.html" title="2.7. Benutzerauthentifizierung und Administratorpasswort"><link rel="next" href="ch02s09.html" title="2.9. Drucken mit kivitendo"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.8. Benutzer- und Gruppenverwaltung</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s07.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s09.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.8. Benutzer- und Gruppenverwaltung"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Benutzer--und-Gruppenverwaltung"></a>2.8. Benutzer- und Gruppenverwaltung</h2></div></div></div><p>Nach der Installation müssen Benutzer, Gruppen und Datenbanken
+ <title>2.8. Benutzer- und Gruppenverwaltung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s07.html" title="2.7. Benutzerauthentifizierung und Administratorpasswort"><link rel="next" href="ch02s09.html" title="2.9. E-Mail-Versand aus kivitendo heraus"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.8. Benutzer- und Gruppenverwaltung</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s07.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s09.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.8. Benutzer- und Gruppenverwaltung"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Benutzer--und-Gruppenverwaltung"></a>2.8. Benutzer- und Gruppenverwaltung</h2></div></div></div><p>Nach der Installation müssen Benutzer, Gruppen und Datenbanken
angelegt werden. Dieses geschieht im Administrationsmenü, das Sie unter
folgender URL finden:</p><p>
<a class="ulink" href="http://localhost/kivitendo-erp/admin.pl" target="_top">http://localhost/kivitendo-erp/admin.pl</a>
Funktionen von kivitendo gewährt. Alle migrierten Benutzern werden
Mitglied in dieser Gruppe. Damit wird das Verhalten von kivitendo bis
Version 2.4.3 inklusive wiederhergestellt, und die Benutzer können
- sich sofort wieder anmelden und mit dem System arbeiten.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s07.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s09.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.7. Benutzerauthentifizierung und Administratorpasswort </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.9. Drucken mit kivitendo</td></tr></table></div></body></html>
\ No newline at end of file
+ sich sofort wieder anmelden und mit dem System arbeiten.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s07.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s09.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.7. Benutzerauthentifizierung und Administratorpasswort </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.9. E-Mail-Versand aus kivitendo heraus</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.9. Drucken mit kivitendo</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s08.html" title="2.8. Benutzer- und Gruppenverwaltung"><link rel="next" href="ch02s10.html" title="2.10. OpenDocument-Vorlagen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.9. Drucken mit kivitendo</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s08.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s10.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.9. Drucken mit kivitendo"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Drucken-mit-kivitendo"></a>2.9. Drucken mit kivitendo</h2></div></div></div><p>Das Drucksystem von kivitendo benutzt von Haus aus LaTeX Vorlagen.
- Um drucken zu können, braucht der Server ein geeignetes LaTeX System. Am
- einfachsten ist dazu eine <code class="literal">texlive</code> Installation. Unter
- Debianoiden Betriebssystemen sind das die Pakete:</p><p>
- <code class="literal">texlive-latex-base texlive-latex-extra
- texlive-fonts-recommended</code>
- </p><p>Diese hinteren beiden enthalten Bibliotheken und Schriftarten die
- von den Standardvorlagen verwendet werden.</p><p>TODO: rpm Pakete.</p><p>In den allermeisten Installationen sollte drucken jetzt schon
- funktionieren. Sollte ein Fehler auftreten wirft TeX sehr lange
- Fehlerbeschreibungen, der eigentliche Fehler ist immer die erste Zeite
- die mit einem Ausrufezeichen anfängt. Häufig auftretende Fehler sind zum
- Beispiel:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>! LaTeX Error: File `eurosym.sty' not found. Die entsprechende
- LaTeX-Bibliothek wurde nicht gefunden. Das tritt vor allem bei
- Vorlagen aus der Community auf. Installieren Sie die entsprechenden
- Pakete.</p></li><li class="listitem"><p>! Package inputenc Error: Unicode char \u8:æ¡\9c not set up for
- use with LaTeX. Dieser Fehler tritt auf, wenn sie versuchen mit
- einer Standardinstallation exotische utf8 Zeichen zu drucken.
- TeXLive unterstützt von Haus nur romanische Schriften und muss mit
- diversen Tricks dazu gebracht werden andere Zeichen zu akzeptieren.
- Adere TeX Systeme wie XeTeX schaffen hier Abhilfe.</p></li></ul></div><p>Wird garkein Fehler angezeigt sondern nur der Name des Templates,
- heißt das normalerweise, dass das LaTeX Binary nicht gefunden wurde.
- Prüfen Sie den Namen in der Konfiguration (Standard:
- <code class="literal">pdflatex</code>), und stellen Sie sicher, dass pdflatex
- (oder das von Ihnen verwendete System) vom Webserver ausgeführt werden
- darf.</p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s08.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s10.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.8. Benutzer- und Gruppenverwaltung </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.10. OpenDocument-Vorlagen</td></tr></table></div></body></html>
\ No newline at end of file
+ <title>2.9. E-Mail-Versand aus kivitendo heraus</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s08.html" title="2.8. Benutzer- und Gruppenverwaltung"><link rel="next" href="ch02s10.html" title="2.10. Drucken mit kivitendo"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.9. E-Mail-Versand aus kivitendo heraus</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s08.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s10.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.9. E-Mail-Versand aus kivitendo heraus"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.sending-email"></a>2.9. E-Mail-Versand aus kivitendo heraus</h2></div></div></div><p>kivitendo kann direkt aus dem Programm heraus E-Mails versenden, z.B. um ein Angebot direkt an einen Kunden zu
+ verschicken. Damit dies funktioniert, muss eingestellt werden, über welchen Server die E-Mails verschickt werden sollen. kivitendo
+ unterstützt dabei zwei Mechanismen: Versand über einen lokalen E-Mail-Server (z.B. mit <span class="productname">Postfix</span>™ oder
+ <span class="productname">Exim</span>™, was auch die standardmäßig aktive Methode ist) sowie Versand über einen SMTP-Server (z.B. der des
+ eigenen Internet-Providers).</p><p>Welche Methode und welcher Server verwendet werden, wird über die Konfigurationsdatei <code class="filename">config/kivitendo.conf</code>
+ festgelegt. Dort befinden sich alle Einstellungen zu diesem Thema im Abschnitt '<code class="literal">[mail_delivery]</code>'.</p><div class="sect2" title="2.9.1. Versand über lokalen E-Mail-Server"><div class="titlepage"><div><div><h3 class="title"><a name="config.sending-email.sendmail"></a>2.9.1. Versand über lokalen E-Mail-Server</h3></div></div></div><p>Diese Methode bietet sich an, wenn auf dem Server, auf dem kivitendo läuft, bereits ein funktionsfähiger E-Mail-Server wie
+ z.B. <span class="productname">Postfix</span>™, <span class="productname">Exim</span>™ oder <span class="productname">Sendmail</span>™ läuft.</p><p>Um diese Methode auszuwählen, muss der Konfigurationsparameter '<code class="literal">method = sendmail</code>' gesetzt sein. Dies ist
+ gleichzeitig der Standardwert, falls er nicht verändert wird.</p><p>Um zu kontrollieren, wie das Programm zum Einliefern gestartet wird, dient der Parameter '<code class="literal">sendmail =
+ ...</code>'. Der Standardwert verweist auf das Programm <code class="filename">/usr/bin/sendmail</code>, das bei allen oben genannten
+ E-Mail-Serverprodukten für diesen Zweck funktionieren sollte.</p><p>Die Konfiguration des E-Mail-Servers selber würde den Rahmen dieses sprengen. Hierfür sei auf die Dokumentation des
+ E-Mail-Servers verwiesen.</p></div><div class="sect2" title="2.9.2. Versand über einen SMTP-Server"><div class="titlepage"><div><div><h3 class="title"><a name="config.sending-email.smtp"></a>2.9.2. Versand über einen SMTP-Server</h3></div></div></div><p>Diese Methode bietet sich an, wenn kein lokaler E-Mail-Server vorhanden oder zwar einer vorhanden, dieser aber nicht
+ konfiguriert ist.</p><p>Um diese Methode auszuwählen, muss der Konfigurationsparameter '<code class="literal">method = smtp</code>' gesetzt sein. Die folgenden
+ Parameter dienen dabei der weiteren Konfiguration:</p><div class="variablelist"><dl><dt><span class="term">
+ <code class="varname">hostname</code>
+ </span></dt><dd><p>Name oder IP-Adresse des SMTP-Servers. Standardwert: '<code class="literal">localhost</code>'</p></dd><dt><span class="term">
+ <code class="varname">port</code>
+ </span></dt><dd><p>Portnummer. Der Standardwert hängt von der verwendeten Verschlüsselungsmethode ab. Gilt '<code class="literal">security =
+ none</code>' oder '<code class="literal">security = tls</code>', so ist 25 die Standardportnummer. Für '<code class="literal">security =
+ ssl</code>' ist 465 die Portnummer. Muss normalerweise nicht geändert werden.</p></dd><dt><span class="term">
+ <code class="varname">security</code>
+ </span></dt><dd><p>Wahl der zu verwendenden Verschlüsselung der Verbindung mit dem Server. Standardwert ist
+ '<code class="literal">none</code>', wodurch keine Verschlüsselung verwendet wird. Mit '<code class="literal">tls</code>' wird TLS-Verschlüsselung
+ eingeschaltet, und mit '<code class="literal">ssl</code>' wird Verschlüsselung via SSL eingeschaltet. Achtung: Für
+ '<code class="literal">tls</code>' und '<code class="literal">ssl</code>' werden zusätzliche Perl-Module benötigt (siehe unten).</p></dd><dt><span class="term">
+ <code class="varname">login</code> und <code class="varname">password</code>
+ </span></dt><dd><p>Falls der E-Mail-Server eine Authentifizierung verlangt, so können mit diesen zwei Parametern der Benutzername
+ und das Passwort angegeben werden. Wird Authentifizierung verwendet, so sollte aus Sicherheitsgründen auch eine Form von
+ Verschlüsselung aktiviert werden.</p></dd></dl></div><p>Wird Verschlüsselung über TLS oder SSL aktiviert, so werden zusätzliche Perl-Module benötigt. Diese sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>TLS-Verschlüsselung: Modul <code class="literal">Net::SSLGlue</code> (Debian-Paketname
+ <code class="literal">libnet-sslglue-perl</code>, Fedora Core: <code class="literal">perl-Net-SSLGlue</code>, openSuSE:
+ <code class="literal">perl-Net-SSLGlue</code>
+ </p></li><li class="listitem"><p>SSL-Verschlüsselung: Modul <code class="literal">Net::SMTP::SSL</code> (Debian-Paketname
+ <code class="literal">libnet-smtp-ssl-perl</code>, Fedora Core: <code class="literal">perl-Net-SMTP-SSL</code>, openSuSE:
+ <code class="literal">perl-Net-SMTP-SSL</code>
+ </p></li></ul></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s08.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s10.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.8. Benutzer- und Gruppenverwaltung </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.10. Drucken mit kivitendo</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.10. OpenDocument-Vorlagen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s09.html" title="2.9. Drucken mit kivitendo"><link rel="next" href="ch02s11.html" title="2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.10. OpenDocument-Vorlagen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s09.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s11.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.10. OpenDocument-Vorlagen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="OpenDocument-Vorlagen"></a>2.10. OpenDocument-Vorlagen</h2></div></div></div><p>kivitendo unterstützt die Verwendung von Vorlagen im
- OpenDocument-Format, wie es OpenOffice.org ab Version 2 erzeugt.
- kivitendo kann dabei sowohl neue OpenDocument-Dokumente als auch aus
- diesen direkt PDF-Dateien erzeugen. Um die Unterstützung von
- OpenDocument-Vorlagen zu aktivieren muss in der Datei
- <code class="filename">config/kivitendo.conf</code> die Variable
- <code class="literal">opendocument</code> im Abschnitt
- <code class="literal">print_templates</code> auf ‘<code class="literal">1</code>’ stehen.
- Dieses ist die Standardeinstellung.</p><p>Weiterhin muss in der Datei
- <code class="filename">config/kivitendo.conf</code> die Variable
- <code class="literal">dbcharset</code> im Abschnitt <code class="literal">system</code> auf
- die Zeichenkodierung gesetzt werden, die auch bei der Speicherung der
- Daten in der Datenbank verwendet wird. Diese ist in den meisten Fällen
- "UTF-8".</p><p>Während die Erzeugung von reinen OpenDocument-Dateien keinerlei
- weitere Software benötigt, wird zur Umwandlung dieser Dateien in PDF
- OpenOffice.org benötigt. Soll dieses Feature genutzt werden, so muss
- neben OpenOffice.org ab Version 2 auch der “X virtual frame buffer”
- (xvfb) installiert werden. Bei Debian ist er im Paket “xvfb” enthalten.
- Andere Distributionen enthalten ihn in anderen Paketen.</p><p>Nach der Installation müssen in der Datei
- <code class="filename">config/kivitendo.conf</code> zwei weitere Variablen
- angepasst werden: <code class="literal">openofficeorg_writer</code> muss den
- vollständigen Pfad zur OpenOffice.org Writer-Anwendung enthalten.
- <code class="literal">xvfb</code> muss den Pfad zum “X virtual frame buffer”
- enthalten. Beide stehen im Abschnitt
- <code class="literal">applications</code>.</p><p>Zusätzlich gibt es zwei verschiedene Arten, wie kivitendo mit
- OpenOffice kommuniziert. Die erste Variante, die benutzt wird, wenn die
- Variable <code class="literal">$openofficeorg_daemon</code> gesetzt ist, startet
- ein OpenOffice, das auch nach der Umwandlung des Dokumentes gestartet
- bleibt. Bei weiteren Umwandlungen wird dann diese laufende Instanz
- benutzt. Der Vorteil ist, dass die Zeit zur Umwandlung deutlich
- reduziert wird, weil nicht für jedes Dokument ein OpenOffice gestartet
- werden muss. Der Nachteil ist, dass diese Methode Python und die
- Python-UNO-Bindings benötigt, die Bestandteil von OpenOffice 2
- sind.</p><p>Ist <code class="literal">$openofficeorg_daemon</code> nicht gesetzt, so
- wird für jedes Dokument OpenOffice neu gestartet und die Konvertierung
- mit Hilfe eines Makros durchgeführt. Dieses Makro muss in der
- Dokumentenvorlage enthalten sein und
- “Standard.Conversion.ConvertSelfToPDF()” heißen. Die Beispielvorlage
- ‘<code class="literal">templates/mastertemplates/German/invoice.odt</code>’
- enthält ein solches Makro, das in jeder anderen Dokumentenvorlage
- ebenfalls enthalten sein muss.</p><p>Als letztes muss herausgefunden werden, welchen Namen
- OpenOffice.org Writer dem Verzeichnis mit den Benutzereinstellungen
- gibt. Unter Debian ist dies momentan
- <code class="literal">~/.openoffice.org2</code>. Sollte der Name bei Ihrer
- OpenOffice.org-Installation anders sein, so muss das Verzeichnis
- <code class="literal">users/.openoffice.org2</code> entsprechend umbenannt werden.
- Ist der Name z.B. einfach nur <code class="literal">.openoffice</code>, so wäre
- folgender Befehl auszuführen:</p><p>
- <code class="literal">mv users/.openoffice.org2
- users/.openoffice</code>
- </p><p>Dieses Verzeichnis, wie auch das komplette
- <code class="literal">users</code>-Verzeichnis, muss vom Webserver beschreibbar
- sein. Dieses wurde bereits erledigt (siehe <a class="xref" href="ch02s02.html" title="2.2. Manuelle Installation des Programmpaketes">Manuelle Installation des Programmpaketes</a>), kann aber
- erneut überprüft werden, wenn die Konvertierung nach PDF
- fehlschlägt.</p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s09.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s11.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.9. Drucken mit kivitendo </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
- EUR</td></tr></table></div></body></html>
\ No newline at end of file
+ <title>2.10. Drucken mit kivitendo</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s09.html" title="2.9. E-Mail-Versand aus kivitendo heraus"><link rel="next" href="ch02s11.html" title="2.11. OpenDocument-Vorlagen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.10. Drucken mit kivitendo</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s09.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s11.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.10. Drucken mit kivitendo"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="Drucken-mit-kivitendo"></a>2.10. Drucken mit kivitendo</h2></div></div></div><p>Das Drucksystem von kivitendo benutzt von Haus aus LaTeX-Vorlagen. Um drucken zu können, braucht der Server ein geeignetes
+ LaTeX System. Am einfachsten ist dazu eine <code class="literal">texlive</code> Installation. Unter Debianoiden Betriebssystemen installiert man
+ die Pakete mit:</p><p>
+ </p><pre class="programlisting">aptitude install texlive-base-bin texlive-latex-recommended texlive-fonts-recommended \
+ texlive-latex-extra texlive-lang-german texlive-generic-extra</pre><p>
+ </p><p>TODO: RPM-Pakete.</p><p>kivitendo bringt drei alternative Vorlagensätze mit:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Standard</p></li><li class="listitem"><p>f-tex</p></li><li class="listitem"><p>RB</p></li></ul></div><div class="sect2" title="2.10.1. Vorlagenverzeichnis anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="Vorlagenverzeichnis-anlegen"></a>2.10.1. Vorlagenverzeichnis anlegen</h3></div></div></div><p>Im Administrationsbereich lässt sich bei einem Benutzer/Mandanten einer dieser Vorlagensätze als Basis für die zu
+ druckenden Dokumente auswählen. Rufen Sie dazu die <span class="guimenu">Benutzerverwaltung</span> auf.</p><p>Wählen Sie dort einen Benutzer aus oder legen Sie einen neuen an. In der Benutzerbearbeiten-Maske müssen Sie zwei Dinge
+ angeben:</p><div class="orderedlist"><ol class="orderedlist" type="1"><li class="listitem"><p>
+ <code class="option">Name</code>: Der Verzeichnisname für den neuen Vorlagensatz. Dieser kann im Rahmen der üblichen
+ Bedingungen für Verzeichnisnamen frei gewählt werden.</p></li><li class="listitem"><p>
+ <code class="option">Vorlagen auswählen</code>: Wählen Sie hier den Vorlagensatz aus, der kopiert werden soll
+ (<code class="filename">Standard</code>, <code class="filename">f-tex</code> oder <code class="filename">RB</code>.)</p></li></ol></div><p>Der gleiche Vorlagensatz kann, wenn er mal angelegt ist, bei mehreren Benutzern verwendet werden.</p><p>Die Abhängigkeiten kann man prüfen mit:</p><pre class="programlisting">/scripts/installation_check.pl -l</pre></div><div class="sect2" title="2.10.2. Standard"><div class="titlepage"><div><div><h3 class="title"><a name="Vorlagen-Standard"></a>2.10.2. Standard</h3></div></div></div><p>Der Standard-Vorlagensatz von Kivitendo. Wie unter <a class="ulink" href="http://demo.kivitendo.org" target="_top">http://demo.kivitendo.org</a> zu
+ sehen.</p></div><div class="sect2" title="2.10.3. f-tex"><div class="titlepage"><div><div><h3 class="title"><a name="f-tex"></a>2.10.3. f-tex</h3></div></div></div><p>Ein Vorlagensatz, der in wenigen Minuten alle Dokumente zur Verfügung stellt.</p><div class="sect3" title="2.10.3.1. Feature-Übersicht"><div class="titlepage"><div><div><h4 class="title"><a name="f-tex-Feature-%C3%9Cbersicht"></a>2.10.3.1. Feature-Übersicht</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Keine Redundanz. Es wird ein- und dieselbe LaTeX-Vorlage für alle briefartigen Dokumente verwendet. Also
+ Angebot, Rechnung, Performarechnung, Lieferschein, aber eben nicht für Paketaufkleber etc..</p></li><li class="listitem"><p>Leichte Anpassung an das Firmen-Layout durch verwendung eines Hintergrund-PDF. Dieses kann leicht mit dem
+ eigenen Lieblingsprogramm erstellt werden (Openoffice, Inkscape, Gimp, Adobe*)</p></li><li class="listitem"><p>Hintergrund-PDF umschaltbar auf "nur erste Seite" (Standard) oder "alle Seiten" (Option
+ "<code class="option">bgPdfFirstPageOnly</code>" in Datei <code class="filename">letter.lco</code>)</p></li><li class="listitem"><p>Hintergrund-PDF für Ausdruck auf bereits bedrucktem Briefpapier abschaltbar. Es wird dann nur bei per E-Mail
+ versendeten Dokumenten eingebunden (Option "<code class="option">bgPdfEmailOnly</code>" in Datei
+ <code class="filename">letter.lco</code>).</p></li><li class="listitem"><p>Nutzung der Layout-Funktionen von LaTeX für Seitenumbruch, Wiederholung von Kopfzeilen, Zwischensummen
+ etc. (danke an Kai-Martin Knaak für die Vorarbeit)</p></li><li class="listitem"><p>Anzeige des Empfängerlandes im Adressfeld nur, wenn es vom Land des eigenen Unternehmens abweicht (also die
+ Rechnung das Land verlässt).</p></li><li class="listitem"><p>Multisprachfähig leicht um weitere Sprachen zu erweitern, alle Übersetzungen in der Datei
+ <code class="filename">translatinos.tex</code>.</p></li><li class="listitem"><p>Auflistung von Bruttopreisen für Endverbraucher.</p></li></ul></div></div><div class="sect3" title="2.10.3.2. Die Installation"><div class="titlepage"><div><div><h4 class="title"><a name="f-tex-Installation"></a>2.10.3.2. Die Installation</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Vorlagenverzeichnis mit Option f-tex anlegen, siehe: <a class="xref" href="ch02s10.html#Vorlagenverzeichnis-anlegen" title="2.10.1. Vorlagenverzeichnis anlegen">Vorlagenverzeichnis anlegen</a>. Das
+ Vorlagensystem funktioniert jetzt schon, hat allerdings noch einen Beispiel-Briefkopf.</p></li><li class="listitem"><p>Erstelle eine pdf-Hintergrund Datei und verlinke sie nach <code class="filename">./letter_head.pdf</code>.</p></li><li class="listitem"><p>Editiere den Bereich "<code class="option">settings</code>" in der datei <code class="filename">letter.lco</code>.</p></li></ul></div><p>oder etwas Detaillierter:</p><p>
+ Es wird eine Datei <code class="filename">sample.lco</code> erstellt und diese nach <code class="filename">letter.lco</code> verlinkt. Eigentlich
+ ist dies die Datei die für die Firmenspezifischen Anpassungen gedacht ist. Da die Einstiegshürde in LaTeX nicht ganz niedrig
+ ist, wird in dieser Datei auf ein Hintergrundpdf verwiesen. Ich empfehle über dieses PDF die persönlichen Layoutanpassungen
+ vorzunehmen und <code class="filename">sample.lco</code> unverändert zu lassen. Die die Anpassung über eine
+ <code class="filename">*.lco</code>-Datei die letztlich auf <code class="filename">letter.lco</code> verlinkt ist ist aber auch möglich.
+ </p><p>
+ Es wird eine Datei <code class="filename">sample_head.pdf</code> mit ausgeliefert, diese wird nach <code class="filename">letter_head.pdf</code>
+ verlinkt. Damit gibt es schon mal eine Funktionsfähige Vorlage. Schau Dir nach Abschluss der Installation die Datei
+ <code class="filename">sample_haed.pdf</code> an und erstelle ein entsprechendes PDF passend zum Briefkopf Deiner Firma, diese dann im
+ Template Verzeichniss ablegen und statt <code class="filename">sample_head.pdf</code> nach <code class="filename">letter_head.pdf</code>
+ verlinken.
+ </p><p>
+ letzlich muss <code class="filename">letter_head.pdf</code> auf das passende Hintergrund-PDF verweisen, welches gewünschten Briefkopf
+ enthält. Bei Updates oder nach erneutem
+ </p><p>
+ Es wird eine Datei <code class="filename">mydata.tex.example</code> ausgeliefert, die nach <code class="filename">mytdata.tex</code> verlinkt
+ ist. Bei verwendetem Hintergrund-PDF wird nur der Eintrag für das Land verwendet. Die Datei muss also nicht angefasst
+ werden. Die Anderen Werte sind für das Modul 'lp' (Label Print in erp - zur Zeit nicht im öffentlichen Zweig).
+ </p><p>
+ Alle Anpassungen zum Briefkopf, Fusszeilen, Firmenlogos, etc. sollten über die Hintergrund-PDF-Datei oder die
+ <code class="filename">*.lco</code>-Datei erfolgen.
+ </p></div><div class="sect3" title="2.10.3.3. f-tex Funktionsübersicht"><div class="titlepage"><div><div><h4 class="title"><a name="f-tex-Funktions%C3%BCbersicht"></a>2.10.3.3. f-tex Funktionsübersicht</h4></div></div></div><p>
+ Das Konzept von kivitendo sieht vor, für jedes Dokument (Auftragsbestätigung, Lieferschein, Rechnung, etc.) eine LaTeX-Vorlage
+ vorzuhalten, dies ist sehr Wartungsunfreundlich. Auch das Einlesen einer einheitlichen Quelle für den Briefkopf bringt nur
+ bedingte Vorteile, da hier leicht die Pflege der Artikel-Tabellen aus dem Ruder läuft. Bei dem vorliegenden Ansatz wird für alle
+ briefartigen Dokumente mit Artikel-Tabellen eine einheitliche LaTeX-Vorlage verwendet, welche über Codeweichen die
+ Besonderheiten der jeweiligen Dokumente Berücksichtigt.
+ </p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Tabellen mit oder ohne Preis</p></li><li class="listitem"><p>Sprache der Tabellenüberschriften etc.</p></li><li class="listitem"><p>Anpassung der Bezugs-Zeile (z.B. Rechnungsnummer versus Angebotsnummer)</p></li><li class="listitem"><p>Darstellung von Brutto oder Netto-Preisen in der Auflistung (Endverbraucher versus Gewerblicher
+ Kunde)</p></li></ul></div><p>Nachteil:</p><p>
+ LaTeX hat ohnehin eine sehr steile Lehrnkurve. Die Datei <code class="filename">letter.tex</code> ist sehr komplex und verstärkt damit
+ diesen Effekt noch einmal erheblich. Wer LaTeX-Erfahrung hat, oder geübt ist Scriptsparachen nachzuvollziehen kann natürlich
+ auch innerhalb der Tabellendarstellung gut persönliche Anpassungen vornehmen. Aber man kann sich hier bei Veränderungen sehr
+ schnell häftig in den Fuss schiessen.
+ </p><p>Wer nicht so tief in die Materie einsteigen will oder leicht zu frustrieren ist, sollte sein Hintergrund PDF auf Basis der
+ mitglieferten Datei <code class="filename">sample_head.pdf</code> erstellen, und sich an der Form der dargestellten Tabellen wie sie
+ ausgeliefert werden, erfreuen.
+ </p><p>Kleiner Tipp: Nicht zu viel auf einmal wollen, lieber kleine kontinuierliche Schritte gehen.</p></div><div class="sect3" title="2.10.3.4. Bruttopreise für Endverbraucher"><div class="titlepage"><div><div><h4 class="title"><a name="f-tex-Bruttopreise"></a>2.10.3.4. Bruttopreise für Endverbraucher</h4></div></div></div><p>Der auszuweisende Bruttopreis wird innerhalb der LaTeX-Umgebung berechnet. Es gibt zwar ein Feld, um bei Aufträgen "alle
+ Preise Brutto" auszuwählen, aber:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>hierfür müssen die Preise auch in Brutto in der Datenbank stehen (ja - das lässt sich über die Preisgruppen und die
+ Zuordung einer Default-Preisgruppe handhaben)</p></li><li class="listitem"><p>man darf beim Anlegen des Vorgangs nicht vergessen Dieses Häkchen zu setzen. (das ist in der Praxis wenn man sowohl
+ Endverbraucher- wie Gewerbekunden beliefert der eigentliche Knackpunkt)</p></li></ul></div><p>
+ Es gibt mit f-tex eine weitere Alternative. Die Information ob Brutto oder Nettorechnung wird mit den Zahlarten
+ verknüpft. Zahlarten bei denen Rechnungen, Angebote, etc, in Brutto ausgegeben werden sollen, enden mit "_E" (für
+ Endverbraucher). Falls identische Zahlarten für Gewerbekunden und Endverbraucher vorhanden sind, legt man diese einfach doppelt
+ an (einmal mit der Namensendung "_E"). Gewinn:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Die Entscheidung, ob Netopreise ausgewiesen werden, ist nicht mehr fix mit einer Preisliste Verbunden.</p></li><li class="listitem"><p>Die Default-Zahlart kann im Kundendatensatz hinterlegt werden, und man muss nicht mehr daran denken, "alle Preise
+ Netto" auszuwählen.</p></li><li class="listitem"><p>Die Entscheidung, ob Netto- oder Bruttopreise ausgewiesen werden, kann direkt beim Drucken reviediert werden,
+ ohne dass sich der Auftragswert ändert.</p></li></ul></div></div><div class="sect3" title="2.10.3.5. Lieferadressen"><div class="titlepage"><div><div><h4 class="title"><a name="f-tex-lieferadressen"></a>2.10.3.5. Lieferadressen</h4></div></div></div><p>In Lieferscheinen kommen <code class="varname">shipto*</code>-Variablen im Adressfeld zum Einsatz. Wenn die
+ <code class="varname">shipto*</code>-Variable leer ist, wird die entsprechende Adressvariable eingesetzt. Wenn also die Lieferadresse in
+ Straße, Hausnummer und Ort abweicht, müssen auch nur diese Felder in der Lieferadresse ausgefüllt werden. Für den Firmenname wird
+ der Wert der Hauptadresse angezeigt.
+ </p></div></div><div class="sect2" title="2.10.4. RB"><div class="titlepage"><div><div><h3 class="title"><a name="Vorlagen-RB"></a>2.10.4. RB</h3></div></div></div><p>Vollständiger Dokumentensatz mit alternativem Design</p></div><div class="sect2" title="2.10.5. Allgemeine Hinweise zu LaTeX Vorlagen"><div class="titlepage"><div><div><h3 class="title"><a name="allgemeine-hinweise-zu-latex"></a>2.10.5. Allgemeine Hinweise zu LaTeX Vorlagen</h3></div></div></div><p>In den allermeisten Installationen sollte drucken jetzt schon
+ funktionieren. Sollte ein Fehler auftreten wirft TeX sehr lange
+ Fehlerbeschreibungen, der eigentliche Fehler ist immer die erste Zeite
+ die mit einem Ausrufezeichen anfängt. Häufig auftretende Fehler sind zum
+ Beispiel:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>! LaTeX Error: File `eurosym.sty' not found. Die entsprechende
+ LaTeX-Bibliothek wurde nicht gefunden. Das tritt vor allem bei
+ Vorlagen aus der Community auf. Installieren Sie die entsprechenden
+ Pakete.</p></li><li class="listitem"><p>! Package inputenc Error: Unicode char \u8:... set up for
+ use with LaTeX. Dieser Fehler tritt auf, wenn sie versuchen mit
+ einer Standardinstallation exotische utf8 Zeichen zu drucken.
+ TeXLive unterstützt von Haus nur romanische Schriften und muss mit
+ diversen Tricks dazu gebracht werden andere Zeichen zu akzeptieren.
+ Adere TeX Systeme wie XeTeX schaffen hier Abhilfe.</p></li></ul></div><p>Wird garkein Fehler angezeigt sondern nur der Name des Templates,
+ heißt das normalerweise, dass das LaTeX Binary nicht gefunden wurde.
+ Prüfen Sie den Namen in der Konfiguration (Standard:
+ <code class="literal">pdflatex</code>), und stellen Sie sicher, dass pdflatex
+ (oder das von Ihnen verwendete System) vom Webserver ausgeführt werden
+ darf.</p><p>Wenn sich das Problem nicht auf Grund der ausgabe im Webbrowser verifizieren lässt:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p> editiere [kivitendo-home]/config/kivitendo.conf und ändere "keep_tmp_files" auf 1</p><p>
+ </p><pre class="programlisting">keep_temp_files = 1;</pre><p>
+ </p></li><li class="listitem"><p>bei fastcgi oder mod_perl den Webserver neu Starten</p></li><li class="listitem"><p>Nochmal einen Druckversuch im Webfrontend auslösen</p></li><li class="listitem"><p>wechsele in das users Verzeichnis von kivitendo</p><p>
+ </p><pre class="programlisting">cd [kivitendo-home]/users</pre><p>
+ </p></li><li class="listitem"><p>LaTeX Suchpfad anpassen:</p><p>
+ </p><pre class="programlisting">export TEXINPUTS=".:[kivitendo-home]/templates/[aktuelles_template_verzeichniss]:"</pre><p>
+ </p></li><li class="listitem"><p>Finde herraus welche Datei kivitendo beim letzten Durchlauf erstellt hat</p><p>
+ </p><pre class="programlisting">ls -lahtr ./1*.tex</pre><p>
+ </p><p>Es sollte die letzte Datei ganz unten sein</p></li><li class="listitem"><p>für besseren Hinweis auf Fehler texdatei nochmals übersetzen</p><p>
+ </p><pre class="programlisting">pdflatex ./1*.tex</pre><p>
+ </p><p>in der *.tex datei nach dem Fehler suchen.</p></li></ul></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s09.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s11.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.9. E-Mail-Versand aus kivitendo heraus </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.11. OpenDocument-Vorlagen</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s10.html" title="2.10. OpenDocument-Vorlagen"><link rel="next" href="ch02s12.html" title="2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
- EUR</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s10.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s12.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.eur"></a>2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
- EUR</h2></div></div></div><div class="sect2" title="2.11.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.introduction"></a>2.11.1. Einführung</h3></div></div></div><p>kivitendo besaß bis inklusive Version 2.6.3 einen
- Konfigurationsparameter namens <code class="varname">eur</code>, der sich in der
- Konfigurationsdatei <code class="filename">config/lx_office.conf</code>
- befand. Somit galt er für alle Mandanten, die in dieser Installation
- benutzt wurden.</p><p>Mit der nachfolgenden Version wurde der Parameter zum Einen in
- die Mandantendatenbank verschoben und dabei auch gleich in drei
- Einzelparameter aufgeteilt, mit denen sich das Verhalten genauer
- steuern lässt.</p></div><div class="sect2" title="2.11.2. Konfigurationsparameter"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.parameters"></a>2.11.2. Konfigurationsparameter</h3></div></div></div><p>Es gibt drei Parameter, die die Gewinnermittlungsart,
- Versteuerungsart und die Warenbuchungsmethode regeln:</p><div class="variablelist"><dl><dt><span class="term">
- <code class="varname">profit_determination</code>
- </span></dt><dd><p>Dieser Parameter legt die Berechnungsmethode für die
- Gewinnermittlung fest. Er enthält entweder
- <code class="literal">balance</code> für
- Betriebsvermögensvergleich/Bilanzierung oder
- <code class="literal">income</code> für die
- Einnahmen-Überschuss-Rechnung.</p></dd><dt><span class="term">
- <code class="varname">accounting_method</code>
- </span></dt><dd><p>Dieser Parameter steuert die Buchungs- und
- Berechnungsmethoden für die Versteuerungsart. Er enthält
- entweder <code class="literal">accrual</code> für die Soll-Versteuerung
- oder <code class="literal">cash</code> für die Ist-Versteuerung.</p></dd><dt><span class="term">
- <code class="varname">inventory_system</code>
- </span></dt><dd><p>Dieser Parameter legt die Warenbuchungsmethode fest. Er
- enthält entweder <code class="literal">perpetual</code> für die
- Bestandsmethode oder <code class="literal">periodic</code> für die
- Aufwandsmethode.</p></dd></dl></div><p>Zum Vergleich der Funktionalität bis und nach 2.6.3:
- <code class="varname">eur</code> = 1 bedeutete Einnahmen-Überschuss-Rechnung,
- Ist-Versteuerung und Aufwandsmethode. <code class="varname">eur</code> = 0
- bedeutete hingegen Bilanzierung, Soll-Versteuerung und
- Bestandsmethode.</p><p>Die Konfiguration "<code class="varname">eur</code>" unter
- <code class="varname">[system]</code> in der <a class="link" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei">Konfigurationsdatei</a>
-
- <code class="filename">config/kivitendo.conf</code> wird nun nicht mehr
- benötigt und kann entfernt werden. Dies muss manuell geschehen.</p></div><div class="sect2" title="2.11.3. Festlegen der Parameter"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.setting-parameters"></a>2.11.3. Festlegen der Parameter</h3></div></div></div><p>Beim Anlegen eines neuen Mandanten bzw. einer neuen Datenbank in
- der Admininstration können diese Optionen nun unabhängig voneinander
- eingestellt werden.</p><p>Beim Upgrade bestehender Mandanten wird eur ausgelesen und die
- Variablen werden so gesetzt, daß sich an der Funktionalität nichts
- ändert.</p><p>Die aktuelle Konfiguration wird unter Nummernkreise und
- Standardkonten unter dem neuen Punkt "Einstellungen" angezeigt
- (read-only). Eine spätere Änderung ist für einen bestehenden Mandanten
- nicht mehr möglich. Dies war auch vorher nicht möglich, bzw.
- vorhandene Daten wurden so belassen und haben damit die Ergebnisse
- verfälscht.</p></div><div class="sect2" title="2.11.4. Bemerkungen zu Bestandsmethode"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.inventory-system-perpetual"></a>2.11.4. Bemerkungen zu Bestandsmethode</h3></div></div></div><p>Die Bestandsmethode ist eigentlich eine sehr elegante Methode,
- funktioniert in kivitendo aber nur unter bestimmten Bedingungen:
- Voraussetzung ist, daß auch immer alle Einkaufsrechnungen gepflegt
- werden, und man beim Jahreswechsel nicht mit einer leeren Datenbank
- anfängt, da bei jedem Verkauf anhand der gesamten Rechnungshistorie
- der Einkaufswert der Ware nach dem FIFO-Prinzip aus den
- Einkaufsrechnungen berechnet wird.</p><p>Die Bestandsmethode kann vom Prinzip her also nur funktioneren,
- wenn man mit den Buchungen bei Null anfängt, und man kann auch nicht
- im laufenden Betrieb von der Aufwandsmethode zur Bestandsmethode
- wechseln.</p></div><div class="sect2" title="2.11.5. Bekannte Probleme"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.knonw-issues"></a>2.11.5. Bekannte Probleme</h3></div></div></div><p>Bei bestimmten Berichten kann man derzeit noch inviduell
- einstellen, ob man nach Ist- oder Sollversteuerung auswertet, und es
- werden im Code Variablen wie $accrual oder $cash gesetzt. Diese
- Codestellen wurden noch nicht angepasst, sondern nur die, wo bisher
- die Konfigurationsvariable
- <code class="varname">$::lx_office_conf{system}->{eur}</code> ausgewertet
- wurde.</p><p>Es fehlen Hilfetext beim Neuanlegen eines Mandanten, was die
- Optionen bewirken, z.B. mit zwei Standardfällen.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s10.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s12.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.10. OpenDocument-Vorlagen </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</td></tr></table></div></body></html>
\ No newline at end of file
+ <title>2.11. OpenDocument-Vorlagen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s10.html" title="2.10. Drucken mit kivitendo"><link rel="next" href="ch02s12.html" title="2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.11. OpenDocument-Vorlagen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s10.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s12.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.11. OpenDocument-Vorlagen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="OpenDocument-Vorlagen"></a>2.11. OpenDocument-Vorlagen</h2></div></div></div><p>kivitendo unterstützt die Verwendung von Vorlagen im
+ OpenDocument-Format, wie es OpenOffice.org ab Version 2 erzeugt.
+ kivitendo kann dabei sowohl neue OpenDocument-Dokumente als auch aus
+ diesen direkt PDF-Dateien erzeugen. Um die Unterstützung von
+ OpenDocument-Vorlagen zu aktivieren muss in der Datei
+ <code class="filename">config/kivitendo.conf</code> die Variable
+ <code class="literal">opendocument</code> im Abschnitt
+ <code class="literal">print_templates</code> auf ‘<code class="literal">1</code>’ stehen.
+ Dieses ist die Standardeinstellung.</p><p>Weiterhin muss in der Datei
+ <code class="filename">config/kivitendo.conf</code> die Variable
+ <code class="literal">dbcharset</code> im Abschnitt <code class="literal">system</code> auf
+ die Zeichenkodierung gesetzt werden, die auch bei der Speicherung der
+ Daten in der Datenbank verwendet wird. Diese ist in den meisten Fällen
+ "UTF-8".</p><p>Während die Erzeugung von reinen OpenDocument-Dateien keinerlei
+ weitere Software benötigt, wird zur Umwandlung dieser Dateien in PDF
+ OpenOffice.org benötigt. Soll dieses Feature genutzt werden, so muss
+ neben OpenOffice.org ab Version 2 auch der “X virtual frame buffer”
+ (xvfb) installiert werden. Bei Debian ist er im Paket “xvfb” enthalten.
+ Andere Distributionen enthalten ihn in anderen Paketen.</p><p>Nach der Installation müssen in der Datei
+ <code class="filename">config/kivitendo.conf</code> zwei weitere Variablen
+ angepasst werden: <code class="literal">openofficeorg_writer</code> muss den
+ vollständigen Pfad zur OpenOffice.org Writer-Anwendung enthalten.
+ <code class="literal">xvfb</code> muss den Pfad zum “X virtual frame buffer”
+ enthalten. Beide stehen im Abschnitt
+ <code class="literal">applications</code>.</p><p>Zusätzlich gibt es zwei verschiedene Arten, wie kivitendo mit
+ OpenOffice kommuniziert. Die erste Variante, die benutzt wird, wenn die
+ Variable <code class="literal">$openofficeorg_daemon</code> gesetzt ist, startet
+ ein OpenOffice, das auch nach der Umwandlung des Dokumentes gestartet
+ bleibt. Bei weiteren Umwandlungen wird dann diese laufende Instanz
+ benutzt. Der Vorteil ist, dass die Zeit zur Umwandlung deutlich
+ reduziert wird, weil nicht für jedes Dokument ein OpenOffice gestartet
+ werden muss. Der Nachteil ist, dass diese Methode Python und die
+ Python-UNO-Bindings benötigt, die Bestandteil von OpenOffice 2
+ sind.</p><p>Ist <code class="literal">$openofficeorg_daemon</code> nicht gesetzt, so
+ wird für jedes Dokument OpenOffice neu gestartet und die Konvertierung
+ mit Hilfe eines Makros durchgeführt. Dieses Makro muss in der
+ Dokumentenvorlage enthalten sein und
+ “Standard.Conversion.ConvertSelfToPDF()” heißen. Die Beispielvorlage
+ ‘<code class="literal">templates/mastertemplates/German/invoice.odt</code>’
+ enthält ein solches Makro, das in jeder anderen Dokumentenvorlage
+ ebenfalls enthalten sein muss.</p><p>Als letztes muss herausgefunden werden, welchen Namen
+ OpenOffice.org Writer dem Verzeichnis mit den Benutzereinstellungen
+ gibt. Unter Debian ist dies momentan
+ <code class="literal">~/.openoffice.org2</code>. Sollte der Name bei Ihrer
+ OpenOffice.org-Installation anders sein, so muss das Verzeichnis
+ <code class="literal">users/.openoffice.org2</code> entsprechend umbenannt werden.
+ Ist der Name z.B. einfach nur <code class="literal">.openoffice</code>, so wäre
+ folgender Befehl auszuführen:</p><p>
+ <code class="literal">mv users/.openoffice.org2
+ users/.openoffice</code>
+ </p><p>Dieses Verzeichnis, wie auch das komplette
+ <code class="literal">users</code>-Verzeichnis, muss vom Webserver beschreibbar
+ sein. Dieses wurde bereits erledigt (siehe <a class="xref" href="ch02s02.html" title="2.2. Manuelle Installation des Programmpaketes">Manuelle Installation des Programmpaketes</a>), kann aber
+ erneut überprüft werden, wenn die Konvertierung nach PDF
+ fehlschlägt.</p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s10.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s12.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.10. Drucken mit kivitendo </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ EUR</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s11.html" title="2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"><link rel="next" href="ch02s13.html" title="2.13. kivitendo ERP verwenden"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s11.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s13.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.skr04-update-3804"></a>2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</h2></div></div></div><div class="sect2" title="2.12.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="config.skr04-update-3804.introduction"></a>2.12.1. Einführung</h3></div></div></div><p>Die Umsatzsteuerumstellung auf 19% für SKR04 für die
- Steuerschlüssel "EU ohne USt-ID Nummer" ist erst 2010 erfolgt.
- kivitendo beinhaltet ein Upgradeskript, das das Konto 3804 automatisch
- erstellt und die Steuereinstellungen korrekt einstellt. Hat der
- Benutzer aber schon selber das Konto 3804 angelegt, oder gab es schon
- Buchungen im Zeitraum nach dem 01.01.2007 auf das Konto 3803, wird das
- Upgradeskript vorsichtshalber nicht ausgeführt, da der Benutzer sich
- vielleicht schon selbst geholfen hat und mit seinen Änderungen
- zufrieden ist. Die korrekten Einstellungen kann man aber auch per Hand
- ausführen. Nachfolgend werden die entsprechenden Schritte anhand von
- Screenshots dargestellt.</p><p>Für den Fall, daß Buchungen mit der Steuerschlüssel "EU ohne
- USt.-IdNr." nach dem 01.01.2007 erfolgt sind, ist davon auszugehen,
- dass diese mit dem alten Umsatzsteuersatz von 16% gebucht worden sind,
- und diese Buchungen sollten entsprechend kontrolliert werden.</p></div><div class="sect2" title="2.12.2. Konto 3804 manuell anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="config.skr04-update-3804.create-chart"></a>2.12.2. Konto 3804 manuell anlegen</h3></div></div></div><p>Die folgenden Schritte sind notwendig, um das Konto manuell
- anzulegen und zu konfigurieren. Zuerst wird in
- <span class="guimenu">System</span> ->
- <span class="guisubmenu">Kontenübersicht</span> -> <span class="guimenuitem">Konto
- erfassen</span> das Konto angelegt.</p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/konto3804.png"></div></div><p>
- Als Zweites muss Steuergruppe 13 für Konto 3803 angepasst werden. Dazu unter <span class="guimenu">System</span> ->
- <span class="guisubmenu">Steuern</span> -> <span class="guimenuitem">Bearbeiten</span> den Eintrag mit Steuerschlüssel 13 auswählen und ihn
- wie im folgenden Screenshot angezeigt anpassen.
- </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuer3803.png"></div></div><p>
- Als Drittes wird ein neuer Eintrag mit Steuerschlüssel 13 für Konto 3804 (19%) angelegt. Dazu unter <span class="guimenu">System</span> ->
- <span class="guisubmenu">Steuern</span> -> <span class="guimenuitem">Erfassen</span> auswählen und die Werte aus dem Screenshot übernehmen.
- </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuer3804.png"></div></div><p>
- Als Nächstes sind alle Konten anzupassen, die als Steuerautomatikkonto die 3803 haben, sodass sie ab dem 1.1.2007 auch
- Steuerautomatik auf 3804 bekommen. Dies betrifft in der Standardkonfiguration die Konten 4315 und 4726. Als Beispiel für 4315
- müssen Sie dazu unter <span class="guimenu">System</span> -> <span class="guisubmenu">Kontenübersicht</span> -> <span class="guimenuitem">Konten
- anzeigen</span> das Konto 4315 anklicken und die Einstellungen wie im Screenshot gezeigt vornehmen.
- </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/konto4315.png"></div></div><p>
- Als Letztes sollte die Steuerliste unter <span class="guimenu">System</span> -> <span class="guisubmenu">Steuern</span> ->
- <span class="guimenuitem">Bearbeiten</span> kontrolliert werden. Zum Vergleich der Screenshot.
- </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuerliste.png"></div></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s11.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s13.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
- EUR </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.13. kivitendo ERP verwenden</td></tr></table></div></body></html>
\ No newline at end of file
+ <title>2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s11.html" title="2.11. OpenDocument-Vorlagen"><link rel="next" href="ch02s13.html" title="2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ EUR</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s11.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s13.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.eur"></a>2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ EUR</h2></div></div></div><div class="sect2" title="2.12.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.introduction"></a>2.12.1. Einführung</h3></div></div></div><p>kivitendo besaß bis inklusive Version 2.6.3 einen Konfigurationsparameter namens <code class="varname">eur</code>, der sich in der
+ Konfigurationsdatei <code class="filename">config/kivitendo.conf</code> (damals noch <code class="filename">config/lx_office.conf</code>)
+ befand. Somit galt er für alle Mandanten, die in dieser Installation benutzt wurden.</p><p>Mit der nachfolgenden Version wurde der Parameter zum Einen in
+ die Mandantendatenbank verschoben und dabei auch gleich in drei
+ Einzelparameter aufgeteilt, mit denen sich das Verhalten genauer
+ steuern lässt.</p></div><div class="sect2" title="2.12.2. Konfigurationsparameter"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.parameters"></a>2.12.2. Konfigurationsparameter</h3></div></div></div><p>Es gibt drei Parameter, die die Gewinnermittlungsart,
+ Versteuerungsart und die Warenbuchungsmethode regeln:</p><div class="variablelist"><dl><dt><span class="term">
+ <code class="varname">profit_determination</code>
+ </span></dt><dd><p>Dieser Parameter legt die Berechnungsmethode für die
+ Gewinnermittlung fest. Er enthält entweder
+ <code class="literal">balance</code> für
+ Betriebsvermögensvergleich/Bilanzierung oder
+ <code class="literal">income</code> für die
+ Einnahmen-Überschuss-Rechnung.</p></dd><dt><span class="term">
+ <code class="varname">accounting_method</code>
+ </span></dt><dd><p>Dieser Parameter steuert die Buchungs- und
+ Berechnungsmethoden für die Versteuerungsart. Er enthält
+ entweder <code class="literal">accrual</code> für die Soll-Versteuerung
+ oder <code class="literal">cash</code> für die Ist-Versteuerung.</p></dd><dt><span class="term">
+ <code class="varname">inventory_system</code>
+ </span></dt><dd><p>Dieser Parameter legt die Warenbuchungsmethode fest. Er
+ enthält entweder <code class="literal">perpetual</code> für die
+ Bestandsmethode oder <code class="literal">periodic</code> für die
+ Aufwandsmethode.</p></dd></dl></div><p>Zum Vergleich der Funktionalität bis und nach 2.6.3:
+ <code class="varname">eur</code> = 1 bedeutete Einnahmen-Überschuss-Rechnung,
+ Ist-Versteuerung und Aufwandsmethode. <code class="varname">eur</code> = 0
+ bedeutete hingegen Bilanzierung, Soll-Versteuerung und
+ Bestandsmethode.</p><p>Die Konfiguration "<code class="varname">eur</code>" unter
+ <code class="varname">[system]</code> in der <a class="link" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei">Konfigurationsdatei</a>
+
+ <code class="filename">config/kivitendo.conf</code> wird nun nicht mehr
+ benötigt und kann entfernt werden. Dies muss manuell geschehen.</p></div><div class="sect2" title="2.12.3. Festlegen der Parameter"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.setting-parameters"></a>2.12.3. Festlegen der Parameter</h3></div></div></div><p>Beim Anlegen eines neuen Mandanten bzw. einer neuen Datenbank in
+ der Admininstration können diese Optionen nun unabhängig voneinander
+ eingestellt werden.</p><p>Beim Upgrade bestehender Mandanten wird eur ausgelesen und die
+ Variablen werden so gesetzt, daß sich an der Funktionalität nichts
+ ändert.</p><p>Die aktuelle Konfiguration wird unter Nummernkreise und
+ Standardkonten unter dem neuen Punkt "Einstellungen" (read-only)
+ angezeigt. Unter <span class="guimenu">System</span>
+ -> <span class="guisubmenu">Mandantenkonfiguration</span> können
+ die Einstellungen auch geändert werden. Dabei ist zu beachten,
+ dass eine Änderung vorhandene Daten so belässt und damit
+ evtl. die Ergebnisse verfälscht. Dies gilt vor Allem für die
+ Warenbuchungsmethode (siehe auch
+ <a class="link" href="ch02s12.html#config.eur.inventory-system-perpetual" title="2.12.4. Bemerkungen zu Bestandsmethode">
+ Bemerkungen zu Bestandsmethode</a>).</p></div><div class="sect2" title="2.12.4. Bemerkungen zu Bestandsmethode"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.inventory-system-perpetual"></a>2.12.4. Bemerkungen zu Bestandsmethode</h3></div></div></div><p>Die Bestandsmethode ist eigentlich eine sehr elegante Methode,
+ funktioniert in kivitendo aber nur unter bestimmten Bedingungen:
+ Voraussetzung ist, daß auch immer alle Einkaufsrechnungen gepflegt
+ werden, und man beim Jahreswechsel nicht mit einer leeren Datenbank
+ anfängt, da bei jedem Verkauf anhand der gesamten Rechnungshistorie
+ der Einkaufswert der Ware nach dem FIFO-Prinzip aus den
+ Einkaufsrechnungen berechnet wird.</p><p>Die Bestandsmethode kann vom Prinzip her also nur funktioneren,
+ wenn man mit den Buchungen bei Null anfängt, und man kann auch nicht
+ im laufenden Betrieb von der Aufwandsmethode zur Bestandsmethode
+ wechseln.</p></div><div class="sect2" title="2.12.5. Bekannte Probleme"><div class="titlepage"><div><div><h3 class="title"><a name="config.eur.knonw-issues"></a>2.12.5. Bekannte Probleme</h3></div></div></div><p>Bei bestimmten Berichten kann man derzeit noch inviduell
+ einstellen, ob man nach Ist- oder Sollversteuerung auswertet, und es
+ werden im Code Variablen wie $accrual oder $cash gesetzt. Diese
+ Codestellen wurden noch nicht angepasst, sondern nur die, wo bisher
+ die Konfigurationsvariable
+ <code class="varname">$::lx_office_conf{system}->{eur}</code> ausgewertet
+ wurde.</p><p>Es fehlen Hilfetext beim Neuanlegen eines Mandanten, was die
+ Optionen bewirken, z.B. mit zwei Standardfällen.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s11.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s13.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.11. OpenDocument-Vorlagen </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>2.13. kivitendo ERP verwenden</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s12.html" title="2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"><link rel="next" href="ch03.html" title="Kapitel 3. Features und Funktionen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.13. kivitendo ERP verwenden</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s12.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch03.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.13. kivitendo ERP verwenden"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="kivitendo-ERP-verwenden"></a>2.13. kivitendo ERP verwenden</h2></div></div></div><p>Nach erfolgreicher Installation ist der Loginbildschirm unter
- folgender URL erreichbar:</p><p>
- <a class="ulink" href="http://localhost/kivitendo-erp/login.pl" target="_top">http://localhost/kivitendo-erp/login.pl</a>
- </p><p>Die Administrationsseite erreichen Sie unter:</p><p>
- <a class="ulink" href="http://localhost/kivitendo-erp/admin.pl" target="_top">http://localhost/kivitendo-erp/admin.pl</a>
- </p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s12.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch03.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> Kapitel 3. Features und Funktionen</td></tr></table></div></body></html>
\ No newline at end of file
+ <title>2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s12.html" title="2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung: EUR"><link rel="next" href="ch02s14.html" title="2.14. Einstellungen pro Mandant"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s12.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s14.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.skr04-update-3804"></a>2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</h2></div></div></div><div class="sect2" title="2.13.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="config.skr04-update-3804.introduction"></a>2.13.1. Einführung</h3></div></div></div><p>Die Umsatzsteuerumstellung auf 19% für SKR04 für die
+ Steuerschlüssel "EU ohne USt-ID Nummer" ist erst 2010 erfolgt.
+ kivitendo beinhaltet ein Upgradeskript, das das Konto 3804 automatisch
+ erstellt und die Steuereinstellungen korrekt einstellt. Hat der
+ Benutzer aber schon selber das Konto 3804 angelegt, oder gab es schon
+ Buchungen im Zeitraum nach dem 01.01.2007 auf das Konto 3803, wird das
+ Upgradeskript vorsichtshalber nicht ausgeführt, da der Benutzer sich
+ vielleicht schon selbst geholfen hat und mit seinen Änderungen
+ zufrieden ist. Die korrekten Einstellungen kann man aber auch per Hand
+ ausführen. Nachfolgend werden die entsprechenden Schritte anhand von
+ Screenshots dargestellt.</p><p>Für den Fall, daß Buchungen mit der Steuerschlüssel "EU ohne
+ USt.-IdNr." nach dem 01.01.2007 erfolgt sind, ist davon auszugehen,
+ dass diese mit dem alten Umsatzsteuersatz von 16% gebucht worden sind,
+ und diese Buchungen sollten entsprechend kontrolliert werden.</p></div><div class="sect2" title="2.13.2. Konto 3804 manuell anlegen"><div class="titlepage"><div><div><h3 class="title"><a name="config.skr04-update-3804.create-chart"></a>2.13.2. Konto 3804 manuell anlegen</h3></div></div></div><p>Die folgenden Schritte sind notwendig, um das Konto manuell
+ anzulegen und zu konfigurieren. Zuerst wird in
+ <span class="guimenu">System</span> ->
+ <span class="guisubmenu">Kontenübersicht</span> -> <span class="guimenuitem">Konto
+ erfassen</span> das Konto angelegt.</p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/konto3804.png"></div></div><p>
+ Als Zweites muss Steuergruppe 13 für Konto 3803 angepasst werden. Dazu unter <span class="guimenu">System</span> ->
+ <span class="guisubmenu">Steuern</span> -> <span class="guimenuitem">Bearbeiten</span> den Eintrag mit Steuerschlüssel 13 auswählen und ihn
+ wie im folgenden Screenshot angezeigt anpassen.
+ </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuer3803.png"></div></div><p>
+ Als Drittes wird ein neuer Eintrag mit Steuerschlüssel 13 für Konto 3804 (19%) angelegt. Dazu unter <span class="guimenu">System</span> ->
+ <span class="guisubmenu">Steuern</span> -> <span class="guimenuitem">Erfassen</span> auswählen und die Werte aus dem Screenshot übernehmen.
+ </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuer3804.png"></div></div><p>
+ Als Nächstes sind alle Konten anzupassen, die als Steuerautomatikkonto die 3803 haben, sodass sie ab dem 1.1.2007 auch
+ Steuerautomatik auf 3804 bekommen. Dies betrifft in der Standardkonfiguration die Konten 4315 und 4726. Als Beispiel für 4315
+ müssen Sie dazu unter <span class="guimenu">System</span> -> <span class="guisubmenu">Kontenübersicht</span> -> <span class="guimenuitem">Konten
+ anzeigen</span> das Konto 4315 anklicken und die Einstellungen wie im Screenshot gezeigt vornehmen.
+ </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/konto4315.png"></div></div><p>
+ Als Letztes sollte die Steuerliste unter <span class="guimenu">System</span> -> <span class="guisubmenu">Steuern</span> ->
+ <span class="guimenuitem">Bearbeiten</span> kontrolliert werden. Zum Vergleich der Screenshot.
+ </p><div class="screenshot"><div class="mediaobject"><img src="images/skr04-update-3804/steuerliste.png"></div></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s12.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s14.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ EUR </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.14. Einstellungen pro Mandant</td></tr></table></div></body></html>
\ No newline at end of file
--- /dev/null
+<html><head>
+ <meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
+ <title>2.14. Einstellungen pro Mandant</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s13.html" title="2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb"><link rel="next" href="ch02s15.html" title="2.15. kivitendo ERP verwenden"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.14. Einstellungen pro Mandant</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s13.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch02s15.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.14. Einstellungen pro Mandant"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="config.client"></a>2.14. Einstellungen pro Mandant</h2></div></div></div><p>Einige Einstellungen können von einem Benutzer mit dem
+ <a class="link" href="ch02s08.html#Zusammenh%C3%A4nge" title="2.8.1. Zusammenhänge">Recht</a> "Administration
+ (Für die Verwaltung der aktuellen Instanz aus einem Userlogin heraus)"
+ gemacht werden. Diese Einstellungen sind dann für die aktuellen
+ Mandanten-Datenbank gültig. Die Einstellungen sind
+ unter <span class="guimenu">System</span>
+ -> <span class="guisubmenu">Mandantenkonfiguration</span> erreichbar.</p><p>Bitte beachten Sie die Hinweise zu den einzelnen
+ Einstellungen. Einige Einstellungen sollten nicht ohne Weiteres
+ im laufenden Betrieb geändert werden (siehe
+ auch <a class="link" href="ch02s12.html#config.eur.inventory-system-perpetual" title="2.12.4. Bemerkungen zu Bestandsmethode">Bemerkungen zu
+ Bestandsmethode</a>).</p><p>Die Einstellungen <code class="literal">show_bestbefore</code>
+ und <code class="literal">payments_changeable</code> aus dem
+ Abschnitt <code class="literal">features</code> und die Einstellungen im
+ Abschnitt <code class="literal">datev_check</code> (sofern schon vorhanden)
+ der <a class="link" href="ch02s03.html" title="2.3. kivitendo-Konfigurationsdatei">kivitendo-Konfigurationsdatei</a>
+ werden bei einem Datenbankupdate einer älteren Version automatisch
+ übernommen. Diese Einträge können danach aus der Konfigurationsdatei
+ entfernt werden.</p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s13.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch02s15.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 2.15. kivitendo ERP verwenden</td></tr></table></div></body></html>
\ No newline at end of file
--- /dev/null
+<html><head>
+ <meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
+ <title>2.15. kivitendo ERP verwenden</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch02.html" title="Kapitel 2. Installation und Grundkonfiguration"><link rel="prev" href="ch02s14.html" title="2.14. Einstellungen pro Mandant"><link rel="next" href="ch03.html" title="Kapitel 3. Features und Funktionen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">2.15. kivitendo ERP verwenden</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s14.html">Zurück</a> </td><th width="60%" align="center">Kapitel 2. Installation und Grundkonfiguration</th><td width="20%" align="right"> <a accesskey="n" href="ch03.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="2.15. kivitendo ERP verwenden"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="kivitendo-ERP-verwenden"></a>2.15. kivitendo ERP verwenden</h2></div></div></div><p>Nach erfolgreicher Installation ist der Loginbildschirm unter
+ folgender URL erreichbar:</p><p>
+ <a class="ulink" href="http://localhost/kivitendo-erp/login.pl" target="_top">http://localhost/kivitendo-erp/login.pl</a>
+ </p><p>Die Administrationsseite erreichen Sie unter:</p><p>
+ <a class="ulink" href="http://localhost/kivitendo-erp/admin.pl" target="_top">http://localhost/kivitendo-erp/admin.pl</a>
+ </p></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s14.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch02.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch03.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.14. Einstellungen pro Mandant </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> Kapitel 3. Features und Funktionen</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>Kapitel 3. Features und Funktionen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch02s13.html" title="2.13. kivitendo ERP verwenden"><link rel="next" href="ch03s02.html" title="3.2. Dokumentenvorlagen und verfügbare Variablen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 3. Features und Funktionen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s13.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch03s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 3. Features und Funktionen"><div class="titlepage"><div><div><h2 class="title"><a name="features"></a>Kapitel 3. Features und Funktionen</h2></div></div></div><div class="sect1" title="3.1. Wiederkehrende Rechnungen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="features.periodic-invoices"></a>3.1. Wiederkehrende Rechnungen</h2></div></div></div><div class="sect2" title="3.1.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="features.periodic-invoices.introduction"></a>3.1.1. Einführung</h3></div></div></div><p>Wiederkehrende Rechnungen werden als normale Aufträge definiert
+ <title>Kapitel 3. Features und Funktionen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch02s15.html" title="2.15. kivitendo ERP verwenden"><link rel="next" href="ch03s02.html" title="3.2. Dokumentenvorlagen und verfügbare Variablen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 3. Features und Funktionen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch02s15.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch03s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 3. Features und Funktionen"><div class="titlepage"><div><div><h2 class="title"><a name="features"></a>Kapitel 3. Features und Funktionen</h2></div></div></div><div class="sect1" title="3.1. Wiederkehrende Rechnungen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="features.periodic-invoices"></a>3.1. Wiederkehrende Rechnungen</h2></div></div></div><div class="sect2" title="3.1.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="features.periodic-invoices.introduction"></a>3.1.1. Einführung</h3></div></div></div><p>Wiederkehrende Rechnungen werden als normale Aufträge definiert
und konfiguriert, mit allen dazugehörigen Kunden- und Artikelangaben.
Die konfigurierten Aufträge werden später automatisch in Rechnungen
umgewandelt, so als ob man den Workflow benutzen würde, und auch die
den neu konfigurieren Auftrag erkennt und daraus eine Rechnung
generiert hat. Alternativ setzt man das Startdatum auf den
Monatsersten des Folgemonats und erstellt die erste Rechnung direkt
- manuell über den Workflow.</p></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s13.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch03s02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.13. kivitendo ERP verwenden </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 3.2. Dokumentenvorlagen und verfügbare Variablen</td></tr></table></div></body></html>
\ No newline at end of file
+ manuell über den Workflow.</p></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch02s15.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch03s02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">2.15. kivitendo ERP verwenden </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 3.2. Dokumentenvorlagen und verfügbare Variablen</td></tr></table></div></body></html>
\ No newline at end of file
</span></dt><dd><p>Beschreibung des ausgewählten Druckers</p></dd><dt><span class="term">
<code class="varname">template_meta.printer.template_code</code>
</span></dt><dd><p>Vorlagenürzel des ausgewählten Druckers, identisch mit
- dem Kürzel das im Dateinamen verwendetet wird.</p></dd></dl></div></div><div class="sect3" title="3.2.7.2. Stammdaten von Kunden und Lieferanten"><div class="titlepage"><div><div><h4 class="title"><a name="dokumentenvorlagen-und-variablen.allgemeine-variablen.kunden-lieferanten"></a>3.2.7.2. Stammdaten von Kunden und Lieferanten</h4></div></div></div><div class="variablelist"><dl><dt><span class="term">
+ dem Kürzel das im Dateinamen verwendetet wird.</p></dd><dt><span class="term">
+ <code class="varname">template_meta.tmpfile</code>
+ </span></dt><dd><p>Datei-Prefix für temporäre Dateien.</p></dd></dl></div></div><div class="sect3" title="3.2.7.2. Stammdaten von Kunden und Lieferanten"><div class="titlepage"><div><div><h4 class="title"><a name="dokumentenvorlagen-und-variablen.allgemeine-variablen.kunden-lieferanten"></a>3.2.7.2. Stammdaten von Kunden und Lieferanten</h4></div></div></div><div class="variablelist"><dl><dt><span class="term">
<code class="varname">account_number</code>
</span></dt><dd><p>Kontonummer</p></dd><dt><span class="term">
<code class="varname">bank</code>
<code class="varname">invdate</code>
</span></dt><dd><p>Rechnungsdatum</p></dd><dt><span class="term">
<code class="varname">invnumber</code>
- </span></dt><dd><p>Rechnungsnummer</p></dd></dl></div></div></div><div class="sect2" title="3.2.10. Variablen in anderen Vorlagen"><div class="titlepage"><div><div><h3 class="title"><a name="dokumentenvorlagen-und-variablen.andere-vorlagen"></a>3.2.10. Variablen in anderen Vorlagen</h3></div></div></div><div class="sect3" title="3.2.10.1. Einführung"><div class="titlepage"><div><div><h4 class="title"><a name="d0e3731"></a>3.2.10.1. Einführung</h4></div></div></div><p>Die Variablen in anderen Vorlagen sind ähnlich wie in der
+ </span></dt><dd><p>Rechnungsnummer</p></dd></dl></div></div></div><div class="sect2" title="3.2.10. Variablen in anderen Vorlagen"><div class="titlepage"><div><div><h3 class="title"><a name="dokumentenvorlagen-und-variablen.andere-vorlagen"></a>3.2.10. Variablen in anderen Vorlagen</h3></div></div></div><div class="sect3" title="3.2.10.1. Einführung"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4361"></a>3.2.10.1. Einführung</h4></div></div></div><p>Die Variablen in anderen Vorlagen sind ähnlich wie in der
Rechnung. Allerdings heißen die Variablen, die mit
<code class="varname">inv</code> beginnen, jetzt anders. Bei den Angeboten
fangen sie mit <code class="varname">quo</code> für "quotation" an:
...
<%end%></pre><p>Eine normale "if-then"-Bedingung. Die Zeilen zwischen dem "if"
und dem "end" werden nur ausgegeben, wenn die Variable
- <code class="varname">variablenname</code> gesetzt und ungleich 0 ist.</p><p>Die Bedingung kann auch negiert werden, indem das Wort
+ <code class="varname">variablenname</code> gesetzt und ungleich 0 ist.</p><p>Handelt es sich bei der benannten Variable um ein Array, also um einen Variablennamen, über den man mit
+ <span class="command"><strong><%foreach variablenname%></strong></span> iteriert, so wird mit diesem Konstrukt darauf getestet, ob das Array Elemente
+ enthält. Somit würde im folgenden Beispiel nur dann eine Liste von Zahlungseingängen samt ihrer Überschrift "Zahlungseingänge"
+ ausgegeben, wenn tatsächlich welche getätigt wurden:</p><pre class="programlisting"><%if payment%>
+Zahlungseingänge:
+ <%foreach payment%>
+ Am <%paymentdate%>: <%payment%> €
+ <%end foreach%>
+<%end if%></pre><p>Die Bedingung kann auch negiert werden, indem das Wort
<code class="function">not</code> nach dem <code class="filename">if</code> verwendet
wird. Beispiel:</p><pre class="programlisting"><%if not cp_greeting%>
...
zeigen:</p><pre class="programlisting"><%if var1 == "Wert"%></pre><p>Testet die Variable <code class="varname">var1</code> auf
übereinstimmung mit der Zeichenkette <code class="constant">Wert</code>.
Mittels <code class="function">!=</code> anstelle von <code class="function">==</code>
- würde auf Ungleichheit getestet.</p><pre class="programlisting">%if var1 == var2%></pre><p>Testet die Variable <code class="varname">var1</code> auf
+ würde auf Ungleichheit getestet.</p><pre class="programlisting"><%if var1 == var2%></pre><p>Testet die Variable <code class="varname">var1</code> auf
übereinstimmung mit der Variablen <code class="varname">var2</code>. Mittel
<code class="function">!=</code> anstelle von <code class="function">==</code> würde
auf Ungleichheit getestet.</p><p>Erfahrere Benutzer können neben der Tests auf (Un-)Gleichheit
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>Kapitel 4. Entwicklerdokumentation</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch03s03.html" title="3.3. Excel-Vorlagen"><link rel="next" href="ch04s02.html" title="4.2. Entwicklung unter FastCGI"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 4. Entwicklerdokumentation</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 4. Entwicklerdokumentation"><div class="titlepage"><div><div><h2 class="title"><a name="d0e4331"></a>Kapitel 4. Entwicklerdokumentation</h2></div></div></div><div class="sect1" title="4.1. Globale Variablen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.globals"></a>4.1. Globale Variablen</h2></div></div></div><div class="sect2" title="4.1.1. Wie sehen globale Variablen in Perl aus?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4337"></a>4.1.1. Wie sehen globale Variablen in Perl aus?</h3></div></div></div><p>Globale Variablen liegen in einem speziellen namespace namens
+ <title>Kapitel 4. Entwicklerdokumentation</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="prev" href="ch03s03.html" title="3.3. Excel-Vorlagen"><link rel="next" href="ch04s02.html" title="4.2. Entwicklung unter FastCGI"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">Kapitel 4. Entwicklerdokumentation</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr></table><hr></div><div class="chapter" title="Kapitel 4. Entwicklerdokumentation"><div class="titlepage"><div><div><h2 class="title"><a name="d0e4968"></a>Kapitel 4. Entwicklerdokumentation</h2></div></div></div><div class="sect1" title="4.1. Globale Variablen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.globals"></a>4.1. Globale Variablen</h2></div></div></div><div class="sect2" title="4.1.1. Wie sehen globale Variablen in Perl aus?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4974"></a>4.1.1. Wie sehen globale Variablen in Perl aus?</h3></div></div></div><p>Globale Variablen liegen in einem speziellen namespace namens
"main", der von überall erreichbar ist. Darüber hinaus sind bareword
globs global und die meisten speziellen Variablen sind...
speziell.</p><p>Daraus ergeben sich folgende Formen:</p><div class="variablelist"><dl><dt><span class="term">
<code class="varname">$PACKAGE::form</code>.</p></dd><dt><span class="term">
<code class="literal">local $form</code>
</span></dt><dd><p>Alle Änderungen an <code class="varname">$form</code> werden am Ende
- des scopes zurückgesetzt</p></dd></dl></div></div><div class="sect2" title="4.1.2. Warum sind globale Variablen ein Problem?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4438"></a>4.1.2. Warum sind globale Variablen ein Problem?</h3></div></div></div><p>Das erste Problem ist <span class="productname">FCGI</span>™.</p><p>
+ des scopes zurückgesetzt</p></dd></dl></div></div><div class="sect2" title="4.1.2. Warum sind globale Variablen ein Problem?"><div class="titlepage"><div><div><h3 class="title"><a name="d0e5075"></a>4.1.2. Warum sind globale Variablen ein Problem?</h3></div></div></div><p>Das erste Problem ist <span class="productname">FCGI</span>™.</p><p>
<span class="productname">SQL-Ledger</span>™ hat fast alles im globalen
namespace abgelegt, und erwartet, dass es da auch wiederzufinden ist.
Unter <span class="productname">FCGI</span>™ müssen diese Sachen aber wieder
dies hat, seit der Einführung, u.a. schon so manche langwierige
Bug-Suche verkürzt. Da globale Variablen aber implizit mit Package
angegeben werden, werden die nicht geprüft, und somit kann sich
- schnell ein Tippfehler einschleichen.</p></div><div class="sect2" title="4.1.3. Kanonische globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4471"></a>4.1.3. Kanonische globale Variablen</h3></div></div></div><p>Um dieses Problem im Griff zu halten gibt es einige wenige
+ schnell ein Tippfehler einschleichen.</p></div><div class="sect2" title="4.1.3. Kanonische globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e5108"></a>4.1.3. Kanonische globale Variablen</h3></div></div></div><p>Um dieses Problem im Griff zu halten gibt es einige wenige
globale Variablen, die kanonisch sind, d.h. sie haben bestimmte
vorgegebenen Eigenschaften, und alles andere sollte anderweitig
umhergereicht werden.</p><p>Diese Variablen sind im Moment die folgenden neun:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
<code class="varname">$::request</code>
</p></li></ul></div><p>Damit diese nicht erneut als Müllhalde missbraucht werden, im
Folgenden eine kurze Erläuterung der bestimmten vorgegebenen
- Eigenschaften (Konventionen):</p><div class="sect3" title="4.1.3.1. $::form"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4535"></a>4.1.3.1. $::form</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Ist ein Objekt der Klasse
+ Eigenschaften (Konventionen):</p><div class="sect3" title="4.1.3.1. $::form"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5172"></a>4.1.3.1. $::form</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Ist ein Objekt der Klasse
"<code class="classname">Form</code>"</p></li><li class="listitem"><p>Wird nach jedem Request gelöscht</p></li><li class="listitem"><p>Muss auch in Tests und Konsolenscripts vorhanden
sein.</p></li><li class="listitem"><p>Enthält am Anfang eines Requests die Requestparameter vom
User</p></li><li class="listitem"><p>Kann zwar intern über Requestgrenzen ein Datenbankhandle
push @{ $form->{TEMPLATE_ARRAYS}{number} }, $form->{"partnumber_$i"};
push @{ $form->{TEMPLATE_ARRAYS}{description} }, $form->{"description_$i"};
# ...
-}</pre></div><div class="sect3" title="4.1.3.2. %::myconfig"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4619"></a>4.1.3.2. %::myconfig</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Das einzige Hash unter den globalen Variablen</p></li><li class="listitem"><p>Wird spätestens benötigt wenn auf die Datenbank
+}</pre></div><div class="sect3" title="4.1.3.2. %::myconfig"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5256"></a>4.1.3.2. %::myconfig</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Das einzige Hash unter den globalen Variablen</p></li><li class="listitem"><p>Wird spätestens benötigt wenn auf die Datenbank
zugegriffen wird</p></li><li class="listitem"><p>Wird bei jedem Request neu erstellt.</p></li><li class="listitem"><p>Enthält die Userdaten des aktuellen Logins</p></li><li class="listitem"><p>Sollte nicht ohne Filterung irgendwo gedumpt werden oder
extern serialisiert werden, weil da auch der Datenbankzugriff
für diesen user drinsteht.</p></li><li class="listitem"><p>Enthält unter anderem Listenbegrenzung vclimit,
überwiegend die Daten, die sich unter <span class="guimenu">Programm</span>
-> <span class="guimenuitem">Einstellungen</span> befinden, bzw. die
Informationen über den Benutzer die über die
- Administrator-Schnittstelle (admin.pl) eingegeben wurden.</p></div><div class="sect3" title="4.1.3.3. $::locale"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4658"></a>4.1.3.3. $::locale</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "Locale"</p></li><li class="listitem"><p>Wird pro Request erstellt</p></li><li class="listitem"><p>Muss auch für Tests und Scripte immer verfügbar
+ Administrator-Schnittstelle (admin.pl) eingegeben wurden.</p></div><div class="sect3" title="4.1.3.3. $::locale"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5295"></a>4.1.3.3. $::locale</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "Locale"</p></li><li class="listitem"><p>Wird pro Request erstellt</p></li><li class="listitem"><p>Muss auch für Tests und Scripte immer verfügbar
sein.</p></li><li class="listitem"><p>Cached intern über Requestgrenzen hinweg benutzte
Locales</p></li></ul></div><p>Lokalisierung für den aktuellen User. Alle Übersetzungen,
- Zahlen- und Datumsformatierungen laufen über dieses Objekt.</p></div><div class="sect3" title="4.1.3.4. $::lxdebug"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4676"></a>4.1.3.4. $::lxdebug</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "LXDebug"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Muss immer verfügbar sein, in nahezu allen
+ Zahlen- und Datumsformatierungen laufen über dieses Objekt.</p></div><div class="sect3" title="4.1.3.4. $::lxdebug"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5313"></a>4.1.3.4. $::lxdebug</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "LXDebug"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Muss immer verfügbar sein, in nahezu allen
Funktionen</p></li></ul></div><p>
<code class="varname">$::lxdebug</code> stellt Debuggingfunktionen
bereit, wie "<code class="function">enter_sub</code>" und
"<code class="function">message</code>" und "<code class="function">dump</code>" mit
denen man flott Informationen ins Log (tmp/kivitendo-debug.log)
packen kann.</p><p>Beispielsweise so:</p><pre class="programlisting">$main::lxdebug->message(0, 'Meine Konfig:' . Dumper (%::myconfig));
-$main::lxdebug->message(0, 'Wer bin ich? Kunde oder Lieferant:' . $form->{vc});</pre></div><div class="sect3" title="4.1.3.5. $::auth"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4713"></a>4.1.3.5. $::auth</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "SL::Auth"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Hat eine permanente DB Verbindung zur Authdatenbank</p></li><li class="listitem"><p>Wird nach jedem Request resettet.</p></li></ul></div><p>
+$main::lxdebug->message(0, 'Wer bin ich? Kunde oder Lieferant:' . $form->{vc});</pre></div><div class="sect3" title="4.1.3.5. $::auth"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5350"></a>4.1.3.5. $::auth</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse "SL::Auth"</p></li><li class="listitem"><p>Wird global gecached</p></li><li class="listitem"><p>Hat eine permanente DB Verbindung zur Authdatenbank</p></li><li class="listitem"><p>Wird nach jedem Request resettet.</p></li></ul></div><p>
<code class="varname">$::auth</code> stellt Funktionen bereit um die
Rechte des aktuellen Users abzufragen. Obwohl diese Informationen
vom aktuellen User abhängen wird das Objekt aus
Geschwindigkeitsgründen nur einmal angelegt und dann nach jedem
- Request kurz resettet.</p></div><div class="sect3" title="4.1.3.6. $::lx_office_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4734"></a>4.1.3.6. $::lx_office_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ Request kurz resettet.</p></div><div class="sect3" title="4.1.3.6. $::lx_office_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5371"></a>4.1.3.6. $::lx_office_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="classname">SL::LxOfficeConf</code>"</p></li><li class="listitem"><p>Global gecached</p></li><li class="listitem"><p>Repräsentation der
<code class="filename">config/kivitendo.conf[.default]</code>-Dateien</p></li></ul></div><p>Globale Konfiguration. Configdateien werden zum Start gelesen
und danach nicht mehr angefasst. Es ist derzeit nicht geplant, dass
file = /tmp/kivitendo-debug.log</pre><p>ist der Key <code class="varname">file</code> im Programm als
<code class="varname">$::lx_office_conf->{debug}{file}</code>
erreichbar.</p><div class="warning" title="Warnung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Warning"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Warnung]" src="../../../../system/docbook-xsl/images/warning.png"></td><th align="left">Warnung</th></tr><tr><td align="left" valign="top"><p>Zugriff auf die Konfiguration erfolgt im Moment über
- Hashkeys, sind also nicht gegen Tippfehler abgesichert.</p></td></tr></table></div></div><div class="sect3" title="4.1.3.7. $::instance_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4770"></a>4.1.3.7. $::instance_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ Hashkeys, sind also nicht gegen Tippfehler abgesichert.</p></td></tr></table></div></div><div class="sect3" title="4.1.3.7. $::instance_conf"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5407"></a>4.1.3.7. $::instance_conf</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="classname">SL::InstanceConfiguration</code>"</p></li><li class="listitem"><p>wird pro Request neu erstellt</p></li></ul></div><p>Funktioniert wie <code class="varname">$::lx_office_conf</code>,
speichert aber Daten die von der Instanz abhängig sind. Eine Instanz
ist hier eine Mandantendatenbank. Beispielsweise überprüft
</p><pre class="programlisting">$::instance_conf->get_inventory_system eq 'perpetual'</pre><p>
- ob die berüchtigte Bestandsmethode zur Anwendung kommt.</p></div><div class="sect3" title="4.1.3.8. $::dispatcher"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4791"></a>4.1.3.8. $::dispatcher</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
+ ob die berüchtigte Bestandsmethode zur Anwendung kommt.</p></div><div class="sect3" title="4.1.3.8. $::dispatcher"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5428"></a>4.1.3.8. $::dispatcher</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Objekt der Klasse
"<code class="varname">SL::Dispatcher</code>"</p></li><li class="listitem"><p>wird pro Serverprozess erstellt.</p></li><li class="listitem"><p>enthält Informationen über die technische Verbindung zum
Server</p></li></ul></div><p>Der dritte Punkt ist auch der einzige Grund warum das Objekt
global gespeichert wird. Wird vermutlich irgendwann in einem anderen
- Objekt untergebracht.</p></div><div class="sect3" title="4.1.3.9. $::request"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4809"></a>4.1.3.9. $::request</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Hashref (evtl später Objekt)</p></li><li class="listitem"><p>Wird pro Request neu initialisiert.</p></li><li class="listitem"><p>Keine Unterstruktur garantiert.</p></li></ul></div><p>
+ Objekt untergebracht.</p></div><div class="sect3" title="4.1.3.9. $::request"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5446"></a>4.1.3.9. $::request</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Hashref (evtl später Objekt)</p></li><li class="listitem"><p>Wird pro Request neu initialisiert.</p></li><li class="listitem"><p>Keine Unterstruktur garantiert.</p></li></ul></div><p>
<code class="varname">$::request</code> ist ein generischer Platz um
Daten "für den aktuellen Request" abzulegen. Sollte nicht für action
at a distance benutzt werden, sondern um lokales memoizing zu
<code class="varname">$::request</code>
</p></li><li class="listitem"><p>Muss ich von anderen Teilen des Programms lesend drauf
zugreifen? Dann <code class="varname">$::request</code>, aber Zugriff über
- Wrappermethode</p></li></ul></div></div></div><div class="sect2" title="4.1.4. Ehemalige globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e4851"></a>4.1.4. Ehemalige globale Variablen</h3></div></div></div><p>Die folgenden Variablen waren einmal im Programm, und wurden
- entfernt.</p><div class="sect3" title="4.1.4.1. $::cgi"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4856"></a>4.1.4.1. $::cgi</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil cookie Methoden nicht als
+ Wrappermethode</p></li></ul></div></div></div><div class="sect2" title="4.1.4. Ehemalige globale Variablen"><div class="titlepage"><div><div><h3 class="title"><a name="d0e5488"></a>4.1.4. Ehemalige globale Variablen</h3></div></div></div><p>Die folgenden Variablen waren einmal im Programm, und wurden
+ entfernt.</p><div class="sect3" title="4.1.4.1. $::cgi"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5493"></a>4.1.4.1. $::cgi</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil cookie Methoden nicht als
Klassenfunktionen funktionieren</p></li><li class="listitem"><p>Aufruf als Klasse erzeugt Dummyobjekt was im
Klassennamespace gehalten wird und über Requestgrenzen
leaked</p></li><li class="listitem"><p>liegt jetzt unter
<code class="varname">$::request->{cgi}</code>
- </p></li></ul></div></div><div class="sect3" title="4.1.4.2. $::all_units"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4872"></a>4.1.4.2. $::all_units</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil einige Funktionen in Schleifen zum Teil
+ </p></li></ul></div></div><div class="sect3" title="4.1.4.2. $::all_units"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5509"></a>4.1.4.2. $::all_units</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>war nötig, weil einige Funktionen in Schleifen zum Teil
ein paar hundert mal pro Request eine Liste der Einheiten
brauchen, und de als Parameter durch einen Riesenstack von
Funktionen geschleift werden müssten.</p></li><li class="listitem"><p>Liegt jetzt unter
<code class="varname">$::request->{cache}{all_units}</code>
</p></li><li class="listitem"><p>Wird nur in
<code class="function">AM->retrieve_all_units()</code> gesetzt oder
- gelesen.</p></li></ul></div></div><div class="sect3" title="4.1.4.3. %::called_subs"><div class="titlepage"><div><div><h4 class="title"><a name="d0e4891"></a>4.1.4.3. %::called_subs</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>wurde benutzt um callsub deep recursions
+ gelesen.</p></li></ul></div></div><div class="sect3" title="4.1.4.3. %::called_subs"><div class="titlepage"><div><div><h4 class="title"><a name="d0e5528"></a>4.1.4.3. %::called_subs</h4></div></div></div><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>wurde benutzt um callsub deep recursions
abzufangen.</p></li><li class="listitem"><p>Wurde entfernt, weil callsub nur einen Bruchteil der
möglichen Rekursioenen darstellt, und da nie welche
auftreten.</p></li><li class="listitem"><p>komplette recursion protection wurde entfernt.</p></li></ul></div></div></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch03s03.html">Zurück</a> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch04s02.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">3.3. Excel-Vorlagen </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.2. Entwicklung unter FastCGI</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>4.4. Translations and languages</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s03.html" title="4.3. SQL-Upgradedateien"><link rel="next" href="ch04s05.html" title="4.5. Stil-Richtlinien"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.4. Translations and languages</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> <a accesskey="n" href="ch04s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="4.4. Translations and languages"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="translations-languages"></a>4.4. Translations and languages</h2></div></div></div><div class="sect2" title="4.4.1. Introduction"><div class="titlepage"><div><div><h3 class="title"><a name="translations-languages.introduction"></a>4.4.1. Introduction</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Dieser Abschnitt ist in Englisch geschrieben, um
+ <title>4.4. Translations and languages</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s03.html" title="4.3. SQL-Upgradedateien"><link rel="next" href="ch04s05.html" title="4.5. Die kivitendo-Test-Suite"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.4. Translations and languages</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s03.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> <a accesskey="n" href="ch04s05.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="4.4. Translations and languages"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="translations-languages"></a>4.4. Translations and languages</h2></div></div></div><div class="sect2" title="4.4.1. Introduction"><div class="titlepage"><div><div><h3 class="title"><a name="translations-languages.introduction"></a>4.4.1. Introduction</h3></div></div></div><div class="note" title="Anmerkung" style="margin-left: 0.5in; margin-right: 0.5in;"><table border="0" summary="Note"><tr><td rowspan="2" align="center" valign="top" width="25"><img alt="[Anmerkung]" src="../../../../system/docbook-xsl/images/note.png"></td><th align="left">Anmerkung</th></tr><tr><td align="left" valign="top"><p>Dieser Abschnitt ist in Englisch geschrieben, um
internationalen Übersetzern die Arbeit zu erleichtern.</p></td></tr></table></div><p>This section describes how localization packages in kivitendo
are built. Currently the only language fully supported is German, and
since most of the internal messages are held in English the English
case you made a typo, so that you don't have to translate
everything again. If a tranlsation is missing, the lost file is
checked first. If you maintain a language package, you might
- want to keep this safe somewhere.</p></dd></dl></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s03.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch04s05.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">4.3. SQL-Upgradedateien </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.5. Stil-Richtlinien</td></tr></table></div></body></html>
\ No newline at end of file
+ want to keep this safe somewhere.</p></dd></dl></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s03.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch04s05.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">4.3. SQL-Upgradedateien </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.5. Die kivitendo-Test-Suite</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>4.5. Stil-Richtlinien</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s04.html" title="4.4. Translations and languages"><link rel="next" href="ch04s06.html" title="4.6. Dokumentation erstellen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.5. Stil-Richtlinien</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> <a accesskey="n" href="ch04s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="4.5. Stil-Richtlinien"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.style-guide"></a>4.5. Stil-Richtlinien</h2></div></div></div><p>Die folgenden Regeln haben das Ziel, den Code möglichst gut les-
- und wartbar zu machen. Dazu gehört zum Einen, dass der Code einheitlich
- eingerückt ist, aber auch, dass Mehrdeutigkeit so weit es geht vermieden
- wird (Stichworte "Klammern" oder "Hash-Keys").</p><p>Diese Regeln sind keine Schikane sondern erleichtern allen das
- Leben!</p><p>Jeder, der einen Patch schickt, sollte seinen Code vorher
- überprüfen. Einige der Regeln lassen sich automatisch überprüfen, andere
- nicht.</p><div class="orderedlist"><ol class="orderedlist" type="1"><li class="listitem"><p>Es werden keine echten Tabs sondern Leerzeichen
- verwendet.</p></li><li class="listitem"><p>Die Einrückung beträgt zwei Leerzeichen. Beispiel:</p><pre class="programlisting">foreach my $row (@data) {
- if ($flag) {
- # do something with $row
- }
+ <title>4.5. Die kivitendo-Test-Suite</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s04.html" title="4.4. Translations and languages"><link rel="next" href="ch04s06.html" title="4.6. Stil-Richtlinien"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.5. Die kivitendo-Test-Suite</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s04.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> <a accesskey="n" href="ch04s06.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="4.5. Die kivitendo-Test-Suite"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.testsuite"></a>4.5. Die kivitendo-Test-Suite</h2></div></div></div><div class="sect2" title="4.5.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="devel.testsuite.intro"></a>4.5.1. Einführung</h3></div></div></div><p>kivitendo enthält eine Suite für automatisierte Tests. Sie basiert auf dem Standard-Perl-Modul <code class="literal">Test::More</code>.</p><p>Die grundlegenden Fakten sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Alle Tests liegen im Unterverzeichnis <code class="filename">t/</code>.</p></li><li class="listitem"><p>Ein Script (bzw. ein Test) in <code class="filename">f/</code> enthält einen oder mehrere Testfälle.</p></li><li class="listitem"><p>Alle Dateinamen von Tests enden auf <code class="literal">.t</code>. Es sind selbstständig ausführbare Perl-Scripte.</p></li><li class="listitem"><p>Die Test-Suite besteht aus der Gesamtheit aller Tests, sprich aller Scripte in <code class="filename">f/</code>, deren
+ Dateiname auf <code class="literal">.t</code> endet.</p></li></ul></div></div><div class="sect2" title="4.5.2. Voraussetzungen"><div class="titlepage"><div><div><h3 class="title"><a name="devel.testsuite.prerequisites"></a>4.5.2. Voraussetzungen</h3></div></div></div><p>Für die Ausführung werden neben den für kivitendo eh schon benötigten Module noch weitere Perl-Module benötigt. Diese sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
+ <code class="literal">Test::Deep</code> (Debian-Paketname: <code class="literal">libtest-deep-perl</code>; Fedora Core:
+ <code class="literal">perl-Test-Deep</code>; openSuSE: <code class="literal">perl-Test-Deep</code>)</p></li><li class="listitem"><p>
+ <code class="literal">Test::Harness</code> 3.0.0 oder höher. Dieses Modul ist ab Perl 5.10.1 Bestandteil der
+ Perl-Distribution und kann für frühere Versionen aus dem <a class="ulink" href="http://www.cpan.org" target="_top">CPAN</a> bezogen
+ werden.</p></li></ul></div></div><div class="sect2" title="4.5.3. Existierende Tests ausführen"><div class="titlepage"><div><div><h3 class="title"><a name="devel.testsuite.execution"></a>4.5.3.
+ Existierende Tests ausführen
+ </h3></div></div></div><p>Es gibt mehrere Möglichkeiten zum Ausführen der Tests: entweder, man lässt alle Tests auf einmal ausführen, oder man führt
+ gezielt einzelne Scripte aus. Für beide Fälle gibt es das Helferscript <code class="filename">t/test.sh</code>.</p><p>Will man die komplette Test-Suite ausführen, so muss man einfach nur <code class="filename">t/test.sh</code> ohne weitere Parameter aus
+ dem kivitendo-Basisverzeichnis heraus ausführen.</p><p>Um einzelne Test-Scripte auszuführen, übergibt man deren Namen an <code class="filename">t/test.sh</code>. Beispielsweise:</p><pre class="programlisting">t/test.sh t/form/format_amount.t t/background_job/known_jobs.t</pre></div><div class="sect2" title="4.5.4. Bedeutung der verschiedenen Test-Scripte"><div class="titlepage"><div><div><h3 class="title"><a name="devel.testsuite.meaning_of_scripts"></a>4.5.4.
+ Bedeutung der verschiedenen Test-Scripte
+ </h3></div></div></div><p>Die Test-Suite umfasst Tests sowohl für Funktionen als auch für Programmierstil. Einige besonders zu erwähnende, weil auch
+ während der Entwicklung nützliche Tests sind:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
+ <code class="filename">t/001compile.t</code> -- compiliert alle Quelldateien und bricht bei Fehlern sofort ab</p></li><li class="listitem"><p>
+ <code class="filename">t/002goodperl.t</code> -- überprüft alle Perl-Dateien auf Anwesenheit von '<code class="literal">use strict</code>'-Anweisungen</p></li><li class="listitem"><p>
+ <code class="filename">t/003safesys.t</code> -- überprüft Aufrufe von <code class="function">system()</code> und <code class="function">exec()</code> auf Gültigkeit</p></li><li class="listitem"><p>
+ <code class="filename">t/005no_tabs.t</code> -- überprüft, ob Dateien Tab-Zeichen enthalten</p></li><li class="listitem"><p>
+ <code class="filename">t/006spelling.t</code> -- sucht nach häufigen Rechtschreibfehlern</p></li><li class="listitem"><p>
+ <code class="filename">t/011pod.t</code> -- überprüft die Syntax von Dokumentation im POD-Format auf Gültigkeit</p></li></ul></div><p>Weitere Test-Scripte überprüfen primär die Funktionsweise einzelner Funktionen und Module.</p></div><div class="sect2" title="4.5.5. Neue Test-Scripte erstellen"><div class="titlepage"><div><div><h3 class="title"><a name="devel.testsuite.create_new"></a>4.5.5.
+ Neue Test-Scripte erstellen
+ </h3></div></div></div><p>Es wird sehr gern gesehen, wenn neue Funktionalität auch gleich mit einem Test-Script abgesichert wird. Auch bestehende
+ Funktion darf und soll ausdrücklich nachträglich mit Test-Scripten abgesichert werden.</p><div class="sect3" title="4.5.5.1. Ideen für neue Test-Scripte, die keine konkreten Funktionen testen"><div class="titlepage"><div><div><h4 class="title"><a name="devel.testsuite.ideas_for_non_function_tests"></a>4.5.5.1.
+ Ideen für neue Test-Scripte, die keine konkreten Funktionen testen
+ </h4></div></div></div><p> Ideen, die abgesehen von Funktions noch nicht umgesetzt wurden:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Überprüfung auf fehlende symbolische Links</p></li><li class="listitem"><p>Suche nach Nicht-ASCII-Zeichen in Perl-Code-Dateien (mit gewissen Einschränkungen wie das Erlauben von deutschen Umlauten)</p></li><li class="listitem"><p>Test auf DOS-Zeilenenden (\r\n anstelle von nur \n)</p></li><li class="listitem"><p>Überprüfung auf Leerzeichen am Ende von Zeilen</p></li><li class="listitem"><p>Test, ob alle zu übersetzenden Strings in <code class="filename">locale/de/all</code> vorhanden sind</p></li><li class="listitem"><p>Test, ob alle Webseiten-Templates in <code class="filename">templates/webpages</code> mit vom Perl-Modul <code class="literal">Template</code> compiliert werden können</p></li></ul></div></div><div class="sect3" title="4.5.5.2. Konvention für Verzeichnis- und Dateinamen"><div class="titlepage"><div><div><h4 class="title"><a name="devel.testsuite.directory_and_test_names"></a>4.5.5.2.
+ Konvention für Verzeichnis- und Dateinamen
+ </h4></div></div></div><p>Es gibt momentan eine wenige Richtlinien, wie Test-Scripte zu benennen sind. Bitte die folgenden Punkte als Richtlinie betrachten und ihnen soweit es geht folgen:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>Die Dateiendung muss <code class="filename">.t</code> lauten.</p></li><li class="listitem"><p>Namen sind englisch, komplett klein geschrieben und einzelne Wörter mit Unterstrichten getrennt (beispielsweise
+ <code class="filename">bad_function_params.t</code>).</p></li><li class="listitem"><p>Unterverzeichnisse sollten grob nach dem Themenbereich benannt sind, mit dem sich die Scripte darin befassen
+ (beispielsweise <code class="filename">background_jobs</code> für Tests rund um Hintergrund-Jobs).</p></li><li class="listitem"><p>Test-Scripte sollten einen überschaubaren Bereich von Funktionalität testen, der logisch zusammenhängend ist
+ (z.B. nur Tests für eine einzelne Funktion in einem Modul). Lieber mehrere Test-Scripte schreiben.</p></li></ul></div></div><div class="sect3" title="4.5.5.3. Minimales Skelett für eigene Scripte"><div class="titlepage"><div><div><h4 class="title"><a name="devel.testsuite.minimal_example"></a>4.5.5.3.
+ Minimales Skelett für eigene Scripte
+ </h4></div></div></div><p>Der folgenden Programmcode enthält das kleinstmögliche Testscript und kann als Ausgangspunkt für eigene Tests verwendet werden:</p><pre class="programlisting">use Test::More tests => 0;
- if ($use_modules) {
- $row->{modules} = MODULE->retrieve(
- id => $row->{id},
- date => $use_now ? localtime() : $row->{time},
- );
- }
+use lib 't';
- $report->add($row);
-}</pre></li><li class="listitem"><p>Öffnende geschweifte Klammern befinden sich auf der gleichen
- Zeile wie der letzte Befehl. Beispiele:</p><pre class="programlisting">sub debug {
- ...
-}</pre><p>oder</p><pre class="programlisting">if ($form->{item_rows} > 0) {
- ...
-}</pre></li><li class="listitem"><p>Schließende geschweifte Klammern sind so weit eingerückt wie
- der Befehl / die öffnende schließende Klammer, die den Block
- gestartet hat, und nicht auf der Ebene des Inhalts. Die gleichen
- Beispiele wie bei 3. gelten.</p></li><li class="listitem"><p>Die Wörter "<code class="function">else</code>",
- "<code class="function">elsif</code>", "<code class="function">while</code>" befinden
- sich auf der gleichen Zeile wie schließende geschweifte Klammern.
- Beispiele:</p><pre class="programlisting">if ($form->{sum} > 1000) {
- ...
-} elsif ($form->{sum} > 0) {
- ...
-} else {
- ...
-}
+use Support::TestSetup;
-do {
- ...
-} until ($a > 0);</pre></li><li class="listitem"><p>Parameter von Funktionsaufrufen müssen mit runden Klammern
- versehen werden. Davon nicht betroffen sind interne Perl-Funktionen,
- und grep-ähnliche Operatoren. Beispiel:</p><pre class="programlisting">$main::lxdebug->message("Could not find file.");
-%options = map { $_ => 1 } grep { !/^#/ } @config_file;</pre></li><li class="listitem"><p>Verschiedene Klammern, Ihre Ausdrücke und Leerzeichen:</p><p>Generell gilt: Hashkeys und Arrayindices sollten nicht durch
- Leerzeichen abgesetzt werden. Logische Klammerungen ebensowenig,
- Blöcke schon. Beispiel:</p><pre class="programlisting">if (($form->{debug} == 1) && ($form->{sum} - 100 < 0)) {
- ...
-}
-
-$array[$i + 1] = 4;
-$form->{sum} += $form->{"row_$i"};
-$form->{ $form->{index} } += 1;
-
-map { $form->{sum} += $form->{"row_$_"} } 1..$rowcount;</pre></li><li class="listitem"><p>Mehrzeilige Befehle</p><div class="orderedlist"><ol class="orderedlist" type="a"><li class="listitem"><p>Werden die Parameter eines Funktionsaufrufes auf mehrere
- Zeilen aufgeteilt, so sollten diese bis zu der Spalte eingerückt
- werden, in der die ersten Funktionsparameter in der ersten Zeile
- stehen. Beispiel:</p><pre class="programlisting">$sth = $dbh->prepare("SELECT * FROM some_table WHERE col = ?",
- $form->{some_col_value});</pre></li><li class="listitem"><p>Ein Spezialfall ist der ternäre Oprator "?:", der am
- besten in einer übersichtlichen Tabellenstruktur organisiert
- wird. Beispiel:</p><pre class="programlisting">my $rowcount = $form->{"row_$i"} ? $i
- : $form->{oldcount} ? $form->{oldcount} + 1
- : $form->{rowcount} - $form->{rowbase};</pre></li></ol></div></li><li class="listitem"><p>Kommentare</p><div class="orderedlist"><ol class="orderedlist" type="a"><li class="listitem"><p>Kommentare, die alleine in einer Zeile stehen, sollten
- soweit wie der Code eingerückt sein.</p></li><li class="listitem"><p>Seitliche hängende Kommentare sollten einheitlich
- formatiert werden.</p></li><li class="listitem"><p>Sämtliche Kommentare und Sonstiges im Quellcode ist bitte
- auf Englisch zu verfassen. So wie ich keine Lust habe,
- französischen Quelltext zu lesen, sollte auch der kivitendo
- Quelltext für nicht-Deutschsprachige lesbar sein.
- Beispiel:</p><pre class="programlisting">my $found = 0;
-while (1) {
- last if $found;
-
- # complicated check
- $found = 1 if //
-}
-
-$i = 0 # initialize $i
-$n = $i; # save $i
-$i *= $const; # do something crazy
-$i = $n; # recover $i</pre></li></ol></div></li><li class="listitem"><p>Hashkeys sollten nur in Anführungszeichen stehen, wenn die
- Interpolation gewünscht ist. Beispiel:</p><pre class="programlisting">$form->{sum} = 0;
-$form->{"row_$i"} = $form->{"row_$i"} - 5;
-$some_hash{42} = 54;</pre></li><li class="listitem"><p>Die maximale Zeilenlänge ist nicht beschränkt. Zeilenlängen
- unterhalb von 79 Zeichen helfen unter bestimmten Bedingungen, aber
- wenn die Lesbarkeit unter kurzen Zeilen leidet (wie zum Biespiel in
- grossen Tabellen), dann ist Lesbarkeit vorzuziehen.</p><p>Als Beispiel sei die Funktion
- <code class="function">print_options</code> aus
- <code class="filename">bin/mozilla/io.pl</code> angeführt.</p></li><li class="listitem"><p>Trailing Whitespace, d.h. Leerzeichen am Ende von Zeilen sind
- unerwünscht. Sie führen zu unnötigen Whitespaceänderungen, die diffs
- verfälschen.</p><p>Emacs und vim haben beide recht einfache Methoden zur
- Entfernung von trailing whitespace. Emacs kennt das Kommande
- <span class="command"><strong>nuke-trailing-whitespace</strong></span>, vim macht das gleiche
- manuell über <code class="literal">:%s/\s\+$//e</code> Mit <code class="literal">:au
- BufWritePre * :%s/\s\+$//e</code> wird das an Speichern
- gebunden.</p></li><li class="listitem"><p>Es wird kein <span class="command"><strong>perltidy</strong></span> verwendet.</p><p>In der Vergangenheit wurde versucht,
- <span class="command"><strong>perltidy</strong></span> zu verwenden, um einen einheitlichen
- Stil zu erlangen. Es hat sich aber gezeigt, dass
- <span class="command"><strong>perltidy</strong></span>s sehr eigenwilliges Verhalten, was
- Zeilenumbrüche angeht, oftmals gut formatierten Code zerstört. Für
- den Interessierten sind hier die
- <span class="command"><strong>perltidy</strong></span>-Optionen, die grob den beschriebenen
- Richtlinien entsprechen:</p><pre class="programlisting">-syn -i=2 -nt -pt=2 -sbt=2 -ci=2 -ibc -hsc -noll -nsts -nsfs -asc -dsm
--aws -bbc -bbs -bbb -mbl=1 -nsob -ce -nbl -nsbl -cti=0 -bbt=0 -bar -l=79
--lp -vt=1 -vtc=1</pre></li><li class="listitem"><p>
- <code class="varname">STDERR</code> ist tabu. Unkonditionale
- Debugmeldungen auch.</p><p>kivitendo bietet mit dem Modul <code class="classname">LXDebug</code>
- einen brauchbaren Trace-/Debug-Mechanismus. Es gibt also keinen
- Grund, nach <code class="varname">STDERR</code> zu schreiben.</p><p>Die <code class="classname">LXDebug</code>-Methode
- "<code class="function">message</code>" nimmt als ersten Paramter außerdem
- eine Flagmaske, für die die Meldung angezeigt wird, wobei "0" immer
- angezeigt wird. Solche Meldungen sollten nicht eingecheckt werden
- und werden in den meisten Fällen auch vom Repository
- zurückgewiesen.</p></li><li class="listitem"><p>Alle neuen Module müssen use strict verwenden.</p><p>
- <code class="varname">$form</code>, <code class="varname">$auth</code>,
- <code class="varname">$locale</code>, <code class="varname">$lxdebug</code> und
- <code class="varname">%myconfig</code> werden derzeit aus dem main package
- importiert (siehe <a class="xref" href="ch04.html#devel.globals" title="4.1. Globale Variablen">Globale Variablen</a>. Alle anderen
- Konstrukte sollten lexikalisch lokal gehalten werden.</p></li></ol></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s04.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch04s06.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">4.4. Translations and languages </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.6. Dokumentation erstellen</td></tr></table></div></body></html>
\ No newline at end of file
+Support::TestSetup::login();</pre><p>Wird eine vollständig initialisierte kivitendo-Umgebung benötigt (Stichwort: alle globalen Variablen wie
+ <code class="varname">$::auth</code>, <code class="varname">$::form</code> oder <code class="varname">$::lxdebug</code>), so muss in der Konfigurationsdatei
+ <code class="filename">config/kivitendo.conf</code> im Abschnitt <code class="literal">testing.login</code> ein gültiger Login-Name eingetragen
+ sein. Dieser wird für die Datenbankverbindung benötigt.</p><p>Wir keine vollständig initialisierte Umgebung benötigt, so kann die letzte Zeile <code class="code">Support::TestSetup::login();</code>
+ weggelassen werden, was die Ausführungszeit des Scripts leicht verringert.</p></div></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s04.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch04s06.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">4.4. Translations and languages </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.6. Stil-Richtlinien</td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>4.6. Dokumentation erstellen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s05.html" title="4.5. Stil-Richtlinien"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.6. Dokumentation erstellen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s05.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> </td></tr></table><hr></div><div class="sect1" title="4.6. Dokumentation erstellen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.build-doc"></a>4.6. Dokumentation erstellen</h2></div></div></div><div class="sect2" title="4.6.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.introduction"></a>4.6.1. Einführung</h3></div></div></div><p>Diese Dokumentation ist in <span class="productname">DocBook</span>™
- XML geschrieben. Zum Bearbeiten reicht grundsätzlich ein Text-Editor.
- Mehr Komfort bekommt man, wenn man einen dedizierten XML-fähigen
- Editor nutzt, der spezielle Unterstützung für
- <span class="productname">DocBook</span>™ mitbringt. Wir empfehlen dafür den
- <a class="ulink" href="http://www.xmlmind.com/xmleditor/" target="_top">XMLmind XML
- Editor</a>, der bei nicht kommerzieller Nutzung kostenlos
- ist.</p></div><div class="sect2" title="4.6.2. Benötigte Software"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.required-software"></a>4.6.2. Benötigte Software</h3></div></div></div><p>Bei <span class="productname">DocBook</span>™ ist Prinzip, dass
- ausschließlich die XML-Quelldatei bearbeitet wird. Aus dieser werden
- dann mit entsprechenden Stylesheets andere Formate wie PDF oder HTML
- erzeugt. Bei kivitendo übernimmt diese Aufgabe das Shell-Script
- <span class="command"><strong>scripts/build_doc.sh</strong></span>.</p><p>Das Script benötigt zur Konvertierung verschiedene
- Softwarekomponenten, die im normalen kivitendo-Betrieb nicht benötigt
- werden:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
- <a class="ulink" href="http://www.oracle.com/technetwork/java/index.html" target="_top">Java</a>
- in einer halbwegs aktuellen Version</p></li><li class="listitem"><p>Das Java-Build-System <a class="ulink" href="http://ant.apache.org/" target="_top">Apache Ant</a>
- </p></li><li class="listitem"><p>Das Dokumentations-System Dobudish für
- <span class="productname">DocBook</span>™ 4.5, eine Zusammenstellung
- diverser Stylesheets und Grafiken zur Konvertierung von
- <span class="productname">DocBook</span>™ XML in andere Formate. Das
- Paket, das benötigt wird, ist zum Zeitpunkt der
- Dokumentationserstellung
- <code class="filename">dobudish-nojre-1.1.4.zip</code>, aus auf <a class="ulink" href="http://code.google.com/p/dobudish/downloads/list" target="_top">code.google.com</a>
- bereitsteht.</p></li></ul></div><p>Apache Ant sowie ein dazu passendes Java Runtime Environment
- sind auf allen gängigen Plattformen verfügbar. Beispiel für
- Debian/Ubuntu:</p><pre class="programlisting">apt-get install ant openjdk-7-jre</pre><p>Nach dem Download von Dobudish muss Dobudish im Unterverzeichnis
- <code class="filename">doc/build</code> entpackt werden. Beispiel unter der
- Annahme, das <span class="productname">Dobudish</span>™ in
- <code class="filename">$HOME/Downloads</code> heruntergeladen wurde:</p><pre class="programlisting">cd doc/build
-unzip $HOME/Downloads/dobudish-nojre-1.1.4.zip</pre></div><div class="sect2" title="4.6.3. PDFs und HTML-Seiten erstellen"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.build"></a>4.6.3. PDFs und HTML-Seiten erstellen</h3></div></div></div><p>Die eigentliche Konvertierung erfolgt nach Installation der
- benötigten Software mit einem einfachen Aufruf direkt aus dem
- kivitendo-Installationsverzeichnis heraus:</p><pre class="programlisting">./scripts/build_doc.sh</pre></div><div class="sect2" title="4.6.4. Einchecken in das Git-Repository"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.repository"></a>4.6.4. Einchecken in das Git-Repository</h3></div></div></div><p>Sowohl die XML-Datei als auch die erzeugten PDF- und
- HTML-Dateien sind Bestandteil des Git-Repositories. Daraus folgt, dass
- nach Änderungen am XML die PDF- und HTML-Dokumente ebenfalls gebaut
- und alles zusammen in einem Commit eingecheckt werden sollten.</p><p>Die "<code class="filename">dobudish</code>"-Verzeichnisse bzw.
- symbolischen Links gehören hingegen nicht in das Repository.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s05.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> </td></tr><tr><td width="40%" align="left" valign="top">4.5. Stil-Richtlinien </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> </td></tr></table></div></body></html>
\ No newline at end of file
+ <title>4.6. Stil-Richtlinien</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s05.html" title="4.5. Die kivitendo-Test-Suite"><link rel="next" href="ch04s07.html" title="4.7. Dokumentation erstellen"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.6. Stil-Richtlinien</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s05.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> <a accesskey="n" href="ch04s07.html">Weiter</a></td></tr></table><hr></div><div class="sect1" title="4.6. Stil-Richtlinien"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.style-guide"></a>4.6. Stil-Richtlinien</h2></div></div></div><p>Die folgenden Regeln haben das Ziel, den Code möglichst gut les-
+ und wartbar zu machen. Dazu gehört zum Einen, dass der Code einheitlich
+ eingerückt ist, aber auch, dass Mehrdeutigkeit so weit es geht vermieden
+ wird (Stichworte "Klammern" oder "Hash-Keys").</p><p>Diese Regeln sind keine Schikane sondern erleichtern allen das
+ Leben!</p><p>Jeder, der einen Patch schickt, sollte seinen Code vorher
+ überprüfen. Einige der Regeln lassen sich automatisch überprüfen, andere
+ nicht.</p><div class="orderedlist"><ol class="orderedlist" type="1"><li class="listitem"><p>Es werden keine echten Tabs sondern Leerzeichen
+ verwendet.</p></li><li class="listitem"><p>Die Einrückung beträgt zwei Leerzeichen. Beispiel:</p><pre class="programlisting">foreach my $row (@data) {
+ if ($flag) {
+ # do something with $row
+ }
+
+ if ($use_modules) {
+ $row->{modules} = MODULE->retrieve(
+ id => $row->{id},
+ date => $use_now ? localtime() : $row->{time},
+ );
+ }
+
+ $report->add($row);
+}</pre></li><li class="listitem"><p>Öffnende geschweifte Klammern befinden sich auf der gleichen
+ Zeile wie der letzte Befehl. Beispiele:</p><pre class="programlisting">sub debug {
+ ...
+}</pre><p>oder</p><pre class="programlisting">if ($form->{item_rows} > 0) {
+ ...
+}</pre></li><li class="listitem"><p>Schließende geschweifte Klammern sind so weit eingerückt wie
+ der Befehl / die öffnende schließende Klammer, die den Block
+ gestartet hat, und nicht auf der Ebene des Inhalts. Die gleichen
+ Beispiele wie bei 3. gelten.</p></li><li class="listitem"><p>Die Wörter "<code class="function">else</code>",
+ "<code class="function">elsif</code>", "<code class="function">while</code>" befinden
+ sich auf der gleichen Zeile wie schließende geschweifte Klammern.
+ Beispiele:</p><pre class="programlisting">if ($form->{sum} > 1000) {
+ ...
+} elsif ($form->{sum} > 0) {
+ ...
+} else {
+ ...
+}
+
+do {
+ ...
+} until ($a > 0);</pre></li><li class="listitem"><p>Parameter von Funktionsaufrufen müssen mit runden Klammern
+ versehen werden. Davon nicht betroffen sind interne Perl-Funktionen,
+ und grep-ähnliche Operatoren. Beispiel:</p><pre class="programlisting">$main::lxdebug->message("Could not find file.");
+%options = map { $_ => 1 } grep { !/^#/ } @config_file;</pre></li><li class="listitem"><p>Verschiedene Klammern, Ihre Ausdrücke und Leerzeichen:</p><p>Generell gilt: Hashkeys und Arrayindices sollten nicht durch
+ Leerzeichen abgesetzt werden. Logische Klammerungen ebensowenig,
+ Blöcke schon. Beispiel:</p><pre class="programlisting">if (($form->{debug} == 1) && ($form->{sum} - 100 < 0)) {
+ ...
+}
+
+$array[$i + 1] = 4;
+$form->{sum} += $form->{"row_$i"};
+$form->{ $form->{index} } += 1;
+
+map { $form->{sum} += $form->{"row_$_"} } 1..$rowcount;</pre></li><li class="listitem"><p>Mehrzeilige Befehle</p><div class="orderedlist"><ol class="orderedlist" type="a"><li class="listitem"><p>Werden die Parameter eines Funktionsaufrufes auf mehrere
+ Zeilen aufgeteilt, so sollten diese bis zu der Spalte eingerückt
+ werden, in der die ersten Funktionsparameter in der ersten Zeile
+ stehen. Beispiel:</p><pre class="programlisting">$sth = $dbh->prepare("SELECT * FROM some_table WHERE col = ?",
+ $form->{some_col_value});</pre></li><li class="listitem"><p>Ein Spezialfall ist der ternäre Oprator "?:", der am
+ besten in einer übersichtlichen Tabellenstruktur organisiert
+ wird. Beispiel:</p><pre class="programlisting">my $rowcount = $form->{"row_$i"} ? $i
+ : $form->{oldcount} ? $form->{oldcount} + 1
+ : $form->{rowcount} - $form->{rowbase};</pre></li></ol></div></li><li class="listitem"><p>Kommentare</p><div class="orderedlist"><ol class="orderedlist" type="a"><li class="listitem"><p>Kommentare, die alleine in einer Zeile stehen, sollten
+ soweit wie der Code eingerückt sein.</p></li><li class="listitem"><p>Seitliche hängende Kommentare sollten einheitlich
+ formatiert werden.</p></li><li class="listitem"><p>Sämtliche Kommentare und Sonstiges im Quellcode ist bitte
+ auf Englisch zu verfassen. So wie ich keine Lust habe,
+ französischen Quelltext zu lesen, sollte auch der kivitendo
+ Quelltext für nicht-Deutschsprachige lesbar sein.
+ Beispiel:</p><pre class="programlisting">my $found = 0;
+while (1) {
+ last if $found;
+
+ # complicated check
+ $found = 1 if //
+}
+
+$i = 0 # initialize $i
+$n = $i; # save $i
+$i *= $const; # do something crazy
+$i = $n; # recover $i</pre></li></ol></div></li><li class="listitem"><p>Hashkeys sollten nur in Anführungszeichen stehen, wenn die
+ Interpolation gewünscht ist. Beispiel:</p><pre class="programlisting">$form->{sum} = 0;
+$form->{"row_$i"} = $form->{"row_$i"} - 5;
+$some_hash{42} = 54;</pre></li><li class="listitem"><p>Die maximale Zeilenlänge ist nicht beschränkt. Zeilenlängen
+ unterhalb von 79 Zeichen helfen unter bestimmten Bedingungen, aber
+ wenn die Lesbarkeit unter kurzen Zeilen leidet (wie zum Biespiel in
+ grossen Tabellen), dann ist Lesbarkeit vorzuziehen.</p><p>Als Beispiel sei die Funktion
+ <code class="function">print_options</code> aus
+ <code class="filename">bin/mozilla/io.pl</code> angeführt.</p></li><li class="listitem"><p>Trailing Whitespace, d.h. Leerzeichen am Ende von Zeilen sind
+ unerwünscht. Sie führen zu unnötigen Whitespaceänderungen, die diffs
+ verfälschen.</p><p>Emacs und vim haben beide recht einfache Methoden zur
+ Entfernung von trailing whitespace. Emacs kennt das Kommande
+ <span class="command"><strong>nuke-trailing-whitespace</strong></span>, vim macht das gleiche
+ manuell über <code class="literal">:%s/\s\+$//e</code> Mit <code class="literal">:au
+ BufWritePre * :%s/\s\+$//e</code> wird das an Speichern
+ gebunden.</p></li><li class="listitem"><p>Es wird kein <span class="command"><strong>perltidy</strong></span> verwendet.</p><p>In der Vergangenheit wurde versucht,
+ <span class="command"><strong>perltidy</strong></span> zu verwenden, um einen einheitlichen
+ Stil zu erlangen. Es hat sich aber gezeigt, dass
+ <span class="command"><strong>perltidy</strong></span>s sehr eigenwilliges Verhalten, was
+ Zeilenumbrüche angeht, oftmals gut formatierten Code zerstört. Für
+ den Interessierten sind hier die
+ <span class="command"><strong>perltidy</strong></span>-Optionen, die grob den beschriebenen
+ Richtlinien entsprechen:</p><pre class="programlisting">-syn -i=2 -nt -pt=2 -sbt=2 -ci=2 -ibc -hsc -noll -nsts -nsfs -asc -dsm
+-aws -bbc -bbs -bbb -mbl=1 -nsob -ce -nbl -nsbl -cti=0 -bbt=0 -bar -l=79
+-lp -vt=1 -vtc=1</pre></li><li class="listitem"><p>
+ <code class="varname">STDERR</code> ist tabu. Unkonditionale
+ Debugmeldungen auch.</p><p>kivitendo bietet mit dem Modul <code class="classname">LXDebug</code>
+ einen brauchbaren Trace-/Debug-Mechanismus. Es gibt also keinen
+ Grund, nach <code class="varname">STDERR</code> zu schreiben.</p><p>Die <code class="classname">LXDebug</code>-Methode
+ "<code class="function">message</code>" nimmt als ersten Paramter außerdem
+ eine Flagmaske, für die die Meldung angezeigt wird, wobei "0" immer
+ angezeigt wird. Solche Meldungen sollten nicht eingecheckt werden
+ und werden in den meisten Fällen auch vom Repository
+ zurückgewiesen.</p></li><li class="listitem"><p>Alle neuen Module müssen use strict verwenden.</p><p>
+ <code class="varname">$form</code>, <code class="varname">$auth</code>,
+ <code class="varname">$locale</code>, <code class="varname">$lxdebug</code> und
+ <code class="varname">%myconfig</code> werden derzeit aus dem main package
+ importiert (siehe <a class="xref" href="ch04.html#devel.globals" title="4.1. Globale Variablen">Globale Variablen</a>. Alle anderen
+ Konstrukte sollten lexikalisch lokal gehalten werden.</p></li></ol></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s05.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> <a accesskey="n" href="ch04s07.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top">4.5. Die kivitendo-Test-Suite </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> 4.7. Dokumentation erstellen</td></tr></table></div></body></html>
\ No newline at end of file
--- /dev/null
+<html><head>
+ <meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
+ <title>4.7. Dokumentation erstellen</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="up" href="ch04.html" title="Kapitel 4. Entwicklerdokumentation"><link rel="prev" href="ch04s06.html" title="4.6. Stil-Richtlinien"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">4.7. Dokumentation erstellen</th></tr><tr><td width="20%" align="left"><a accesskey="p" href="ch04s06.html">Zurück</a> </td><th width="60%" align="center">Kapitel 4. Entwicklerdokumentation</th><td width="20%" align="right"> </td></tr></table><hr></div><div class="sect1" title="4.7. Dokumentation erstellen"><div class="titlepage"><div><div><h2 class="title" style="clear: both"><a name="devel.build-doc"></a>4.7. Dokumentation erstellen</h2></div></div></div><div class="sect2" title="4.7.1. Einführung"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.introduction"></a>4.7.1. Einführung</h3></div></div></div><p>Diese Dokumentation ist in <span class="productname">DocBook</span>™
+ XML geschrieben. Zum Bearbeiten reicht grundsätzlich ein Text-Editor.
+ Mehr Komfort bekommt man, wenn man einen dedizierten XML-fähigen
+ Editor nutzt, der spezielle Unterstützung für
+ <span class="productname">DocBook</span>™ mitbringt. Wir empfehlen dafür den
+ <a class="ulink" href="http://www.xmlmind.com/xmleditor/" target="_top">XMLmind XML
+ Editor</a>, der bei nicht kommerzieller Nutzung kostenlos
+ ist.</p></div><div class="sect2" title="4.7.2. Benötigte Software"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.required-software"></a>4.7.2. Benötigte Software</h3></div></div></div><p>Bei <span class="productname">DocBook</span>™ ist Prinzip, dass
+ ausschließlich die XML-Quelldatei bearbeitet wird. Aus dieser werden
+ dann mit entsprechenden Stylesheets andere Formate wie PDF oder HTML
+ erzeugt. Bei kivitendo übernimmt diese Aufgabe das Shell-Script
+ <span class="command"><strong>scripts/build_doc.sh</strong></span>.</p><p>Das Script benötigt zur Konvertierung verschiedene
+ Softwarekomponenten, die im normalen kivitendo-Betrieb nicht benötigt
+ werden:</p><div class="itemizedlist"><ul class="itemizedlist" type="disc"><li class="listitem"><p>
+ <a class="ulink" href="http://www.oracle.com/technetwork/java/index.html" target="_top">Java</a>
+ in einer halbwegs aktuellen Version</p></li><li class="listitem"><p>Das Java-Build-System <a class="ulink" href="http://ant.apache.org/" target="_top">Apache Ant</a>
+ </p></li><li class="listitem"><p>Das Dokumentations-System Dobudish für
+ <span class="productname">DocBook</span>™ 4.5, eine Zusammenstellung
+ diverser Stylesheets und Grafiken zur Konvertierung von
+ <span class="productname">DocBook</span>™ XML in andere Formate. Das
+ Paket, das benötigt wird, ist zum Zeitpunkt der
+ Dokumentationserstellung
+ <code class="filename">dobudish-nojre-1.1.4.zip</code>, aus auf <a class="ulink" href="http://code.google.com/p/dobudish/downloads/list" target="_top">code.google.com</a>
+ bereitsteht.</p></li></ul></div><p>Apache Ant sowie ein dazu passendes Java Runtime Environment
+ sind auf allen gängigen Plattformen verfügbar. Beispiel für
+ Debian/Ubuntu:</p><pre class="programlisting">apt-get install ant openjdk-7-jre</pre><p>Nach dem Download von Dobudish muss Dobudish im Unterverzeichnis
+ <code class="filename">doc/build</code> entpackt werden. Beispiel unter der
+ Annahme, das <span class="productname">Dobudish</span>™ in
+ <code class="filename">$HOME/Downloads</code> heruntergeladen wurde:</p><pre class="programlisting">cd doc/build
+unzip $HOME/Downloads/dobudish-nojre-1.1.4.zip</pre></div><div class="sect2" title="4.7.3. PDFs und HTML-Seiten erstellen"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.build"></a>4.7.3. PDFs und HTML-Seiten erstellen</h3></div></div></div><p>Die eigentliche Konvertierung erfolgt nach Installation der
+ benötigten Software mit einem einfachen Aufruf direkt aus dem
+ kivitendo-Installationsverzeichnis heraus:</p><pre class="programlisting">./scripts/build_doc.sh</pre></div><div class="sect2" title="4.7.4. Einchecken in das Git-Repository"><div class="titlepage"><div><div><h3 class="title"><a name="devel.build-doc.repository"></a>4.7.4. Einchecken in das Git-Repository</h3></div></div></div><p>Sowohl die XML-Datei als auch die erzeugten PDF- und
+ HTML-Dateien sind Bestandteil des Git-Repositories. Daraus folgt, dass
+ nach Änderungen am XML die PDF- und HTML-Dokumente ebenfalls gebaut
+ und alles zusammen in einem Commit eingecheckt werden sollten.</p><p>Die "<code class="filename">dobudish</code>"-Verzeichnisse bzw.
+ symbolischen Links gehören hingegen nicht in das Repository.</p></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"><a accesskey="p" href="ch04s06.html">Zurück</a> </td><td width="20%" align="center"><a accesskey="u" href="ch04.html">Nach oben</a></td><td width="40%" align="right"> </td></tr><tr><td width="40%" align="left" valign="top">4.6. Stil-Richtlinien </td><td width="20%" align="center"><a accesskey="h" href="index.html">Zum Anfang</a></td><td width="40%" align="right" valign="top"> </td></tr></table></div></body></html>
\ No newline at end of file
<html><head>
<meta http-equiv="Content-Type" content="text/html; charset=UTF-8">
- <title>kivitendo: Installation, Konfiguration, Entwicklung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="next" href="ch01.html" title="Kapitel 1. Aktuelle Hinweise"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">kivitendo: Installation, Konfiguration, Entwicklung</th></tr><tr><td width="20%" align="left"> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr></table><hr></div><div lang="de" class="book" title="kivitendo: Installation, Konfiguration, Entwicklung"><div class="titlepage"><div><div><h1 class="title"><a name="kivitendo-documentation"></a>kivitendo: Installation, Konfiguration, Entwicklung</h1></div></div><hr></div><div class="toc"><p><b>Inhaltsverzeichnis</b></p><dl><dt><span class="chapter"><a href="ch01.html">1. Aktuelle Hinweise</a></span></dt><dt><span class="chapter"><a href="ch02.html">2. Installation und Grundkonfiguration</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch02.html#Ben%C3%B6tigte-Software-und-Pakete">2.1. Benötigte Software und Pakete</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02.html#Betriebssystem">2.1.1. Betriebssystem</a></span></dt><dt><span class="sect2"><a href="ch02.html#Pakete">2.1.2. Pakete</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s02.html">2.2. Manuelle Installation des Programmpaketes</a></span></dt><dt><span class="sect1"><a href="ch02s03.html">2.3. kivitendo-Konfigurationsdatei</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s03.html#config.config-file.introduction">2.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.sections-parameters">2.3.2. Abschnitte und Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.prior-versions">2.3.3. Versionen vor 2.6.3</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s04.html">2.4. Anpassung der PostgreSQL-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s04.html#Zeichens%C3%A4tze-die-Verwendung-von-UTF-8">2.4.1. Zeichensätze/die Verwendung von UTF-8</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#%C3%84nderungen-an-Konfigurationsdateien">2.4.2. Änderungen an Konfigurationsdateien</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren">2.4.3. Erweiterung für servergespeicherte Prozeduren</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Datenbankbenutzer-anlegen">2.4.4. Datenbankbenutzer anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s05.html">2.5. Webserver-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s05.html#d0e490">2.5.1. Grundkonfiguration mittels CGI</a></span></dt><dt><span class="sect2"><a href="ch02s05.html#Apache-Konfiguration.FCGI">2.5.2. Konfiguration für FastCGI/FCGI</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s06.html">2.6. Der Task-Server</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s06.html#Konfiguration-des-Task-Servers">2.6.1. Verfügbare und notwendige Konfigurationsoptionen</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Einbinden-in-den-Boot-Prozess">2.6.2. Automatisches Starten des Task-Servers beim Booten</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle">2.6.3. Wie der Task-Server gestartet und beendet wird</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle2">2.6.4. Task-Server mit mehreren Mandanten</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s07.html">2.7. Benutzerauthentifizierung und Administratorpasswort</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s07.html#Grundlagen-zur-Benutzerauthentifizierung">2.7.1. Grundlagen zur Benutzerauthentifizierung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Administratorpasswort">2.7.2. Administratorpasswort</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Authentifizierungsdatenbank">2.7.3. Authentifizierungsdatenbank</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Passwort%C3%BCberpr%C3%BCfung">2.7.4. Passwortüberprüfung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Name-des-Session-Cookies">2.7.5. Name des Session-Cookies</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Anlegen-der-Authentifizierungsdatenbank">2.7.6. Anlegen der Authentifizierungsdatenbank</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s08.html">2.8. Benutzer- und Gruppenverwaltung</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s08.html#Zusammenh%C3%A4nge">2.8.1. Zusammenhänge</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Datenbanken-anlegen">2.8.2. Datenbanken anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppen-anlegen">2.8.3. Gruppen anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Benutzer-anlegen">2.8.4. Benutzer anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppenmitgliedschaften-verwalten">2.8.5. Gruppenmitgliedschaften verwalten</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Migration-alter-Installationen">2.8.6. Migration alter Installationen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s09.html">2.9. Drucken mit kivitendo</a></span></dt><dt><span class="sect1"><a href="ch02s10.html">2.10. OpenDocument-Vorlagen</a></span></dt><dt><span class="sect1"><a href="ch02s11.html">2.11. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
- EUR</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s11.html#config.eur.introduction">2.11.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.parameters">2.11.2. Konfigurationsparameter</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.setting-parameters">2.11.3. Festlegen der Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.inventory-system-perpetual">2.11.4. Bemerkungen zu Bestandsmethode</a></span></dt><dt><span class="sect2"><a href="ch02s11.html#config.eur.knonw-issues">2.11.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s12.html">2.12. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s12.html#config.skr04-update-3804.introduction">2.12.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.skr04-update-3804.create-chart">2.12.2. Konto 3804 manuell anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s13.html">2.13. kivitendo ERP verwenden</a></span></dt></dl></dd><dt><span class="chapter"><a href="ch03.html">3. Features und Funktionen</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch03.html#features.periodic-invoices">3.1. Wiederkehrende Rechnungen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.introduction">3.1.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.configuration">3.1.2. Konfiguration</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.reports">3.1.3. Auflisten</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.task-server">3.1.4. Erzeugung der eigentlichen Rechnungen</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.create-for-current-month">3.1.5. Erste Rechnung für aktuellen Monat erstellen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s02.html">3.2. Dokumentenvorlagen und verfügbare Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.einf%C3%BChrung">3.2.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.variablen-ausgeben">3.2.2. Variablen ausgeben</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.verwendung-in-druckbefehlen">3.2.3. Verwendung in Druckbefehlen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.tag-style">3.2.4. Anfang und Ende der Tags verändern</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.zuordnung-dateinamen">3.2.5. Zuordnung von den Dateinamen zu den Funktionen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.dateinamen-erweitert">3.2.6. Sprache, Drucker und E-Mail</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.allgemeine-variablen">3.2.7. Allgemeine Variablen, die in allen Vorlagen vorhanden
+ <title>kivitendo: Installation, Konfiguration, Entwicklung</title><link rel="stylesheet" type="text/css" href="style.css"><meta name="generator" content="DocBook XSL Stylesheets V1.76.1-RC2"><link rel="home" href="index.html" title="kivitendo: Installation, Konfiguration, Entwicklung"><link rel="next" href="ch01.html" title="Kapitel 1. Aktuelle Hinweise"></head><body bgcolor="white" text="black" link="#0000FF" vlink="#840084" alink="#0000FF"><div class="navheader"><table width="100%" summary="Navigation header"><tr><th colspan="3" align="center">kivitendo: Installation, Konfiguration, Entwicklung</th></tr><tr><td width="20%" align="left"> </td><th width="60%" align="center"> </th><td width="20%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr></table><hr></div><div lang="de" class="book" title="kivitendo: Installation, Konfiguration, Entwicklung"><div class="titlepage"><div><div><h1 class="title"><a name="kivitendo-documentation"></a>kivitendo: Installation, Konfiguration, Entwicklung</h1></div></div><hr></div><div class="toc"><p><b>Inhaltsverzeichnis</b></p><dl><dt><span class="chapter"><a href="ch01.html">1. Aktuelle Hinweise</a></span></dt><dt><span class="chapter"><a href="ch02.html">2. Installation und Grundkonfiguration</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch02.html#Ben%C3%B6tigte-Software-und-Pakete">2.1. Benötigte Software und Pakete</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02.html#Betriebssystem">2.1.1. Betriebssystem</a></span></dt><dt><span class="sect2"><a href="ch02.html#Pakete">2.1.2. Pakete</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s02.html">2.2. Manuelle Installation des Programmpaketes</a></span></dt><dt><span class="sect1"><a href="ch02s03.html">2.3. kivitendo-Konfigurationsdatei</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s03.html#config.config-file.introduction">2.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.sections-parameters">2.3.2. Abschnitte und Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s03.html#config.config-file.prior-versions">2.3.3. Versionen vor 2.6.3</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s04.html">2.4. Anpassung der PostgreSQL-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s04.html#Zeichens%C3%A4tze-die-Verwendung-von-UTF-8">2.4.1. Zeichensätze/die Verwendung von UTF-8</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#%C3%84nderungen-an-Konfigurationsdateien">2.4.2. Änderungen an Konfigurationsdateien</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Erweiterung-f%C3%BCr-servergespeicherte-Prozeduren">2.4.3. Erweiterung für servergespeicherte Prozeduren</a></span></dt><dt><span class="sect2"><a href="ch02s04.html#Datenbankbenutzer-anlegen">2.4.4. Datenbankbenutzer anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s05.html">2.5. Webserver-Konfiguration</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s05.html#d0e592">2.5.1. Grundkonfiguration mittels CGI</a></span></dt><dt><span class="sect2"><a href="ch02s05.html#Apache-Konfiguration.FCGI">2.5.2. Konfiguration für FastCGI/FCGI</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s06.html">2.6. Der Task-Server</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s06.html#Konfiguration-des-Task-Servers">2.6.1. Verfügbare und notwendige Konfigurationsoptionen</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Einbinden-in-den-Boot-Prozess">2.6.2. Automatisches Starten des Task-Servers beim Booten</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle">2.6.3. Wie der Task-Server gestartet und beendet wird</a></span></dt><dt><span class="sect2"><a href="ch02s06.html#Prozesskontrolle2">2.6.4. Task-Server mit mehreren Mandanten</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s07.html">2.7. Benutzerauthentifizierung und Administratorpasswort</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s07.html#Grundlagen-zur-Benutzerauthentifizierung">2.7.1. Grundlagen zur Benutzerauthentifizierung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Administratorpasswort">2.7.2. Administratorpasswort</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Authentifizierungsdatenbank">2.7.3. Authentifizierungsdatenbank</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Passwort%C3%BCberpr%C3%BCfung">2.7.4. Passwortüberprüfung</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Name-des-Session-Cookies">2.7.5. Name des Session-Cookies</a></span></dt><dt><span class="sect2"><a href="ch02s07.html#Anlegen-der-Authentifizierungsdatenbank">2.7.6. Anlegen der Authentifizierungsdatenbank</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s08.html">2.8. Benutzer- und Gruppenverwaltung</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s08.html#Zusammenh%C3%A4nge">2.8.1. Zusammenhänge</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Datenbanken-anlegen">2.8.2. Datenbanken anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppen-anlegen">2.8.3. Gruppen anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Benutzer-anlegen">2.8.4. Benutzer anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Gruppenmitgliedschaften-verwalten">2.8.5. Gruppenmitgliedschaften verwalten</a></span></dt><dt><span class="sect2"><a href="ch02s08.html#Migration-alter-Installationen">2.8.6. Migration alter Installationen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s09.html">2.9. E-Mail-Versand aus kivitendo heraus</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s09.html#config.sending-email.sendmail">2.9.1. Versand über lokalen E-Mail-Server</a></span></dt><dt><span class="sect2"><a href="ch02s09.html#config.sending-email.smtp">2.9.2. Versand über einen SMTP-Server</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s10.html">2.10. Drucken mit kivitendo</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s10.html#Vorlagenverzeichnis-anlegen">2.10.1. Vorlagenverzeichnis anlegen</a></span></dt><dt><span class="sect2"><a href="ch02s10.html#Vorlagen-Standard">2.10.2. Standard</a></span></dt><dt><span class="sect2"><a href="ch02s10.html#f-tex">2.10.3. f-tex</a></span></dt><dt><span class="sect2"><a href="ch02s10.html#Vorlagen-RB">2.10.4. RB</a></span></dt><dt><span class="sect2"><a href="ch02s10.html#allgemeine-hinweise-zu-latex">2.10.5. Allgemeine Hinweise zu LaTeX Vorlagen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s11.html">2.11. OpenDocument-Vorlagen</a></span></dt><dt><span class="sect1"><a href="ch02s12.html">2.12. Konfiguration zur Einnahmenüberschussrechnung/Bilanzierung:
+ EUR</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s12.html#config.eur.introduction">2.12.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.eur.parameters">2.12.2. Konfigurationsparameter</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.eur.setting-parameters">2.12.3. Festlegen der Parameter</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.eur.inventory-system-perpetual">2.12.4. Bemerkungen zu Bestandsmethode</a></span></dt><dt><span class="sect2"><a href="ch02s12.html#config.eur.knonw-issues">2.12.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s13.html">2.13. SKR04 19% Umstellung für innergemeinschaftlichen Erwerb</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch02s13.html#config.skr04-update-3804.introduction">2.13.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch02s13.html#config.skr04-update-3804.create-chart">2.13.2. Konto 3804 manuell anlegen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch02s14.html">2.14. Einstellungen pro Mandant</a></span></dt><dt><span class="sect1"><a href="ch02s15.html">2.15. kivitendo ERP verwenden</a></span></dt></dl></dd><dt><span class="chapter"><a href="ch03.html">3. Features und Funktionen</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch03.html#features.periodic-invoices">3.1. Wiederkehrende Rechnungen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.introduction">3.1.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.configuration">3.1.2. Konfiguration</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.reports">3.1.3. Auflisten</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.task-server">3.1.4. Erzeugung der eigentlichen Rechnungen</a></span></dt><dt><span class="sect2"><a href="ch03.html#features.periodic-invoices.create-for-current-month">3.1.5. Erste Rechnung für aktuellen Monat erstellen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s02.html">3.2. Dokumentenvorlagen und verfügbare Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.einf%C3%BChrung">3.2.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.variablen-ausgeben">3.2.2. Variablen ausgeben</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.verwendung-in-druckbefehlen">3.2.3. Verwendung in Druckbefehlen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.tag-style">3.2.4. Anfang und Ende der Tags verändern</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.zuordnung-dateinamen">3.2.5. Zuordnung von den Dateinamen zu den Funktionen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.dateinamen-erweitert">3.2.6. Sprache, Drucker und E-Mail</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.allgemeine-variablen">3.2.7. Allgemeine Variablen, die in allen Vorlagen vorhanden
sind</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.invoice">3.2.8. Variablen in Rechnungen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.dunning">3.2.9. Variablen in Mahnungen und Rechnungen über Mahngebühren</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.andere-vorlagen">3.2.10. Variablen in anderen Vorlagen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.bloecke">3.2.11. Blöcke, bedingte Anweisungen und Schleifen</a></span></dt><dt><span class="sect2"><a href="ch03s02.html#dokumentenvorlagen-und-variablen.markup">3.2.12. Markup-Code zur Textformatierung innerhalb von
- Formularen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s03.html">3.3. Excel-Vorlagen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s03.html#excel-templates.summary">3.3.1. Zusammenfassung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.usage">3.3.2. Bedienung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.syntax">3.3.3. Variablensyntax</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.limitations">3.3.4. Einschränkungen</a></span></dt></dl></dd></dl></dd><dt><span class="chapter"><a href="ch04.html">4. Entwicklerdokumentation</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch04.html#devel.globals">4.1. Globale Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04.html#d0e4337">4.1.1. Wie sehen globale Variablen in Perl aus?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4438">4.1.2. Warum sind globale Variablen ein Problem?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4471">4.1.3. Kanonische globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e4851">4.1.4. Ehemalige globale Variablen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s02.html">4.2. Entwicklung unter FastCGI</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.general">4.2.1. Allgemeines</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.exiting">4.2.2. Programmende und Ausnahmen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.globals">4.2.3. Globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.performance">4.2.4. Performance und Statistiken</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.known-issues">4.2.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s03.html">4.3. SQL-Upgradedateien</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.introduction">4.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.format">4.3.2. Format der Kontrollinformationen</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.dbupgrade-tool">4.3.3. Hilfsscript dbupgrade2_tool.pl</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s04.html">4.4. Translations and languages</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s04.html#translations-languages.introduction">4.4.1. Introduction</a></span></dt><dt><span class="sect2"><a href="ch04s04.html#translations-languages.file-structure">4.4.2. File structure</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s05.html">4.5. Stil-Richtlinien</a></span></dt><dt><span class="sect1"><a href="ch04s06.html">4.6. Dokumentation erstellen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.introduction">4.6.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.required-software">4.6.2. Benötigte Software</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.build">4.6.3. PDFs und HTML-Seiten erstellen</a></span></dt><dt><span class="sect2"><a href="ch04s06.html#devel.build-doc.repository">4.6.4. Einchecken in das Git-Repository</a></span></dt></dl></dd></dl></dd></dl></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top"> </td><td width="20%" align="center"> </td><td width="40%" align="right" valign="top"> Kapitel 1. Aktuelle Hinweise</td></tr></table></div></body></html>
\ No newline at end of file
+ Formularen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch03s03.html">3.3. Excel-Vorlagen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch03s03.html#excel-templates.summary">3.3.1. Zusammenfassung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.usage">3.3.2. Bedienung</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.syntax">3.3.3. Variablensyntax</a></span></dt><dt><span class="sect2"><a href="ch03s03.html#excel-templates.limitations">3.3.4. Einschränkungen</a></span></dt></dl></dd></dl></dd><dt><span class="chapter"><a href="ch04.html">4. Entwicklerdokumentation</a></span></dt><dd><dl><dt><span class="sect1"><a href="ch04.html#devel.globals">4.1. Globale Variablen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04.html#d0e4974">4.1.1. Wie sehen globale Variablen in Perl aus?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e5075">4.1.2. Warum sind globale Variablen ein Problem?</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e5108">4.1.3. Kanonische globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04.html#d0e5488">4.1.4. Ehemalige globale Variablen</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s02.html">4.2. Entwicklung unter FastCGI</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.general">4.2.1. Allgemeines</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.exiting">4.2.2. Programmende und Ausnahmen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.globals">4.2.3. Globale Variablen</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.performance">4.2.4. Performance und Statistiken</a></span></dt><dt><span class="sect2"><a href="ch04s02.html#devel.fcgi.known-issues">4.2.5. Bekannte Probleme</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s03.html">4.3. SQL-Upgradedateien</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.introduction">4.3.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.format">4.3.2. Format der Kontrollinformationen</a></span></dt><dt><span class="sect2"><a href="ch04s03.html#db-upgrade-files.dbupgrade-tool">4.3.3. Hilfsscript dbupgrade2_tool.pl</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s04.html">4.4. Translations and languages</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s04.html#translations-languages.introduction">4.4.1. Introduction</a></span></dt><dt><span class="sect2"><a href="ch04s04.html#translations-languages.file-structure">4.4.2. File structure</a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s05.html">4.5. Die kivitendo-Test-Suite</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s05.html#devel.testsuite.intro">4.5.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s05.html#devel.testsuite.prerequisites">4.5.2. Voraussetzungen</a></span></dt><dt><span class="sect2"><a href="ch04s05.html#devel.testsuite.execution">4.5.3.
+ Existierende Tests ausführen
+ </a></span></dt><dt><span class="sect2"><a href="ch04s05.html#devel.testsuite.meaning_of_scripts">4.5.4.
+ Bedeutung der verschiedenen Test-Scripte
+ </a></span></dt><dt><span class="sect2"><a href="ch04s05.html#devel.testsuite.create_new">4.5.5.
+ Neue Test-Scripte erstellen
+ </a></span></dt></dl></dd><dt><span class="sect1"><a href="ch04s06.html">4.6. Stil-Richtlinien</a></span></dt><dt><span class="sect1"><a href="ch04s07.html">4.7. Dokumentation erstellen</a></span></dt><dd><dl><dt><span class="sect2"><a href="ch04s07.html#devel.build-doc.introduction">4.7.1. Einführung</a></span></dt><dt><span class="sect2"><a href="ch04s07.html#devel.build-doc.required-software">4.7.2. Benötigte Software</a></span></dt><dt><span class="sect2"><a href="ch04s07.html#devel.build-doc.build">4.7.3. PDFs und HTML-Seiten erstellen</a></span></dt><dt><span class="sect2"><a href="ch04s07.html#devel.build-doc.repository">4.7.4. Einchecken in das Git-Repository</a></span></dt></dl></dd></dl></dd></dl></div></div><div class="navfooter"><hr><table width="100%" summary="Navigation footer"><tr><td width="40%" align="left"> </td><td width="20%" align="center"> </td><td width="40%" align="right"> <a accesskey="n" href="ch01.html">Weiter</a></td></tr><tr><td width="40%" align="left" valign="top"> </td><td width="20%" align="center"> </td><td width="40%" align="right" valign="top"> Kapitel 1. Aktuelle Hinweise</td></tr></table></div></body></html>
\ No newline at end of file
* Testlauf t/test.sh
- - Im Moment sind 4 Fehler optimal (die sind noch nicht angegangen):
- o bin/mozilla/ar.pl contains at least 190 html tags.
+ - Im Moment sind 3 Fehler optimal (die sind noch nicht angegangen):
o bin/mozilla/ic.pl contains at least 130 html tags.
o bin/mozilla/ap.pl contains at least 183 html tags.
o bin/mozilla/admin.pl DOES NOT use proper system or exec calls
* Status Bugzilla
- Aus dem Bugsprint sollten keine Bugs mit Target der neuen Version mehr
- offen sein.
+ offen sein, ist aber unrealistisch. Die noch offenen Bugs müssen bewertet
+ werden. Kritische Bugs müssen behoben, weniger kritische evtl auf die
+ nächste Version verschoben werden.
- Neue Bugs seit dem Bugsprint müssen bewertet, gegebenenfalls behoben
werden.
- Sollten noch schwere Probleme existieren, Release verschieben.
o copy&paste in eine Datei
o perl -pale '$_=" - Bugfix $F[0]: @F[1..$#F]"' oder awk/sed drüber
+ Das gleiche für trac:
+ o Individuelle Abfrage
+ + geändert zwischen <letztes Releasedatum> und <heute>
+ + Status closed
+ + Lösung behobena
+ + Komponente ist Lx-Office ERP
+ o Spalten: nur Zusammenfassung
+ o sortieren nach Ticketnummer
+ o rest weiter ab copy&paste
+
- Ausserdem einmal durch das git scrollen und sinnvolle grössere Änderungen
ins changelog übertragen. Muss nur einmal gemacht werden, möglichst danach
nur noch inkrementell.
* Locales auf Vollständigkeit prüfen
$ scripts/locales.pl de
- $ scripts/locales.pl de_DE
* SL::DB::Helper::ALL auf Vollständigkeit prüfen
});
// legacy. sone forms install these
if (typeof fokus == 'function') { fokus(); return; }
- if (focus_by_name('fokus')) return;
if (focus_by_name('cursor_fokus')) return;
set_cursor_to_first_element();
});
'#1 of #2 importable objects were imported.' => '#1 von #2 importierbaren Objekten wurden importiert.',
'#1 prices were updated.' => '#1 Preise wurden aktualisiert.',
'* there are restrictions for the perpetual method, look at chapter "Bemerkungen zu Bestandsmethode" in' => ' für die Bestandsmethode gibt es Einschränkungen, siehe Kapitel "Bemerkungen zu Bestandsmethode" in',
- '*) Since version 2.7 these parameters ares set in the client database and not in the lx-erp.conf / lx_office.conf file, details in chapter:' => '*) Seit 2.7 werden Gewinnermittlungsart, Versteuerungsart und Warenbuchungsmethode in der Mandanten-DB gesteuert und nicht mehr in der lx-erp.conf / lx_office.conf, Umstellungs-Details:',
+ '*) Since version 2.7 these parameters ares set in the client database and not in the configuration file, details in chapter:' => '*) Seit 2.7 werden Gewinnermittlungsart, Versteuerungsart und Warenbuchungsmethode in der Mandanten-DB gesteuert und nicht mehr in der Konfigurationsdatei, Umstellungs-Details:',
'*/' => '*/',
'---please select---' => '---bitte auswählen---',
'...after loggin in' => '...nach dem Anmelden',
'AP Transaction Storno (one letter abbreviation)' => 'S',
'AP Transaction with Storno (abbreviation)' => 'K(S)',
'AP Transactions' => 'Kreditorenbuchungen',
+ 'AP transactions changeable' => 'Änderbarkeit von Kreditorenbuchungen',
'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
'AR' => 'Verkauf',
'AR Aging' => 'Offene Forderungen',
'AR Transaction' => 'Debitorenbuchung',
'AR Transaction (abbreviation)' => 'D',
'AR Transactions' => 'Debitorenbuchungen',
+ 'AR transactions changeable' => 'Änderbarkeit von Debitorenbuchungen',
'ASSETS' => 'AKTIVA',
+ 'ATTENTION! If you enabled this feature you can not simply turn it off again without taking care that best_before fields are emptied in the database.' => 'ACHTUNG! Wenn Sie diese Einstellung aktivieren, dann können Sie sie später nicht ohne Weiteres deaktivieren, ohne dafür zu sorgen, dass die Felder der Mindeshaltbarkeitsdaten in der Datenbank leer gemacht werden.',
+ 'ATTENTION! You can not simply change it from periodic to perpetual once you started posting.' => 'ACHTUNG! Es kann nicht ohne Weiteres im laufenden Betrieb von der Aufwandsmethode zur Bestandsmethode gewechselt werden.',
'Abort' => 'Abbrechen',
'Abrechnungsnummer' => 'Abrechnungsnummer',
'Abteilung' => 'Abteilung',
'Account Link IC_taxpart' => 'Warenliste Steuer',
'Account Link IC_taxservice' => 'Dienstleistungen Steuer',
'Account Number' => 'Kontonummer',
- 'Account Number already used!' => 'Kontonummer ist bereits in Benutzung!',
'Account Number missing!' => 'Kontonummer fehlt!',
'Account Nummer' => 'Kontonummer',
'Account Type' => 'Kontoart',
'Account for interest' => 'Konto für Zinsen',
'Account number' => 'Kontonummer',
'Account number #1, bank code #2, #3' => 'Kontonummer #1, BLZ #2, #3',
+ 'Account number not unique!' => 'Kontonummer bereits vorhanden!',
'Account saved!' => 'Konto gespeichert!',
'Accounting Group deleted!' => 'Buchungsgruppe gelöscht!',
'Accounting Group saved!' => 'Buchungsgruppe gespeichert!',
'Accounting method' => 'Versteuerungsart',
- 'Accrual' => 'Bilanzierung',
+ 'Accrual' => 'Soll-Versteuerung',
'Active' => 'Aktiv',
'Active?' => 'Aktiviert?',
'Add' => 'Erfassen',
'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
'Amount' => 'Betrag',
'Amount Due' => 'Betrag fällig',
- 'Amount has to be greater then zero! Wrong row number: ' => 'Leere Eingabe oder Werte kleiner, gleich null eingegeben. Fehler in Reihe Nummer: ',
'Amount payable' => 'Noch zu bezahlender Betrag',
'Amount payable less discount' => 'Noch zu bezahlender Betrag abzüglich Skonto',
'An exception occurred during execution.' => 'Während der Ausführung trat eine Ausnahme auf.',
'An upper-case character is required.' => 'Ein Großbuchstabe ist vorgeschrieben.',
'Annotations' => 'Anmerkungen',
'Another user with the login #1 does already exist.' => 'Es existiert bereits ein anderer Benutzer mit diesem Login.',
+ 'Any stock contents containing a best before date will be impossible to stock out otherwise.' => 'Sonst können Artikel, bei denen ein Mindesthaltbarkeitsdatum gesetzt ist, nicht mehr ausgelagert werden.',
'Ap aging on %s' => 'Offene Verbindlichkeiten zum %s',
'Application Error. No Format given' => 'Fehler in der Anwendung. Das Ausgabeformat fehlt.',
'Application Error. Wrong Format' => 'Fehler in der Anwendung. Falsches Format: ',
'Bin From' => 'Quelllagerplatz',
'Bin List' => 'Lagerliste',
'Bin To' => 'Ziellagerplatz',
- 'Binding to the LDAP server as "#1" failed. Please check config/lx_office.conf.' => 'Die Anmeldung am LDAP-Server als "#1" schlug fehl. Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
+ 'Binding to the LDAP server as "#1" failed. Please check config/kivitendo.conf.' => 'Die Anmeldung am LDAP-Server als "#1" schlug fehl. Bitte überprüfen Sie die Angaben in config/kivitendo.conf.',
'Bins saved.' => 'Lagerplätze gespeichert.',
'Bins that have been used in the past cannot be deleted anymore. For these bins there\'s no checkbox in the "Delete" column.' => 'Lagerplätze, die bereits benutzt wurden, können nicht mehr gelöscht werden. Deswegen fehlt bei ihnen die Checkbox in der Spalte "Löschen".',
'Birthday' => 'Geburtstag',
+ 'Birthday (after conversion)' => 'Geburtstag (nach Umstellung)',
+ 'Birthday (before conversion)' => 'Geburtstag (vor Umstellung)',
'Bis' => 'bis',
'Bis Konto: ' => 'bis Konto: ',
'Block' => 'Block',
'Check' => 'Scheck',
'Check Details' => 'Bitte Angaben überprüfen',
'Check for duplicates' => 'Dublettencheck',
+ 'Check on ap transaction' => 'Prüfen bei Kreditorenbuchung',
+ 'Check on ar transaction' => 'Prüfen bei Debitorenbuchung',
+ 'Check on gl transaction' => 'Prüfen bei Dialogbuchung',
+ 'Check on purchase invoice' => 'Prüfen bei Einkaufsrechnung',
+ 'Check on sales invoice' => 'Prüfen bei Verkaufsrechnung',
'Checks' => 'Schecks',
'Choose Customer' => 'Endkunde wählen:',
'Choose Outputformat' => 'Ausgabeformat auswählen...',
'Cleared Balance' => 'abgeschlossen',
'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
'Click on login name to edit!' => 'Zum Bearbeiten den Benutzernamen anklicken!',
+ 'Client Configuration' => 'Mandantenkonfiguration',
+ 'Client Configuration saved!' => 'Mandantenkonfiguration gespeichert!',
'Close' => 'Übernehmen',
'Close Books up to' => 'Die Bücher abschließen bis zum',
'Close Dialog' => 'Schließen',
'Contacts' => 'Ansprechpersonen',
'Continue' => 'Weiter',
'Contra' => 'gegen',
+ 'Conversion of "birthday" contact person attribute' => 'Umstellung des Kontaktpersonenfeldes "Geburtstag"',
'Copies' => 'Kopien',
'Correct taxkey' => 'Richtiger Steuerschlüssel',
'Corrections' => 'Korrekturen',
'DATEV - Export Assistent' => 'DATEV-Exportassistent',
'DATEV Angaben' => 'DATEV-Angaben',
'DATEV Export' => 'DATEV-Export',
+ 'DATEV check configuration' => 'Einstellungen für DATEV-Prüfung',
'DATEV check returned errors:' => 'Die DATEV Prüfung dieser Buchung ergab Fehler:',
'DATEX - Export Assistent' => 'DATEV-Exportassistent',
'DELETED' => 'Gelöscht',
'Database Administration' => 'Datenbankadministration',
'Database Connection Test' => 'Test der Datenbankverbindung',
'Database Host' => 'Datenbankcomputer',
+ 'Database ID' => 'Datenbank-ID',
'Database User' => 'Datenbankbenutzer',
'Database User missing!' => 'Datenbankbenutzer fehlt!',
'Database backups and restorations are disabled in the configuration.' => 'Datenbanksicherungen und -wiederherstellungen sind in der Konfiguration deaktiviert.',
'End date' => 'Enddatum',
'Enter a description for this new draft.' => 'Geben Sie eine Beschreibung für diesen Entwurf ein.',
'Enter longdescription' => 'Langtext eingeben',
+ 'Enter the abbreviations separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen als Abkürzungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
+ 'Entries for which automatic conversion failed:' => 'Einträge, für die die automatische Umstellung fehlschlug:',
+ 'Entries for which automatic conversion succeeded:' => 'Einträge, für die die automatische Umstellung erfolgreich war:',
'Equity' => 'Passiva',
'Error' => 'Fehler',
'Error in database control file \'%s\': %s' => 'Fehler in Datenbankupgradekontrolldatei \'%s\': %s',
'Full access to all functions' => 'Vollzugriff auf alle Funktionen',
'Fwd' => 'Vorwärts',
'GL Transaction' => 'Dialogbuchung',
+ 'GL transactions changeable' => 'Änderbarkeit von Dialogbuchungen',
'Gegenkonto' => 'Gegenkonto',
'Gender' => 'Geschlecht',
'General Ledger' => 'Finanzbuchhaltung',
'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => 'Wenn Sie für die Artikelnummer und / oder die Beschreibung etwas eingeben, so werden nur die Lagerplätze angezeigt, in denen Waren eingelagert sind, die Ihre Suchbegriffe enthalten.',
'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => 'Wenn Sie diese Meldung sehen haben Sie wahrscheinlich ein frisches LX-Office Setup und noch keine Buchungsgruppen eingerichtet. Ein Administrator kann dies im Systemmenü erledigen.',
'If you select a base unit then you also have to enter a factor.' => 'Wenn Sie eine Basiseinheit auswählen, dann müssen Sie auch einen Faktor eingeben.',
- 'If you want to change any of these parameters then press the "Back" button, edit the file "config/lx_office.conf" and login into the admin module again.' => 'Wenn Sie einen der Parameter ändern wollen, so drücken Sie auf den "Zurück"-Button, bearbeiten Sie die Datei "config/lx_office.conf", und melden Sie sich erneut im Administrationsbereich an.',
+ 'If you want to change any of these parameters then press the "Back" button, edit the file "config/kivitendo.conf" and login into the admin module again.' => 'Wenn Sie einen der Parameter ändern wollen, so drücken Sie auf den "Zurück"-Button, bearbeiten Sie die Datei "config/kivitendo.conf", und melden Sie sich erneut im Administrationsbereich an.',
'If you want to delete such a dataset you have to edit the user(s) that are using the dataset in question and have them use another dataset.' => 'Wenn Sie eine solche Datenbank löschen wollen, so müssen Sie zuerst die Benutzer bearbeiten, die die fragliche Datenbank benutzen, und sie so ändern, dass sie eine andere Datenbank benutzen.',
'If you want to set up the authentication database yourself then log in to the administration panel. kivitendo will then create the database and tables for you.' => 'Wenn Sie die Authentifizierungs-Datenbank selber einrichten wollen, so melden Sie sich im Administrationsbereich an. kivitendo wird dann die Datenbank und die erforderlichen Tabellen für Sie anlegen.',
'Image' => 'Grafik',
'Invoice total less discount' => 'Rechnungssumme abzüglich Skonto',
'Invoice with Storno (abbreviation)' => 'R(S)',
'Invoices' => 'Rechnungen',
+ 'Invoices, Credit Notes & AR Transactions' => 'Rechnungen, Gutschriften & Debitorenbuchungen',
'Is Searchable' => 'Durchsuchbar',
'Is this a summary account to record' => 'Sammelkonto für',
'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => 'Es ist möglich, dies für einige, aber nicht für alle Buchungsgruppen automatisch zu erledigen.',
'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => 'Das ist für einige Einheiten automatisch möglich, aber bei anderen muss der Benutzer die neue Einheit auswählen.',
+ 'It is possible to make a quick DATEV export everytime you post a record to ensure things work nicely with their data requirements. This will result in a slight overhead though you can enable this for each type of record independantly.' => 'Es ist möglich, bei jeder Buchung einen schnellen DATEV-Export durchzuführen, um sicherzustellen, dass die Datensätze den DATEV-Anforderungen genügen. Da dies einen kleinen Overhead bedeutet, lässt sich die Einstellung für jeden Buchungstyp getrennt einstellen.',
'It may optionally be compressed with "gzip".' => 'Sie darf optional mit "gzip" komprimiert sein.',
'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
'Item deleted!' => 'Artikel gelöscht!',
'KNE-Export erfolgreich!' => 'KNE-Export erfolgreich!',
'KNr. beim Kunden' => 'KNr. beim Kunden',
'Keine Suchergebnisse gefunden!' => 'Keine Suchergebnisse gefunden!',
- 'Kivitendo needs to update the authentication database before you can proceed.' => 'kivitendo muss die Authentifizierungsdatenbank aktualisieren, bevor Sie fortfahren können.',
- 'Kivitendo will then update the database automatically.' => 'kivitendo wird die Datenbank daraufhin automatisch aktualisieren.',
'Konten' => 'Konten',
'L' => 'L',
'LIABILITIES' => 'PASSIVA',
'Long Dates' => 'Lange Monatsnamen',
'Long Description' => 'Langtext',
'MAILED' => 'Gesendet',
- 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' => 'Ihr Browser kann leider keine eingebetteten Frames anzeigen. Bitte wählen Sie ein anderes Menü in der Benutzerkonfiguration im Administrationsmenü aus.',
'Main Preferences' => 'Grundeinstellungen',
'Main sorting' => 'Hauptsortierung',
'Make' => 'Lieferant',
- 'Make (with X being a number)' => 'Lieferant (X ist eine fortlaufende Zahl)',
+ 'Make (vendor\'s database ID, number or name; with X being a number)' => 'Lieferant (Datenbank-ID, Nummer oder Name des Lieferanten; X ist eine fortlaufende Zahl)',
'Make compatible for import' => 'Für den Import kompatibel machen',
'Make default profile' => 'Zu Standardprofil machen',
'Manage Custom Variables' => 'Benutzerdefinierte Variablen',
'No file has been uploaded yet.' => 'Es wurde noch keine Datei hochgeladen.',
'No group has been selected, or the group does not exist anymore.' => 'Es wurde keine Gruppe ausgewählt, oder die Gruppe wurde in der Zwischenzeit gelöscht.',
'No groups have been added yet.' => 'Es wurden noch keine Gruppen angelegt.',
- 'No or an unknown authenticantion module specified in "config/lx_office.conf".' => 'Es wurde kein oder ein unbekanntes Authentifizierungsmodul in "config/lx_office.conf" angegeben.',
+ 'No or an unknown authenticantion module specified in "config/kivitendo.conf".' => 'Es wurde kein oder ein unbekanntes Authentifizierungsmodul in "config/kivitendo.conf" angegeben.',
'No part was found matching the search parameters.' => 'Es wurde kein Artikel gefunden, auf den die Suchparameter zutreffen.',
'No payment term has been created yet.' => 'Es wurden noch keine Zahlungsbedingungen angelegt.',
'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
'Notes' => 'Bemerkungen',
'Notes (translation for #1)' => 'Bemerkungen (Übersetzung für #1)',
'Notes (will appear on hard copy)' => 'Bemerkungen',
+ 'Notes for customer' => 'Bemerkungen beim Kunden',
+ 'Notes for vendor' => 'Bemerkungen beim Lieferanten',
'Nothing has been selected for removal.' => 'Es wurde nichts für eine Entnahme ausgewählt.',
'Nothing has been selected for transfer.' => 'Es wurde nichts zum Umlagern ausgewählt.',
'Nothing selected!' => 'Es wurde nichts ausgewählt!',
'Order Number missing!' => 'Auftragsnummer fehlt!',
'Order deleted!' => 'Auftrag gelöscht!',
'Ordered' => 'Vom Kunde bestellt',
+ 'Orders / Delivery Orders deleteable' => 'Aufträge / Lieferscheine löschbar',
'Orientation' => 'Seitenformat',
'Orphaned' => 'Nie benutzt',
'Other users\' follow-ups' => 'Wiedervorlagen anderer Benutzer',
'Payment terms (database ID)' => 'Zahlungsbedingungen (Datenbank-ID)',
'Payment terms (name)' => 'Zahlungsbedingungen (Name)',
'Payments' => 'Zahlungsausgänge',
+ 'Payments Changeable' => 'Änderbarkeit von Zahlungen',
'Per. Inv.' => 'Wied. Rech.',
+ 'Perform check when a gl transaction is posted?' => 'Prüfung durchführen, wenn eine Dialogbuchung gebucht wird?',
+ 'Perform check when a purchase invoice or a payment for a purchase invoice is posted?' => 'Prüfung durchführen, wenn eine Einkaufsrechnung oder ein Zahlungsausgang hierfür gebucht wird?',
+ 'Perform check when a sales invoice or a payment for a sales invoice is posted?' => 'Prüfung durchführen, wenn eine Verkaufsrechnung oder ein Zahlungseingang hierfür gebucht wird?',
+ 'Perform check when an ap transaction is posted?' => 'Prüfung durchführen, wenn eine Kreditorenbuchung gebucht wird?',
+ 'Perform check when an ar transaction is posted?' => 'Prüfung durchführen, wenn eine Debiotorenbuchung gebucht wird?',
'Period' => 'Zeitraum',
'Period:' => 'Zeitraum:',
'Periodic Invoices' => 'Wiederkehrende Rechnungen',
'Post' => 'Buchen',
'Post Payment' => 'Zahlung buchen',
'Post payments' => 'Zahlungen buchen',
+ 'Posting Configuration' => 'Buchungskonfiguration',
'Postscript' => 'Postscript',
'Posustva_coa' => 'USTVA Kennz.',
'Preferences' => 'Einstellungen',
'Projects' => 'Projekte',
'Projecttransactions' => 'Projektbuchungen',
'Prozentual/Absolut' => 'Prozentual/Absolut',
+ 'Purchase Delivery Orders deleteable' => 'Einkaufslieferscheine löschbar',
'Purchase Invoice' => 'Einkaufsrechnung',
'Purchase Order' => 'Lieferantenauftrag',
'Purchase Orders' => 'Lieferantenaufträge',
+ 'Purchase Orders deleteable' => 'Lieferantenaufträge löschbar',
'Purchase Price' => 'Einkaufspreis',
'Purchase Prices' => 'Einkaufspreise',
'Purchase delivery order' => 'Lieferschein (Einkauf)',
'Purchase invoices' => 'Einkaufsrechnungen',
+ 'Purchase invoices changeable' => 'Änderbarkeit von Einkaufsrechnunen',
'Purchase net amount' => 'EK-Betrag',
'Purchase price' => 'EK-Preis',
'Purchase price total' => 'EK-Betrag',
'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
'Reference' => 'Referenz',
'Reference / Invoice Number' => 'Referenz / Rechnungsnummer',
+ 'Reference day' => 'Stichtag',
'Reference missing!' => 'Referenz fehlt!',
'Release From Stock' => 'Lagerausgang',
'Remaining' => 'Rest',
'Revenues EU without UStId' => 'Erlöse EU o. UStId',
'Review of Aging list' => 'Altersstrukturliste',
'Right' => 'Rechts',
+ 'Row #1: amount has to be different from zero.' => 'Zeile #1: Der Wert darf nicht 0 sein.',
+ 'Row number' => 'Zeilennummer',
'Run at' => 'Ausgeführt um',
'SAVED' => 'Gespeichert',
'SAVED FOR DUNNING' => 'Gespeichert',
'Saldo neu' => 'Saldo neu',
'Saldo per' => 'Saldo per',
'Sale Prices' => 'Verkaufspreise',
+ 'Sales Delivery Orders deleteable' => 'Verkaufslieferscheine löschbar',
'Sales Invoice' => 'Rechnung',
'Sales Invoices' => 'Kundenrechnung',
'Sales Order' => 'Kundenauftrag',
'Sales Orders' => 'Aufträge',
+ 'Sales Orders deleteable' => 'Kundenaufträge löschbar',
'Sales Price information' => 'Verkaufspreisinformation',
'Sales Report' => 'Verkaufsbericht',
'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
'Sales delivery order' => 'Lieferschein (Verkauf)',
'Sales invoice number' => 'Ausgangsrechnungsnummer',
'Sales invoices' => 'Verkaufsrechnungen',
+ 'Sales invoices changeable' => 'Änderbarkeit von Verkaufsrechnungen',
'Sales margin' => 'Marge',
'Sales margin %' => 'Marge prozentual',
'Sales net amount' => 'VK-Betrag',
'Shipto is in use and was flagged invalid.' => 'Lieferadresse ist noch in Verwendung, und wurde als ungültig markiert.',
'Shopartikel' => 'Shopartikel',
'Short' => 'Knapp',
+ 'Should ap transactions be and when should they be changeable or deleteable after posting?' => 'Sollen Kreditorenbuchungen nach der Buchung zu ändern oder zu löschen sein?',
+ 'Should ar transactions be and when should they be changeable or deleteable after posting?' => 'Sollen Debitorenbuchungen nach der Buchung zu ändern oder zu löschen sein?',
+ 'Should gl transactions be and when should they be changeable or deleteable after posting?' => 'Sollen Dialogbuchungen nach der Buchung zu ändern oder zu löschen sein?',
+ 'Should payments be and when should they be changeable after posting?' => 'Sollen Zahlungen nach dem Buchen änderbar sein, und wenn ja, wann?',
+ 'Should purchase invoices be and when should they be deleteable after posting?' => 'Sollen Einkaufsrechnungen nach der Buchung zu löschen sein?',
+ 'Should sales invoices be and when should they be changeable or deleteable after posting?' => 'Sollen Verkaufrechnung nach der Buchung zu ändern oder zu löschen sein?',
+ 'Should the "mark as paid" button showed in ap transactions?' => 'Soll der Knopf "als bezahlt markieren" bei Kreditorenbuchungen angezeigt werden?',
+ 'Should the "mark as paid" button showed in ar transactions?' => 'Soll der Knopf "als bezahlt markieren" bei Debitorenbuchungen angezeigt werden?',
+ 'Should the "mark as paid" button showed in purchase invoices?' => 'Soll der Knopf "als bezahlt markieren" bei Einkaufsrechnungen angezeigt werden?',
+ 'Should the "mark as paid" button showed on sales invoices?' => 'Soll der Knopf "als bezahlt markieren" bei Verkaufsrechnungen angezeigt werden?',
'Show' => 'Zeigen',
+ 'Show "mark as paid" in ap transactions' => '"als bezahlt markieren" bei Kreditorenbuchungen anzeigen',
+ 'Show "mark as paid" in ar transactions' => '"als bezahlt markieren" bei Debitorenbuchungen anzeigen',
+ 'Show "mark as paid" in purchase invoices' => '"als bezahlt markieren" bei Einkaufsrechnungen anzeigen',
+ 'Show "mark as paid" in sales invoices' => '"als bezahlt markieren" bei Verkaufsrechnungen anzeigen',
+ 'Show Bestbefore' => 'Mindesthaltbarkeit anzeigen',
'Show Filter' => 'Filter zeigen',
'Show Salesman' => 'Verkäufer anzeigen',
'Show TODO list' => 'Aufgabenliste anzeigen',
'Show by default' => 'Standardmäßig anzeigen',
'Show custom variable search inputs' => 'Suchoptionen für Benutzerdefinierte Variablen verstecken',
+ 'Show delete button in purchase delivery orders?' => 'Soll der "Löschen"-Knopf bei Einkaufslieferscheinen angezeigt werden?',
+ 'Show delete button in purchase orders?' => 'Soll der "Löschen"-Knopf bei Lieferantenaufträgen angezeigt werden?',
+ 'Show delete button in sales delivery orders?' => 'Soll der "Löschen"-Knopf bei Verkaufslieferscheinen angezeigt werden?',
+ 'Show delete button in sales orders?' => 'Soll der "Löschen"-Knopf bei Kundenaufträgen angezeigt werden?',
'Show details' => 'Detailsanzeige',
+ 'Show fields used for the best before date?' => 'Felder zur Eingabe des Mindesthaltbarkeitsdatums anzeigen?',
'Show follow ups...' => 'Zeige Wiedervorlagen...',
'Show help text' => 'Hilfetext anzeigen',
'Show items from invoices individually' => 'Artikel aus Rechnungen anzeigen',
'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
- 'The LDAP server "#1:#2" is unreachable. Please check config/lx_office.conf.' => 'Der LDAP-Server "#1:#2" ist nicht erreichbar. Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
+ 'The LDAP server "#1:#2" is unreachable. Please check config/kivitendo.conf.' => 'Der LDAP-Server "#1:#2" ist nicht erreichbar. Bitte überprüfen Sie die Angaben in config/kivitendo.conf.',
'The SEPA export has been created.' => 'Der SEPA-Export wurde erstellt',
'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
'The access rights have been saved.' => 'Die Zugriffsrechte wurden gespeichert.',
'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird übersprungen.',
'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefügt.',
+ 'The action you\'ve chosen has not been executed because the document does not contain any item yet.' => 'Die von Ihnen ausgewählte Aktion wurde nicht ausgeführt, weil der Beleg noch keine Positionen enthält.',
'The application "#1" was not found on the system.' => 'Die Anwendung "#1" wurde auf dem System nicht gefunden.',
'The assembly has been created.' => 'Das Erzeugnis wurde hergestellt.',
'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => 'Der Korrekturassistent konnte kein Problem bei #1 feststellen. Eventuell wurde das Problem in der Zwischenzeit bereits behoben.',
'The business has been saved.' => 'Der Kunden-/Lieferantentyp wurde gespeichert.',
'The business is in use and cannot be deleted.' => 'Der Kunden-/Lieferantentyp wird benutzt und kann nicht gelöscht werden.',
'The changing of tax-o-matic account is NOT recommended, but if you do so please also (re)configure buchungsgruppen and reconfigure ALL charts which point to this tax-o-matic account. ' => 'Es wird nicht empfohlen Steuerkonten (Umsatzsteuer oder Vorsteuer) "umzuhängen", aber falls es gemacht wird, bitte auch entsprechend konsequent die Buchungsgruppen und die Konten die mit dieser Steuer verknüpft sind umkonfigurieren.',
+ 'The column "make_X" can contain either a vendor\'s database ID, a vendor number or a vendor\'s name.' => 'Die Spalte "make_X" can entweder die Datenbank-ID des Lieferanten, eine Lieferantennummer oder einen Lieferantennamen enthalten.',
+ 'The column triplets can occur multiple times with different numbers "X" each time (e.g. "make_1", "model_1", "lastcost_1", "make_2", "model_2", "lastcost_2", "make_3", "model_3", "lastcost_3" etc).' => 'Die Spalten-Dreiergruppen können mehrfach auftreten, sofern sie unterschiedliche Nummern "X" verwenden (z.B. "make_1", "model_1", "lastcost_1", "make_2", "model_2", "lastcost_2", "make_3", "model_3", "lastcost_3" etc).',
'The columns "Dunning Duedate", "Total Fees" and "Interest" show data for the previous dunning created for this invoice.' => 'Die Spalten "Zahlbar bis", "Kumulierte Gebühren" und "Zinsen" zeigen Daten der letzten für diese Rechnung erzeugten Mahnung.',
- 'The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/lx_office.conf.' => 'Die Verbindung zum LDAP-Server kann nicht verschlüsselt werden (Fehler bei SSL/TLS-Initialisierung). Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
+ 'The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/kivitendo.conf.' => 'Die Verbindung zum LDAP-Server kann nicht verschlüsselt werden (Fehler bei SSL/TLS-Initialisierung). Bitte überprüfen Sie die Angaben in config/kivitendo.conf.',
'The connection to the authentication database failed:' => 'Die Verbindung zur Authentifizierungsdatenbank schlug fehl:',
'The connection to the database could not be established.' => 'Die Verbindung zur Datenbank konnte nicht hergestellt werden.',
'The connection to the template database failed:' => 'Die Verbindung zur Vorlagendatenbank schlug fehl:',
'The connection was established successfully.' => 'Die Verbindung zur Datenbank wurde erfolgreich hergestellt.',
+ 'The contact person attribute "birthday" is converted from a free-form text field into a date field.' => 'Das Kontaktpersonenfeld "Geburtstag" wird von einem freien Textfeld auf ein Datumsfeld umgestellt.',
'The creation of the authentication database failed:' => 'Das Anlegen der Authentifizierungsdatenbank schlug fehl:',
'The custom variable has been deleted.' => 'Die benutzerdefinierte Variable wurde gelöscht.',
'The custom variable has been saved.' => 'Die benutzerdefinierte Variable wurde gespeichert.',
'The following Buchungsgruppen have already been created:' => 'Die folgenden Buchungsgruppen wurden bereits angelegt:',
'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
'The following drafts have been saved and can be loaded.' => 'Die folgenden Entwürfe wurden gespeichert und können geladen werden.',
- 'The following old files whose settings have to be merged manually into the new configuration file "config/lx_office.conf" still exist:' => 'Es existieren noch die folgenden alten Dateien, deren Einstellungen manuell in die neue Konfiguratsdatei "config/lx_office.conf" migriert werden müssen:',
+ 'The following old files whose settings have to be merged manually into the new configuration file "config/kivitendo.conf" still exist:' => 'Es existieren noch die folgenden alten Dateien, deren Einstellungen manuell in die neue Konfiguratsdatei "config/kivitendo.conf" migriert werden müssen:',
'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
'The following units are unknown.' => 'Die folgenden Einheiten sind unbekannt.',
'The group has been saved.' => 'Die Gruppe wurde gespeichert.',
'The group memberships have been saved.' => 'Die Gruppenmitgliedschaften wurden gespeichert.',
'The group name is missing.' => 'Der Gruppenname fehlt.',
+ 'The items are imported accoring do their number "X" regardless of the column order inside the file.' => 'Die Einträge werden in der Reihenfolge ihrer Indizes "X" unabhängig von der Spaltenreihenfolge in der Datei importiert.',
'The list has been printed.' => 'Die Liste wurde ausgedruckt.',
'The long description is missing.' => 'Der Langtext fehlt.',
'The name in row %d has already been used before.' => 'Der Name in Zeile %d wurde vorher bereits benutzt.',
'The task server was started successfully.' => 'Der Task-Server wurde erfolgreich gestartet.',
'The task server was stopped successfully.' => 'Der Task-Server wurde erfolgreich beendet.',
'The third way is to download the module from the above mentioned URL and to install the module manually following the installations instructions contained in the source archive.' => 'Die dritte Variante besteht darin, das Paket von der oben genannten URL herunterzuladen und es manuell zu installieren. Beachten Sie dabei die im Paket enthaltenen Installationsanweisungen.',
+ 'The three columns "make_X", "model_X" and "lastcost_X" with the same number "X" are used to import vendor part numbers and vendor prices.' => 'Die drei Spalten "make_X", "model_X" und "lastcost_X" mit derselben Nummer "X" werden zum Import von Lieferantenartikelnummern und -preisen genutzt.',
'The transaction is shown below in its current state.' => 'Nachfolgend wird angezeigt, wie die Buchung momentan aussieht.',
'The unit has been saved.' => 'Die Einheit wurde gespeichert.',
'The unit in row %d has been deleted in the meantime.' => 'Die Einheit in Zeile %d ist in der Zwischentzeit gelöscht worden.',
'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => 'Deswegen muss man den gleichen Artikel nicht mehr mehrmals anlegen, wenn er in verschiedenen Steuerzonen gehandelt werden soll.',
'These units can be based on other units so that kivitendo can convert prices when the user switches from one unit to another.' => 'Einheiten können auf anderen Einheiten basieren, sodass kivitendo Preise automatisch umrechnen kann, wenn die Benutzer zwischen solchen Einheiten umschalten.',
'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
+ 'This can be done with the following query:' => 'Dies kann mit der folgenden Datenbankabfrage erreicht werden:',
'This corresponds to kivitendo\'s behavior prior to version 2.4.4.' => 'Dies entspricht kivitendos Verhalten vor Version 2.4.4.',
'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
'This customer number is already in use.' => 'Diese Kundennummer wird bereits verwendet.',
'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
+ 'This option controls the inventory system.' => 'Dieser Parameter legt die Warenbuchungsmethode fest.',
+ 'This option controls the method used for profit determination.' => 'Dieser Parameter legt die Berechnungsmethode für die Gewinnermittlung fest.',
+ 'This option controls the posting and calculation behavior for the accounting method.' => 'Dieser Parameter steuert die Buchungs- und Berechnungsmethoden für die Versteuerungsart.',
+ 'This partnumber is not unique. You should change it.' => 'Diese Artikelnummer ist nicht eindeutig. Bitte wählen Sie eine andere.',
+ 'This requires you to manually correct entries for which an automatic conversion failed and to check those for which it succeeded.' => 'Dies erfordert, dass Sie diejenigen Einträge manuell korrigieren, für die die automatische Umstellung fehlschlug, sowie dass Sie diejenigen überprüfen, für die die Umstellung erfolgreich war.',
'This transaction has to be split into several transactions manually.' => 'Diese Buchung muss manuell in mehrere Buchungen aufgeteilt werden.',
'This update will change the nature the onhand of goods is tracked.' => 'Dieses update ändert die Art und Weise wie Lagermengen gezält werden.',
'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => 'Dieses Upgradescript versucht, bei allen bestehenden Artikeln neu erstellte Buchungsgruppen zuzuordnen.',
'Vendor' => 'Lieferant',
'Vendor (name)' => 'Lieferant (Name)',
'Vendor Invoice' => 'Einkaufsrechnung',
- 'Vendor Invoices' => 'Einkaufsrechnungen',
+ 'Vendor Invoices & AP Transactions' => 'Einkaufsrechnungen & Kreditorenbuchungen',
'Vendor Name' => 'Lieferantenname',
'Vendor Number' => 'Lieferantennummer',
'Vendor Order Number' => 'Bestellnummer beim Lieferanten',
'Weight unit' => 'Gewichtseinheit',
'What <b>term</b> you are looking for?' => 'Nach welchem <b>Begriff</b> wollen Sie suchen?',
'What type of item is this?' => 'Was ist dieser Artikel?',
- 'Which is located at doc/Kivitendo-Dokumentation.pdf. Click here: ' => 'Diese befindet sich unter doc/Kivitendo-Dokumentation.pdf. Klicken Sie hier:',
+ 'Which is located at doc/kivitendo-Dokumentation.pdf. Click here: ' => 'Diese befindet sich unter doc/kivitendo-Dokumentation.pdf. Klicken Sie hier:',
'With Extension Of Time' => 'mit Dauerfristverlängerung',
'Workflow Delivery Order' => 'Workflow Lieferschein',
'Workflow purchase_order' => 'Workflow Lieferantenauftrag',
'Workflow sales_order' => 'Workflow Auftrag',
'Workflow sales_quotation' => 'Workflow Angebot',
'Wrong Period' => 'Falscher Zeitraum',
- 'Wrong date format!' => 'Falsches Datumsformat!',
'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
'YYYY' => 'JJJJ',
'close' => 'schließen',
'closed' => 'geschlossen',
'companylogo_subtitle' => 'Lizenziert für',
- 'config/lx_office.conf: Key "DB_config" is missing.' => 'config/lx_office.conf: Das Schlüsselwort "DB_config" fehlt.',
- 'config/lx_office.conf: Key "authentication/ldap" is missing.' => 'config/lx_office.conf: Der Schlüssel "authentication/ldap" fehlt.',
- 'config/lx_office.conf: Missing parameters in "authentication/database". Required parameters are "host", "db" and "user".' => 'config/lx_office.conf: Fehlende Parameter in "authentication/database". Benötigte Parameter sind "host", "db" und "user".',
- 'config/lx_office.conf: Missing parameters in "authentication/ldap". Required parameters are "host", "attribute" and "base_dn".' => 'config/lx_office.conf: Fehlende Parameter in "authentication/ldap". Benötigt werden "host", "attribute" und "base_dn".',
+ 'config/kivitendo.conf: Key "DB_config" is missing.' => 'config/kivitendo.conf: Das Schlüsselwort "DB_config" fehlt.',
+ 'config/kivitendo.conf: Key "authentication/ldap" is missing.' => 'config/kivitendo.conf: Der Schlüssel "authentication/ldap" fehlt.',
+ 'config/kivitendo.conf: Missing parameters in "authentication/database". Required parameters are "host", "db" and "user".' => 'config/kivitendo.conf: Fehlende Parameter in "authentication/database". Benötigte Parameter sind "host", "db" und "user".',
+ 'config/kivitendo.conf: Missing parameters in "authentication/ldap". Required parameters are "host", "attribute" and "base_dn".' => 'config/kivitendo.conf: Fehlende Parameter in "authentication/ldap". Benötigt werden "host", "attribute" und "base_dn".',
'contact_list' => 'ansprechperson_liste',
'continue' => 'weiter',
'correction' => 'Korrektur',
'ea' => 'St.',
'emailed to' => 'gemailt an',
'empty' => 'leer',
+ 'every time' => 'immer',
'executed' => 'ausgeführt',
'failed' => 'fehlgeschlagen',
'female' => 'weiblich',
'follow_up_list' => 'wiedervorlageliste',
'for' => 'für',
'for Period' => 'für den Zeitraum',
+ 'for date' => 'zum Stichtag',
'found' => 'Gefunden',
'from (time)' => 'von',
'general_ledger_list' => 'buchungsjournal',
'kivitendo has found one or more problems in the general ledger.' => 'kivitendo hat ein oder mehrere Probleme im Hauptbuch gefunden.',
'kivitendo is about to update the database [ #1 ].' => 'kivitendo wird gleich die Datenbank [ #1 ] aktualisieren.',
'kivitendo is now able to manage warehouses instead of just tracking the amount of goods in your system.' => 'kivitendo enthält jetzt auch echte Lagerverwaultung anstatt reiner Mengenzählung.',
+ 'kivitendo needs to update the authentication database before you can proceed.' => 'kivitendo muss die Authentifizierungsdatenbank aktualisieren, bevor Sie fortfahren können.',
+ 'kivitendo will then update the database automatically.' => 'kivitendo wird die Datenbank daraufhin automatisch aktualisieren.',
'lead deleted!' => 'Kundenquelle gelöscht',
'lead saved!' => 'Kundenquelle geichert',
'list' => 'auflisten',
'not yet executed' => 'Noch nicht ausgeführt',
'number' => 'Nummer',
'oe.pl::search called with unknown type' => 'oe.pl::search mit unbekanntem Typ aufgerufen',
+ 'on the same day' => 'am selben Tag',
'one-time execution' => 'einmalige Ausführung',
'only OB Transactions' => 'nur EB-Buchungen',
'open' => 'Offen',
+++ /dev/null
-missing
-lost
+++ /dev/null
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (C) 2002
-#
-# German texts:
-#
-# Author: Thomas Bayen <tbayen@bayen.de>
-# Gunter Ohrner <G.Ohrner@post.rwth-aachen.de>
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-######################################################################
+++ /dev/null
-Deutsch (de_DE)
+++ /dev/null
-#=====================================================================
-# SQL-Ledger Accounting
-# Copyright (C) 2002
-#
-# Author: Dieter Simader
-# Email: dsimader@sql-ledger.org
-# Web: http://www.sql-ledger.org
-#
-# Contributors:
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#======================================================================
-#
-# this is a variation of the Lingua package
-# written for check and receipt printing
-# it returns a properly formatted text string
-# for a number up to 10**12
-
-sub init {
- my $self = shift;
-
- %{ $self->{numbername} } =
- (0 => 'Null',
- 1 => 'ein',
- 2 => 'zwei',
- 3 => 'drei',
- 4 => 'vier',
- 5 => 'fünf',
- 6 => 'sechs',
- 7 => 'sieben',
- 8 => 'acht',
- 9 => 'neun',
- 10 => 'zehn',
- 11 => 'elf',
- 12 => 'zwölf',
- 13 => 'dreizehn',
- 14 => 'vierzehn',
- 15 => 'fünfzehn',
- 16 => 'sechzehn',
- 17 => 'siebzehn',
- 18 => 'achtzehn',
- 19 => 'neunzehn',
- 20 => 'zwanzig',
- 30 => 'dreissig',
- 40 => 'vierzig',
- 50 => 'fünfzig',
- 60 => 'sechzig',
- 70 => 'siebzig',
- 80 => 'achtzig',
- 90 => 'neunzig',
- 10**2 => 'hundert',
- 10**3 => 'tausend',
- 10**6 => 'million',
- 10**9 => 'milliarde',
- 10**12 => 'billion'
- );
-
-}
-
-
-sub num2text {
- my ($self, $amount) = @_;
-
- return $self->{numbername}{0} unless $amount;
-
- my @textnumber = ();
-
- # split amount into chunks of 3
- my @num = reverse split //, $amount;
- my @numblock = ();
- my ($i, $appendn);
- my @a = ();
-
- while (@num) {
- @a = ();
- for (1 .. 3) {
- push @a, shift @num;
- }
- push @numblock, join / /, reverse @a;
- }
-
- my $belowhundred = !$#numblock;
-
- while (@numblock) {
-
- $i = $#numblock;
- @num = split //, $numblock[$i];
- $appendn = "";
-
- $numblock[$i] *= 1;
-
- if ($numblock[$i] == 0) {
- pop @numblock;
- next;
- }
-
- if ($numblock[$i] > 99) {
- # the one from hundreds
- push @textnumber, $self->{numbername}{$num[0]};
-
- # add hundred designation
- push @textnumber, $self->{numbername}{10**2};
-
- # reduce numblock
- $numblock[$i] -= $num[0] * 100;
- }
-
- $appendn = 'en' if ($i == 2);
- $appendn = 'n' if ($i > 2);
-
- if ($numblock[$i] > 9) {
- # tens
- push @textnumber, $self->format_ten($numblock[$i], $belowhundred);
- } elsif ($numblock[$i] > 1) {
- # ones
- push @textnumber, $self->{numbername}{$numblock[$i]};
- } elsif ($numblock[$i] == 1) {
- if ($i == 0) {
- push @textnumber, $self->{numbername}{$numblock[$i]}.'s';
- } else {
- if ($i >= 2) {
- push @textnumber, $self->{numbername}{$numblock[$i]}.'e';
- } else {
- push @textnumber, $self->{numbername}{$numblock[$i]};
- }
- }
- $appendn = "";
- }
-
- # add thousand, million
- if ($i) {
- $amount = 10**($i * 3);
- push @textnumber, $self->{numbername}{$amount}.$appendn;
- }
-
- pop @numblock;
-
- }
-
- join '', @textnumber;
-
-}
-
-
-sub format_ten {
- my ($self, $amount, $belowhundred) = @_;
-
- my $textnumber = "";
- my @num = split //, $amount;
-
- if ($amount > 20) {
- if ($num[1] == 0) {
- $textnumber = $self->{numbername}{$amount};
- } else {
- if ($belowhundred) {
- $amount = $num[0] * 10;
- $textnumber = $self->{numbername}{$num[1]}.'und'.$self->{numbername}{$amount};
- } else {
- $amount = $num[0] * 10;
- $textnumber = $self->{numbername}{$amount}.$self->{numbername}{$num[1]};
- $textnumber .= 's' if ($num[1] == 1);
- }
- }
- } else {
- $textnumber = $self->{numbername}{$amount};
- }
-
- $textnumber;
-
-}
-
-
-1;
-
+++ /dev/null
-#!/usr/bin/perl
-# -*- coding: utf-8; -*-
-# vim: fenc=UTF-8
-
-use utf8;
-
-# These are all the texts to build the translations files.
-# The file has the form of 'english text' => 'foreign text',
-# you can add the translation in this file or in the 'missing' file
-# run locales.pl from this directory to rebuild the translation files
-
-$self->{texts} = {
- ' Date missing!' => ' Datum fehlt!',
- ' Part Number missing!' => ' Artikelnummer fehlt!',
- ' missing!' => ' fehlt!',
- '#1 (custom variable)' => '#1 (benutzerdefinierte Variable)',
- '#1 of #2 importable objects were imported.' => '#1 von #2 importierbaren Objekten wurden importiert.',
- '#1 prices were updated.' => '#1 Preise wurden aktualisiert.',
- '* there are restrictions for the perpetual method, look at chapter "Bemerkungen zu Bestandsmethode" in' => ' für die Bestandsmethode gibt es Einschränkungen, siehe Kapitel "Bemerkungen zu Bestandsmethode" in',
- '*) Since version 2.7 these parameters ares set in the client database and not in the lx-erp.conf / lx_office.conf file, details in chapter:' => '*) Seit 2.7 werden Gewinnermittlungsart, Versteuerungsart und Warenbuchungsmethode in der Mandanten-DB gesteuert und nicht mehr in der lx-erp.conf / lx_office.conf, Umstellungs-Details:',
- '*/' => '*/',
- '---please select---' => '---bitte auswählen---',
- '...after loggin in' => '...nach dem Anmelden',
- '...done' => '...fertig',
- '...on the TODO list' => '...auf der Aufgabenliste',
- '1. Quarter' => '1. Quartal',
- '2. Quarter' => '2. Quartal',
- '3. Quarter' => '3. Quartal',
- '4. Quarter' => '4. Quartal',
- '<b>What</b> do you want to look for?' => '<b>Wonach</b> wollen Sie suchen?',
- 'A Buchungsgruppe consists of a descriptive name and the account numbers for the income and expense accounts for those four tax zones as well as the inventory account number.' => 'Eine Buchungsgruppe besteht aus einem deskriptiven Namen, den Erlös- und Aufwandskonten für diese vier Steuerzonen sowie aus einem Inventarkonto.',
- 'A digit is required.' => 'Eine Ziffer ist vorgeschrieben.',
- 'A group named "Full Access" has been created.' => 'Eine Gruppe namens "Vollzugriff" wurde angelegt.',
- 'A group with that name does already exist.' => 'Eine Gruppe mit diesem Namen gibt es bereits.',
- 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => 'Die Bedienung von Lx-Office wurde an vielen Stellen mit Javascript verbessert. Obwohl es derzeit möglich ist, jeden Aspekt von Lx-Office auch ohne Javascript zu benutzen, empfehlen wir es. In einer zukünftigen Version wird Javascript eventuell notwendig sein um weitergehende Features zu benutzen.',
- 'A lower-case character is required.' => 'Ein Kleinbuchstabe ist vorgeschrieben.',
- 'A special character is required (valid characters: #1).' => 'Ein Sonderzeichen ist vorgeschrieben (gültige Zeichen: #1).',
- 'A temporary directory could not be created:' => 'Ein temporäres Verzeichnis konnte nicht erstellt werden:',
- 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => 'Eine temporäre Datei konnte nicht angelegt werden. Bitte stellen Sie sicher, dass das Verzeichnis "#1" vom Webserver beschrieben werden darf.',
- 'A temporary file could not be created:' => 'Eine temporäre Datei konnte nicht erstellt werden:',
- 'A unit with this name does already exist.' => 'Eine Einheit mit diesem Namen existiert bereits.',
- 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => 'Eine als \'editierbar\' markierte Variable kann in jedem Angebot, Auftrag, jeder Rechnung etc für jede Position geändert werden.',
- 'ADDED' => 'Hinzugefügt',
- 'AP' => 'Einkauf',
- 'AP Aging' => 'Verbindlichkeiten',
- 'AP Transaction' => 'Kreditorenbuchung',
- 'AP Transaction (abbreviation)' => 'K',
- 'AP Transaction Storno (one letter abbreviation)' => 'S',
- 'AP Transaction with Storno (abbreviation)' => 'K(S)',
- 'AP Transactions' => 'Eingangsrechnungen',
- 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => 'Kreditorenbuchungen mit Umsatzsteuer-Steuerschlüsseln und/oder Debitorenbuchungen mit Vorsteuer-Steuerschlüsseln',
- 'AR' => 'Verkauf',
- 'AR Aging' => 'Forderungen',
- 'AR Transaction' => 'Debitorenbuchung',
- 'AR Transaction (abbreviation)' => 'D',
- 'AR Transactions' => 'Debitorenbuchungen',
- 'ASSETS' => 'AKTIVA',
- 'Abort' => 'Abbrechen',
- 'Abrechnungsnummer' => 'Abrechnungsnummer',
- 'Abteilung' => 'Abteilung',
- 'Account' => 'Konto',
- 'Account Category A' => 'Aktiva/Mittelverwendung',
- 'Account Category C' => 'Kosten',
- 'Account Category E' => 'Aufwandskonto',
- 'Account Category G' => '?Gegenkonto?',
- 'Account Category I' => 'Erlöskonto',
- 'Account Category L' => 'Passiva/Mittelherkunft',
- 'Account Category Q' => 'Passiva',
- 'Account Description missing!' => 'Beschreibung fehlt!',
- 'Account Link AP' => 'Einkauf',
- 'Account Link AP_amount' => 'Verbindlichkeiten Aufwand/Anlagen',
- 'Account Link AP_paid' => 'Verbindlichkeiten Zahlungsausgang',
- 'Account Link AP_tax' => 'Verbindlichkeiten Steuer',
- 'Account Link AR' => 'Verkauf',
- 'Account Link AR_amount' => 'Forderungen Erlöskonto',
- 'Account Link AR_paid' => 'Forderungen Zahlungseingang',
- 'Account Link AR_tax' => 'Forderungen Steuer',
- 'Account Link IC' => 'Inventar',
- 'Account Link IC_cogs' => 'Warenliste Aufwandskonto',
- 'Account Link IC_expense' => 'Dienstleistungen Aufwandskonto',
- 'Account Link IC_income' => 'Dienstleistungen Erlöskonto',
- 'Account Link IC_sale' => 'Warenliste Erlöskonto',
- 'Account Link IC_taxpart' => 'Warenliste Steuer',
- 'Account Link IC_taxservice' => 'Dienstleistungen Steuer',
- 'Account Number' => 'Kontonummer',
- 'Account Number already used!' => 'Kontonummer ist bereits in Benutzung!',
- 'Account Number missing!' => 'Kontonummer fehlt!',
- 'Account Nummer' => 'Kontonummer',
- 'Account Type' => 'Kontoart',
- 'Account Type missing!' => 'Kontoart fehlt!',
- 'Account deleted!' => 'Konto gelöscht!',
- 'Account for fees' => 'Konto für Gebühren',
- 'Account for interest' => 'Konto für Zinsen',
- 'Account number' => 'Kontonummer',
- 'Account number #1, bank code #2, #3' => 'Kontonummer #1, BLZ #2, #3',
- 'Account saved!' => 'Konto gespeichert!',
- 'Accounting Group deleted!' => 'Buchungsgruppe gelöscht!',
- 'Accounting Group saved!' => 'Buchungsgruppe gespeichert!',
- 'Accounting method' => 'Versteuerungsart',
- 'Accrual' => 'Bilanzierung',
- 'Active' => 'Aktiv',
- 'Active?' => 'Aktiviert?',
- 'Add' => 'Erfassen',
- 'Add AP Transaction' => 'Kreditorenbuchung',
- 'Add AR Transaction' => 'Debitorenbuchung',
- 'Add Account' => 'Konto erfassen',
- 'Add Accounting Group' => 'Buchungsgruppe erfassen',
- 'Add Accounts Payables Transaction' => 'Kreditorenbuchung erfassen',
- 'Add Accounts Receivables Transaction' => 'Debitorenbuchung erfassen',
- 'Add Assembly' => 'Neues Erzeugnis',
- 'Add Buchungsgruppe' => 'Buchungsgruppe erfassen',
- 'Add Business' => 'Kunden-/Lieferantentyp erfassen',
- 'Add Credit Note' => 'Neue Gutschrift',
- 'Add Customer' => 'Neuer Kunde',
- 'Add Delivery Note' => 'Lieferung (Eingang)',
- 'Add Delivery Order' => 'Neuer Lieferschein',
- 'Add Department' => 'Abteilung erfassen',
- 'Add Dunning' => 'Neue Mahnung',
- 'Add Exchangerate' => 'Wechselkurs erfassen',
- 'Add Follow-Up' => 'Neue Wiedervorlage',
- 'Add Follow-Up for #1' => 'Wiedervorlage für #1 erstellen',
- 'Add General Ledger Transaction' => 'Dialogbuchen',
- 'Add Group' => 'Warengruppe erfassen',
- 'Add Language' => 'Sprache hinzufügen',
- 'Add Lead' => 'Kundenquelle erfassen',
- 'Add Part' => 'Neuer Artikel',
- 'Add Payment Terms' => 'Zahlungskonditionen hinzufügen',
- 'Add Price Factor' => 'Preisfaktor erfassen',
- 'Add Pricegroup' => 'Preisgruppe erfassen',
- 'Add Printer' => 'Drucker hinzufügen',
- 'Add Project' => 'Neues Projekt',
- 'Add Purchase Delivery Order' => 'Lieferschein (Eingang) erfassen',
- 'Add Purchase Order' => 'Einkaufsbestellung',
- 'Add Quotation' => 'Neues Angebot',
- 'Add RFQ' => 'Neue Preisanfrage',
- 'Add Request for Quotation' => 'Anfrage erfassen',
- 'Add Sales Delivery Order' => 'Lieferschein (Verkauf) erfassen',
- 'Add Sales Invoice' => 'Neue Rechnung',
- 'Add Sales Order' => 'Neuer Auftrag',
- 'Add Service' => 'Neue Dienstleistung',
- 'Add Storno Credit Note' => 'Gutschrift Storno hinzufügen',
- 'Add Transaction' => 'Dialogbuchen',
- 'Add User' => 'Neuer Benutzer',
- 'Add Vendor' => 'Neuer Lieferant',
- 'Add Vendor Invoice' => 'Rechnungseingang',
- 'Add Warehouse' => 'Lager erfassen',
- 'Add a new group' => 'Neue Gruppe erfassen',
- 'Add and edit units' => 'Einheiten erfassen und bearbeiten',
- 'Add bank account' => 'Bankkonto erfassen',
- 'Add custom variable' => 'Erweitertes Datenfeld anlegen.',
- 'Add note' => 'Notiz erfassen',
- 'Add unit' => 'Einheit hinzufügen',
- 'Address' => 'Adresse',
- 'Administration' => 'Administration',
- 'Administration (Used to access instance administration from user logins)' => 'Administration (Für die Verwaltung der aktuellen Instanz aus einem Userlogin heraus)',
- 'Administration area' => 'Administration',
- 'Advance turnover tax return' => 'Umsatzsteuervoranmeldung',
- 'Aktion' => 'Aktion',
- 'All' => 'Alle',
- 'All Accounts' => 'Alle Konten',
- 'All Datasets up to date!' => 'Alle Datenbanken sind auf aktuellem Stand.',
- 'All changes in that file have been reverted.' => 'Alle Änderungen in dieser Datei wurden rückgängig gemacht.',
- 'All database upgrades have been applied.' => 'Alle Datenbankupdates wurden eingespielt.',
- 'All general ledger entries' => 'Alle Hauptbucheinträge',
- 'All of the exports you have selected were already closed.' => 'Alle von Ihnen ausgewählten Exporte sind bereits abgeschlossen.',
- 'All reports' => 'Alle Berichte (Kontenübersicht, Summen- u. Saldenliste, GuV, BWA, Bilanz, Projektbuchungen)',
- 'All the selected exports have already been closed, or all of their items have already been executed.' => 'Alle ausgewählten Exporte sind als abgeschlossen markiert, oder für alle Einträge wurden bereits Zahlungen verbucht.',
- 'All units have either no or exactly one base unit of which they are multiples.' => 'Einheiten haben entweder keine oder genau eine Basiseinheit, von der sie ein Vielfaches sind.',
- 'All users' => 'Nichtmitglieder',
- 'Allow access' => 'Zugriff erlauben',
- 'Allow the following users access to my follow-ups:' => 'Erlaube den folgenden Benutzern Zugriff auf meine Wiedervorlagen:',
- 'Alternatively you can create a new part which will then be selected.' => 'Sie können auch einen neuen Artikel anlegen, der dann automatisch ausgewählt wird.',
- 'Alternatively you can skip this step and create groups yourself.' => 'Alternativ können Sie diesen Schritt überspringen und selber Gruppen anlegen.',
- 'Amended Advance Turnover Tax Return' => 'Berichtigte Anmeldung',
- 'Amended Advance Turnover Tax Return (Nr. 10)' => 'Ist dies eine berichtigte Anmeldung? (Nr. 10/Zeile 15 Steuererklärung)',
- 'Amount' => 'Betrag',
- 'Amount Due' => 'Betrag fällig',
- 'Amount has to be greater then zero! Wrong row number: ' => '"Betrag" muss größer Null sein. Fehlerhafte Zeile: ',
- 'Amount payable' => 'Noch zu bezahlender Betrag',
- 'Amount payable less discount' => 'Noch zu bezahlender Betrag abzüglich Skonto',
- 'An invalid character was used (invalid characters: #1).' => 'Ein ungültiges Zeichen wurde benutzt (ungültige Zeichen: #1).',
- 'An invalid character was used (valid characters: #1).' => 'Ein ungültiges Zeichen wurde benutzt (gültige Zeichen: #1).',
- 'An upper-case character is required.' => 'Ein Großbuchstabe ist vorgeschrieben.',
- 'Annotations' => 'Hilfe',
- 'Another user with the login #1 does already exist.' => 'Es existiert bereits ein anderer Benutzer mit diesem Login.',
- 'Ap aging on %s' => 'Offene Verbindlichkeiten zum %s',
- 'Application Error. No Format given' => 'Fehler in der Anwendung. Das Ausgabeformat fehlt.',
- 'Application Error. Wrong Format' => 'Fehler in der Anwendung. Falsches Format: ',
- 'Apply to all parts' => 'Bei allen Artikeln setzen',
- 'Apply to parts without buchungsgruppe' => 'Bei allen Artikeln ohne gültige Buchungsgruppe setzen',
- 'Applying #1:' => 'Führe #1 aus:',
- 'Approximately #1 prices will be updated.' => 'Ungefähr #1 Preise werden aktualisiert.',
- 'Apr' => 'Apr',
- 'April' => 'April',
- 'Ar aging on %s' => 'Offene Forderungen zum %s',
- 'Are you sure you want to delete Delivery Order Number #1?' => 'Sind Sie sicher, dass Sie Lieferschein #1 löschen wollen?',
- 'Are you sure you want to delete Invoice Number' => 'Soll die Rechnung mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Order Number' => 'Soll der Auftrag mit folgender Nummer wirklich gelöscht werden:',
- 'Are you sure you want to delete Quotation Number' => 'Sind Sie sicher, dass Angebotnummer gelöscht werden soll?',
- 'Are you sure you want to delete Transaction' => 'Buchung wirklich löschen?',
- 'Are you sure you want to delete this business?' => 'Sind Sie sicher, dass Sie diesen Kunden-/Lieferantentyp löschen wollen?',
- 'Are you sure you want to delete this department?' => 'Sind Sie sicher, dass Sie diese Abteilung löschen wollen?',
- 'Are you sure you want to delete this payment term?' => 'Wollen Sie diese Zahlungsbedingungen wirklich löschen?',
- 'Are you sure you want to remove the marked entries from the queue?' => 'Sind Sie sicher, dass die markierten Einträge von der Warteschlange gelöscht werden sollen?',
- 'Are you sure you want to update the prices' => 'Sind Sie sicher, dass Sie die Preise aktualisieren wollen?',
- 'Article Code' => 'Artikelkürzel',
- 'Article Code missing!' => 'Artikelkürzel fehlt',
- 'Article type (see below)' => 'Artikeltyp (siehe unten)',
- 'As a result, the saved onhand values of the present goods can be stored into a warehouse designated by you, or will be reset for a proper warehouse tracking' => 'Als Konsequenz können die gespeicherten Mengen entweder in ein Lager überführt werden, oder für eine frische Lagerverwaltung resettet werden.',
- 'Assemblies' => 'Erzeugnisse',
- 'Assembly Description' => 'Erzeugnis-Beschreibung',
- 'Assembly Number' => 'Erzeugnis-Nummer',
- 'Assembly Number missing!' => 'Erzeugnisnummer fehlt!',
- 'Asset' => 'Aktiva/Mittelverwendung',
- 'Assets' => 'Aktiva',
- 'Assign new units' => 'Neue Einheiten zuweisen',
- 'Assign units' => 'Einheiten zuweisen',
- 'Assistant for general ledger corrections' => 'Assistent für die Korrektur von Hauptbucheinträgen',
- 'Assume Tax Consultant Data in Tax Computation?' => 'Beraterdaten in UStVA übernehmen?',
- 'At least' => 'Mindestens',
- 'At least one Perl module that Lx-Office ERP requires for running is not installed on your system.' => 'Mindestes ein Perl-Modul, das Lx-Office ERP zur Ausführung benötigt, ist auf Ihrem System nicht installiert.',
- 'At least one of the columns #1, customer, customernumber, vendor, vendornumber (depending on the target table) is required for matching the entry to an existing customer or vendor.' => 'Mindestens eine der Spalten #1, customer, customernumber, vendor, vendornumber (von Zieltabelle abhängig) wird benötigt, um einen Eintrag einem bestehenden Kunden bzw. Lieferanten zuzuordnen.',
- 'At most' => 'Höchstens',
- 'At the moment the transaction looks like this:' => 'Aktuell sieht die Buchung wie folgt aus:',
- 'Attach PDF:' => 'PDF anhängen',
- 'Attachment' => 'als Anhang',
- 'Attachment name' => 'Name des Anhangs',
- 'Attempt to call an undefined sub named \'%s\'' => 'Es wurde versucht, eine nicht definierte Unterfunktion namens \'%s\' aufzurufen.',
- 'Audit Control' => 'Bücherkontrolle',
- 'Aug' => 'Aug',
- 'August' => 'August',
- 'Authentification database creation' => 'Anlegen der Datenbank zur Benutzerauthentifizierung',
- 'Authentification tables creation' => 'Anlegen der Tabellen zur Benutzerauthentifizierung',
- 'Auto Send?' => 'Auto. Versand?',
- 'Automatically created invoice for fee and interest for dunning %s' => 'Automatisch erzeugte Rechnung für Gebühren und Zinsen zu Mahnung %s',
- 'Available' => 'Verfügbar',
- 'Available qty' => 'Lagerbestand',
- 'BALANCE SHEET' => 'BILANZ',
- 'BIC' => 'BIC',
- 'BOM' => 'Stückliste',
- 'BWA' => 'BWA',
- 'Back' => 'Zurück',
- 'Back to login' => 'Zurück zur Anmeldung',
- 'Back to the login page' => 'Zurück zur Loginseite',
- 'Backup Dataset' => 'Datenbank sichern',
- 'Backup file' => 'Sicherungsdatei',
- 'Backup of dataset' => 'Sicherung der Datenbank',
- 'Balance' => 'Bilanz',
- 'Balance Sheet' => 'Bilanz',
- 'Bank' => 'Bank',
- 'Bank Code' => 'BLZ',
- 'Bank Code (long)' => 'Bankleitzahl (BLZ)',
- 'Bank Code Number' => 'Bankleitzahl',
- 'Bank Connection Tax Office' => 'Bankverbindung des Finanzamts',
- 'Bank Connections' => 'Bankverbindungen',
- 'Bank accounts' => 'Bankkonten',
- 'Bank code' => 'Bankleitzahl',
- 'Bank collection amount' => 'Einzugsbetrag',
- 'Bank collection payment list for export #1' => 'Bankeinzugszahlungsliste für SEPA-Export #1',
- 'Bank collection via SEPA' => 'Bankeinzug via SEPA',
- 'Bank collections via SEPA' => 'Bankeinzüge via SEPA',
- 'Bank transfer amount' => 'Überweisungssumme',
- 'Bank transfer payment list for export #1' => 'Überweisungszahlungsliste für SEPA-Export #1',
- 'Bank transfer via SEPA' => 'SEPA-Überweisung',
- 'Bank transfers via SEPA' => 'SEPA-Überweisungen',
- 'Base unit' => 'Basiseinheit',
- 'Basic Data' => 'Basisdaten',
- 'Batch Printing' => 'Druck',
- 'Bcc' => 'Bcc',
- 'Belegnummer' => 'Buchungsnummer',
- 'Beratername' => 'Beratername',
- 'Beraternummer' => 'Beraternummer',
- 'Best Before' => 'Mindesthaltbarkeit',
- 'Bestandskonto' => 'Bestandskonto',
- 'Bilanz' => 'Bilanz',
- 'Billing Address' => 'Rechnungsadresse',
- 'Billing/shipping address (city)' => 'Rechnungsadresse (Stadt)',
- 'Billing/shipping address (street)' => 'Rechnungsadresse (Straße)',
- 'Billing/shipping address (zipcode)' => 'Rechnungsadresse (PLZ)',
- 'Bin' => 'Lagerplatz',
- 'Bin From' => 'von Lagerplatz',
- 'Bin List' => 'Lagerliste',
- 'Bin To' => 'nach Lagerplatz',
- 'Binding to the LDAP server as "#1" failed. Please check config/lx_office.conf.' => 'Die Anmeldung am LDAP-Server als "#1" schlug fehl. Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
- 'Bins saved.' => 'Lagerplätze gespeichert.',
- 'Bins that have been used in the past cannot be deleted anymore. For these bins there\'s no checkbox in the "Delete" column.' => 'Lagerplätze, die bereits benutzt wurden, können nicht mehr gelöscht werden. Deswegen fehlt bei ihnen die Checkbox in der Spalte "Löschen".',
- 'Birthday' => 'Geburtstag',
- 'Bis' => 'bis',
- 'Bis Konto: ' => 'bis Konto: ',
- 'Block' => 'Block',
- 'Body' => 'Text',
- 'Body:' => 'Text:',
- 'Booking Date' => 'Buchungsdatum',
- 'Books are open' => 'Die Bücher sind geöffnet.',
- 'Books closed up to' => 'Bücher abgeschlossen bis zum',
- 'Boolean variables: If the default value is non-empty then the checkbox will be checked by default and unchecked otherwise.' => 'Ja/Nein-Datenfeld: Wenn der Standardwert nicht leer ist, so wird die Checkbox standardmäßig angehakt.',
- 'Both' => 'Beide',
- 'Bottom' => 'Unten',
- 'Bought' => 'Gekauft',
- 'Buchungsdatum' => 'Buchungsdatum',
- 'Buchungsgruppe' => 'Buchungsgruppe',
- 'Buchungsgruppe (database ID)' => 'Buchungsgruppe (Datenbank-ID)',
- 'Buchungsgruppe (name)' => 'Buchungsgruppe (Name)',
- 'Buchungsgruppen' => 'Buchungsgruppen',
- 'Buchungskonto' => 'Buchungskonto',
- 'Buchungsnummer' => 'Buchungsnummer',
- 'Business Number' => 'Firmennummer',
- 'Business Volume' => 'Geschäftsvolumen',
- 'Business evaluation' => 'Betriebswirtschaftliche Auswertung',
- 'Business type (database ID)' => 'Kunden-/Lieferantentyp (Datenbank-ID)',
- 'Business type (name)' => 'Kunden-/Lieferantentyp (Name)',
- 'Businesses' => 'Kunden-/Lieferantentypen',
- 'CANCELED' => 'Storniert',
- 'CB Transaction' => 'SB-Buchung',
- 'CB Transactions' => 'SB-Buchungen',
- 'CR' => 'H',
- 'CRM admin' => 'Administration',
- 'CRM create customers, vendors and contacts' => 'Erfassen (Kunden, Lieferanten, Personen)',
- 'CRM follow up' => 'Wiedervorlage',
- 'CRM know how' => 'Wissens DB',
- 'CRM notices' => 'Notizen',
- 'CRM opportunity' => 'Auftragschance',
- 'CRM optional software' => 'CRM optionale Software',
- 'CRM other' => 'alles Andere',
- 'CRM search' => 'Adresssuche',
- 'CRM send email' => 'eMail',
- 'CRM services' => 'Dienstleistung',
- 'CRM status' => 'Admin Status',
- 'CRM termin' => 'Termine',
- 'CRM user' => 'Admin Benutzer',
- 'CSV export -- options' => 'CSV-Export -- Optionen',
- 'CSV import: contacts' => 'CSV-Import: Ansprechpersonen',
- 'CSV import: customers and vendors' => 'CSV-Import: Kunden und Lieferanten',
- 'CSV import: parts and services' => 'CSV-Import: Waren und Dienstleistungen',
- 'CSV import: shipping addresses' => 'CSV-Import: Lieferadressen',
- 'Calculate' => 'Berechnen',
- 'Calendar' => 'Kalender',
- 'Can not create that quantity with current stock' => 'Diese Anzahl kann mit dem gegenwärtigen Lagerbestand nicht hergestellt werden.',
- 'Cancel' => 'Abbrechen',
- 'Cancel Accounts Payables Transaction' => 'Kreditorenbuchung stornieren',
- 'Cancel Accounts Receivables Transaction' => 'Debitorenbuchung stornieren',
- 'Cannot create Lock!' => 'System kann nicht gesperrt werden!',
- 'Cannot delete account!' => 'Konto kann nicht gelöscht werden!',
- 'Cannot delete customer!' => 'Kunde kann nicht gelöscht werden!',
- 'Cannot delete default account!' => 'Das Standard-Konto kann nicht gelöscht werden!',
- 'Cannot delete delivery order!' => 'Lieferschein kann nicht gelöscht werden!',
- 'Cannot delete invoice!' => 'Rechnung kann nicht gelöscht werden!',
- 'Cannot delete item!' => 'Artikel kann nicht gelöscht werden!',
- 'Cannot delete order!' => 'Auftrag kann nicht gelöscht werden!',
- 'Cannot delete quotation!' => 'Angebot kann nicht gelöscht werden!',
- 'Cannot delete transaction!' => 'Buchung kann nicht gelöscht werden!',
- 'Cannot delete vendor!' => 'Lieferant kann nicht gelöscht werden!',
- 'Cannot find matching template for this print request. Please contact your template maintainer. I tried these: #1.' => 'Konnte keine passende Vorlage für diesen Druckauftrag finden. Bitte benachrichtigen Sie Ihren Vorlagenadministrator. Die folgenden Pfade wurden durchsucht: #1 ',
- 'Cannot have a value in both Debit and Credit!' => 'Es kann nicht gleichzeitig Soll und Haben gebucht werden!',
- 'Cannot post Payment!' => 'Zahlung kann nicht gebucht werden!',
- 'Cannot post Receipt!' => 'Beleg kann nicht gebucht werden!',
- 'Cannot post a transaction without a value!' => 'Eine Buchung ohne Betrag kann nicht vorgenommen werden!',
- 'Cannot post invoice for a closed period!' => 'Das Rechnungsdatum fällt in einen abgeschlossen Zeitraum!',
- 'Cannot post invoice!' => 'Rechnung kann nicht gebucht werden!',
- 'Cannot post payment for a closed period!' => 'Es können keine Zahlungen für abgeschlossene Bücher gebucht werden!',
- 'Cannot post payment!' => 'Zahlung kann nicht gebucht werden!',
- 'Cannot post transaction for a closed period!' => 'Für einen bereits abgeschlossenen Zeitraum kann keine Buchung angelegt werden!',
- 'Cannot post transaction with a debit and credit entry for the same account!' => 'Kann Soll und Haben nicht auf dasselbe Konto buchen!',
- 'Cannot post transaction!' => 'Rechnung kann nicht gebucht werden!',
- 'Cannot process payment for a closed period!' => 'Es kann keine Zahlung in einem abgeschlossenen Zeitraum verbucht werden!',
- 'Cannot remove files!' => 'Dateien können nicht gelöscht werden!',
- 'Cannot save account!' => 'Konto kann nicht gespeichert werden!',
- 'Cannot save order!' => 'Auftrag kann nicht gespeichert werden!',
- 'Cannot save preferences!' => 'Einstellungen können nicht gespeichert werden!',
- 'Cannot save quotation!' => 'Angebot kann nicht gespeichert werden!',
- 'Cannot storno storno invoice!' => 'Kann eine Stornorechnung nicht stornieren',
- 'Carry over shipping address' => 'Lieferadresse übernehmen',
- 'Cash' => 'Zahlungsverkehr',
- 'Cc' => 'Cc',
- 'Change Lx-Office installation settings (all menu entries beneath \'System\')' => 'Verändern der Lx-Office-Installationseinstellungen (Menüpunkte unterhalb von \'System\')',
- 'Change representative to' => 'Vertreter ändern in',
- 'Changes in this block are only sensible if the account is NOT a summary account AND there exists one valid taxkey. To select both Receivables and Payables only make sense for Payment / Receipt (i.e. account cash).' => 'Es ist nur sinnvoll Änderungen vorzunehmen, wenn das Konto KEIN Sammelkonto ist und wenn ein gültiger Steuerschlüssel für das Konto existiert. Gleichzeitig Haken bei Forderungen und Verbindlichkeiten zu setzen, macht auch NUR für den Zahlungsein- und Ausgang (bspw. Bank oder Kasse) Sinn.',
- 'Changes to Receivables and Payables are only possible if no transactions to this account are posted yet.' => 'Änderungen bei Forderungen oder Verbindlichkeiten sind nur möglich, wenn dieses Konto noch nicht bebucht wurde.',
- 'Charge Number' => 'Chargennummer',
- 'Charge number' => 'Chargennummer',
- 'Charset' => 'Zeichensatz',
- 'Chart' => 'Buchungskonto',
- 'Chart Type' => 'Kontentyp',
- 'Chart balance' => 'Kontensaldo',
- 'Chart of Accounts' => 'Kontenübersicht',
- 'Chart of accounts' => 'Kontenrahmen',
- 'Chartaccounts connected to this Tax:' => 'Konten, die mit dieser Steuer verknüpft sind:',
- 'Check' => 'Scheck',
- 'Check Details' => 'Bitte Angaben überprüfen',
- 'Check for duplicates' => 'Dublettencheck',
- 'Checks' => 'Schecks',
- 'Choose Customer' => 'Endkunde wählen:',
- 'Choose Outputformat' => 'Ausgabeformat auswählen...',
- 'Choose Vendor' => 'Händler wählen',
- 'Choose a Tax Number' => 'Bitte eine Steuernummer angeben',
- 'City' => 'Stadt',
- 'Cleared Balance' => 'abgeschlossen',
- 'Clearing Tax Received (No 71)' => 'Verrechnung des Erstattungsbetrages erwünscht (Zeile 71)',
- 'Click on login name to edit!' => 'Zum Bearbeiten den Benutzernamen anklicken!',
- 'Close' => 'Übernehmen',
- 'Close Books up to' => 'Die Bücher abschließen bis zum',
- 'Close Dialog' => 'Schließen',
- 'Close Flash' => 'Schließen',
- 'Close SEPA exports' => 'SEPA-Export abschließen',
- 'Close Window' => 'Fenster Schließen',
- 'Closed' => 'Geschlossen',
- 'Collective Orders only work for orders from one customer!' => 'Sammelaufträge funktionieren nur für Aufträge von einem Kunden!',
- 'Column name' => 'Spaltenname',
- 'Comma' => 'Komma',
- 'Comment' => 'Kommentar',
- 'Company' => 'Firma',
- 'Company Name' => 'Firmenname',
- 'Compare to' => 'Gegenüberstellen zu',
- 'Configuration' => 'Einstellungen',
- 'Configuration of individual TODO items' => 'Konfiguration für die einzelnen Aufgabenlistenpunkte',
- 'Configure' => 'Konfigurieren',
- 'Confirm' => 'Bestätigen',
- 'Confirm!' => 'Bestätigen Sie!',
- 'Confirmation' => 'Auftragsbestätigung',
- 'Contact' => 'Kontakt',
- 'Contact Person' => 'Ansprechpartner',
- 'Contact deleted.' => 'Ansprechpartner gelöscht.',
- 'Contact is in use and was flagged invalid.' => 'Ansprechpartner ist noch in Verwendung, und wurde als ungültig markiert.',
- 'Contact person (surname)' => 'Ansprechpartner (Nachname)',
- 'Contacts' => 'Ansprechpartner',
- 'Continue' => 'Weiter',
- 'Contra' => 'gegen',
- 'Copies' => 'Kopien',
- 'Correct taxkey' => 'Richtiger Steuerschlüssel',
- 'Corrections' => 'Korrekturen',
- 'Costs' => 'Kosten',
- 'Could not copy %s to %s. Reason: %s' => 'Die Datei "%s" konnte nicht nach "%s" kopiert werden. Grund: %s',
- 'Could not load employee' => 'Konnte Benutzer nicht laden',
- 'Could not open the file users/members.' => 'Die Datei "users/members" konnte nicht geöffnet werden.',
- 'Could not open the old memberfile.' => 'Die Datei mit den Benutzerdaten konnte nicht geöffnet werden.',
- 'Could not print dunning.' => 'Die Mahnungen konnten nicht gedruckt werden.',
- 'Could not rename %s to %s. Reason: %s' => 'Die Datei "%s" konnte nicht in "%s" umbenannt werden. Grund: %s',
- 'Could not spawn ghostscript.' => 'Die Anwendung "ghostscript" konnte nicht gestartet werden.',
- 'Could not spawn the printer command.' => 'Die Druckanwendung konnte nicht gestartet werden.',
- 'Could not update prices!' => 'Preise konnten nicht aktualisiert werden!',
- 'Country' => 'Land',
- 'Create Assembly' => 'Erzeugnis fertigen',
- 'Create Buchungsgruppen' => 'Buchungsgruppe erfassen',
- 'Create Chart of Accounts' => 'Zu verwendender Kontenplan',
- 'Create Dataset' => 'Neue Datenbank anlegen',
- 'Create Date' => 'Erstelldatum',
- 'Create a new business' => 'Einen neuen Kunden-/Lieferantentyp erfassen',
- 'Create a new department' => 'Eine neue Abteilung erfassen',
- 'Create a new payment term' => 'Neue Zahlungsbedingungen anlegen',
- 'Create a standard group' => 'Eine Standard-Benutzergruppe anlegen',
- 'Create and edit RFQs' => 'Lieferantenanfragen erfassen und bearbeiten',
- 'Create and edit dunnings' => 'Mahnungen erfassen und bearbeiten',
- 'Create and edit invoices and credit notes' => 'Rechnungen und Gutschriften erfassen und bearbeiten',
- 'Create and edit parts, services, assemblies' => 'Artikel, Dienstleistungen, Erzeugnisse erfassen und bearbeiten',
- 'Create and edit projects' => 'Projekte erfassen und bearbeiten',
- 'Create and edit purchase delivery orders' => 'Lieferscheine von Lieferanten erfassen und bearbeiten',
- 'Create and edit purchase orders' => 'Lieferantenaufträge erfassen und bearbeiten',
- 'Create and edit sales delivery orders' => 'Lieferscheine für Kunden erfassen und bearbeiten',
- 'Create and edit sales orders' => 'Auftragsbestätigungen erfassen und bearbeiten',
- 'Create and edit sales quotations' => 'Angebote erfassen und bearbeiten',
- 'Create and edit vendor invoices' => 'Eingangsrechnungen erfassen und bearbeiten',
- 'Create bank collection' => 'Bankeinzug erstellen',
- 'Create bank collection via SEPA XML' => 'Bankeinzug via SEPA XML erstellen',
- 'Create bank transfer' => 'Überweisung erstellen',
- 'Create bank transfer via SEPA XML' => 'Überweisung via SEPA XML erzeugen',
- 'Create customers and vendors. Edit all vendors. Edit all customers' => 'Kunden und Lieferanten erfassen. Alle Lieferanten bearbeiten. Alle Kunden bearbeiten',
- 'Create customers and vendors. Edit all vendors. Edit only customers where salesman equals employee (login)' => 'Kunden und Lieferanten erfassen. Alle Lieferanten bearbeiten. Nur Kunden bearbeiten bei denen der Verkäufer gleich Bearbeiter (login) ist',
- 'Create invoice?' => 'Rechnung erstellen?',
- 'Create new' => 'Neu erfassen',
- 'Create new business' => 'Kunden-/Lieferantentyp erfassen',
- 'Create new department' => 'Neue Abteilung erfassen',
- 'Create new payment term' => 'Neue Zahlungsbedingung anlegen',
- 'Create tables' => 'Tabellen anlegen',
- 'Created by' => 'Erstellt von',
- 'Created for' => 'Erstellt für',
- 'Created on' => 'Erstellt am',
- 'Credit' => 'Haben',
- 'Credit (one letter abbreviation)' => 'H',
- 'Credit Account' => 'Habenkonto',
- 'Credit Limit' => 'Kreditlimit',
- 'Credit Limit exceeded!!!' => 'Kreditlimit überschritten!',
- 'Credit Note' => 'Gutschrift',
- 'Credit Note Date' => 'Gutschriftdatum',
- 'Credit Note Number' => 'Gutschriftnummer',
- 'Credit Starting Balance' => 'EB Aktiva',
- 'Credit Tax' => 'Umsatzsteuer',
- 'Credit Tax Account' => 'Umsatzsteuerkonto',
- 'Credit note (one letter abbreviation)' => 'G',
- 'Curr' => 'Währung',
- 'Currencies' => 'Währungen',
- 'Currency' => 'Währung',
- 'Current / Next Level' => 'Aktuelles / Nächstes Mahnlevel',
- 'Current Earnings' => 'Gewinn',
- 'Current assets account' => 'Konto für Umlaufvermögen',
- 'Current profile' => 'Aktuelles Profil',
- 'Current unit' => 'Aktuelle Einheit',
- 'Current value:' => 'Aktueller Wert:',
- 'Custom Variables' => 'Erweitert',
- 'Custom variables for module' => ' Erweiterte Datenfelder für ',
- 'Customer' => 'Kunde',
- 'Customer (name)' => 'Kunde (Name)',
- 'Customer Name' => 'Kundenname',
- 'Customer Number' => 'Kundennummer',
- 'Customer Order Number' => 'Bestellnummer des Kunden',
- 'Customer deleted!' => 'Kunde gelöscht!',
- 'Customer details' => 'Kundendetails',
- 'Customer missing!' => 'Kundenname fehlt!',
- 'Customer not on file or locked!' => 'Dieser Kunde existiert nicht oder ist gesperrt.',
- 'Customer not on file!' => 'Kunde ist nicht in der Datenbank!',
- 'Customer saved!' => 'Kunde gespeichert!',
- 'Customer type' => 'Kundentyp',
- 'Customer/Vendor' => 'Kunde/Lieferant',
- 'Customer/Vendor (database ID)' => 'Kunde/Lieferant (Datenbank-ID)',
- 'Customername' => 'Kundenname',
- 'Customernumberinit' => 'Kunden-/Lieferantennummernkreis',
- 'Customers' => 'Kunden',
- 'Customers and vendors' => 'Kunden und Lieferanten',
- 'Customized Report' => 'Vorgewählte Zeiträume',
- 'DATEV - Export Assistent' => 'DATEV-Exportassistent',
- 'DATEV Angaben' => 'DATEV-Angaben',
- 'DATEV Export' => 'DATEV-Export',
- 'DATEX - Export Assistent' => 'DATEV-Exportassistent',
- 'DELETED' => 'Gelöscht',
- 'DFV-Kennzeichen' => 'DFV-Kennzeichen',
- 'DR' => 'S',
- 'DUNNING STARTED' => 'Mahnprozess gestartet',
- 'DUNS-Nr' => 'DUNS-Nr.',
- 'Database' => 'Datenbank',
- 'Database Administration' => 'Datenbankadministration',
- 'Database Connection Test' => 'Test der Datenbankverbindung',
- 'Database Host' => 'Datenbankcomputer',
- 'Database User' => 'Datenbankbenutzer',
- 'Database User missing!' => 'Datenbankbenutzer fehlt!',
- 'Database backups and restorations are disabled in the configuration.' => 'Datenbanksicherungen und -wiederherstellungen sind in der Konfiguration deaktiviert.',
- 'Database name' => 'Datenbankname',
- 'Database template' => 'Datenbankvorlage',
- 'Database update error:' => 'Fehler beim Datenbankupgrade:',
- 'Dataset' => 'Datenbank',
- 'Dataset missing!' => 'Datenbank fehlt!',
- 'Dataset name' => 'Datenbankname',
- 'Dataset upgrade' => 'Datenbankaktualisierung',
- 'Date' => 'Datum',
- 'Date Format' => 'Datumsformat',
- 'Date Paid' => 'Zahlungsdatum',
- 'Date and timestamp variables: If the default value equals \'NOW\' then the current date/current timestamp will be used. Otherwise the default value is copied as-is.' => 'Datums- und Uhrzeitvariablen: Wenn der Standardwert \'NOW\' ist, so wird das aktuelle Datum/die aktuelle Uhrzeit eingefügt. Andernfalls wird der Standardwert so wie er ist benutzt.',
- 'Date missing!' => 'Datum fehlt!',
- 'Date the payment is due in full' => 'Das Datum, bis die Rechnung in voller Höhe bezahlt werden muss',
- 'Date the payment is due with discount' => 'Das Datum, bis die Rechnung unter Abzug von Skonto bezahlt werden kann',
- 'Datevautomatik' => 'Datevexport',
- 'Datum von' => 'Datum von',
- 'Debit' => 'Soll',
- 'Debit (one letter abbreviation)' => 'S',
- 'Debit Account' => 'Sollkonto',
- 'Debit Starting Balance' => 'EB Passiva',
- 'Debit Tax' => 'Vorsteuer',
- 'Debit Tax Account' => 'Vorsteuerkonto',
- 'Debit and credit out of balance!' => 'Soll und Haben müssen gleich sein.',
- 'Dec' => 'Dez',
- 'December' => 'Dezember',
- 'Decimalplaces' => 'Dezimalstellen',
- 'Decrease' => 'Verringern',
- 'Default (no language selected)' => 'Standard (keine Sprache ausgewählt)',
- 'Default Accounts' => 'Standardkonten',
- 'Default Customer/Vendor Language' => 'Standard-Kunden-/Lieferantensprache',
- 'Default buchungsgruppe' => 'Standardbuchungsgruppe',
- 'Default output medium' => 'Standardausgabekanal',
- 'Default printer' => 'Standarddrucker',
- 'Default template format' => 'Standardvorlagenformat',
- 'Default unit' => 'Standardeinheit',
- 'Default value' => 'Standardwert',
- 'Defaults saved.' => 'Die Standardeinstellungen wurden gespeichert.',
- 'Delete' => 'Löschen',
- 'Delete Account' => 'Konto löschen',
- 'Delete Contact' => 'Ansprechpartner löschen',
- 'Delete Dataset' => 'Datenbank löschen',
- 'Delete Shipto' => 'Lieferadresse löschen',
- 'Delete delivery order' => 'Lieferschein löschen',
- 'Delete drafts' => 'Entwürfe löschen',
- 'Delete group' => 'Gruppe löschen',
- 'Delete profile' => 'Profil löschen',
- 'Delete transaction' => 'Buchung löschen',
- 'Deleted' => 'Gelöscht',
- 'Delivered' => 'Geliefert',
- 'Delivery Date' => 'Lieferdatum',
- 'Delivery Order' => 'Lieferschein',
- 'Delivery Order Date' => 'Lieferscheindatum',
- 'Delivery Order Date missing!' => 'Lieferscheindatum fehlt!',
- 'Delivery Order Number' => 'Lieferscheinnummer',
- 'Delivery Order created' => 'Lieferschein erstellt',
- 'Delivery Order deleted!' => 'Lieferschein gelöscht!',
- 'Delivery Orders' => 'Lieferscheine',
- 'Department' => 'Abteilung',
- 'Department 1' => 'Abteilung (1)',
- 'Department 2' => 'Abteilung (2)',
- 'Department Id' => 'Abteilungsnummer',
- 'Departments' => 'Abteilungen',
- 'Dependency loop detected:' => 'Schleife in den Abhängigkeiten entdeckt:',
- 'Deposit' => 'Gutschrift',
- 'Description' => 'Beschreibung',
- 'Description (Click on Description for details)' => 'Beschreibung (Klick öffnet einzelne Kontendetails)',
- 'Description (translation for #1)' => 'Beschreibung (Übersetzung für #1)',
- 'Description missing!' => 'Beschreibung fehlt.',
- 'Description must not be empty!' => 'Beschreibung darf nicht leer sein',
- 'Destination BIC' => 'Ziel-BIC',
- 'Destination IBAN' => 'Ziel-IBAN',
- 'Destination bin' => 'Ziellagerplatz',
- 'Destination warehouse' => 'Ziellager',
- 'Destination warehouse and bin' => 'Ziellager und -lagerplatz',
- 'Details (one letter abbreviation)' => 'Details',
- 'Difference' => 'Differenz',
- 'Dimension unit' => 'Maßeinheit',
- 'Directory' => 'Verzeichnis',
- 'Discard duplicate entries in CSV file' => 'Doppelte Einträge in CSV-Datei verwerfen',
- 'Discard entries with duplicates in database or CSV file' => 'Einträge aus CSV-Datei verwerfen, die es bereits in der Datenbank oder der CSV-Datei gibt',
- 'Discount' => 'Rabatt',
- 'Display' => 'Anzeigen',
- 'Display file' => 'Datei anzeigen',
- 'Display options' => 'Oberfläche',
- 'Do not check for duplicates' => 'Nicht nach Dubletten suchen',
- 'Do not set default buchungsgruppe' => 'Nie Standardbuchungsgruppe setzen',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank collections that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => 'Wollen Sie wirklich die folgenden SEPA-Exporte abschließen? Für Überweisungen, die noch nicht gebucht wurden, werden dann keine Zahlungen verbucht.',
- 'Do you really want to delete AP transaction #1?' => 'Wollen Sie wirklich die Kreditorenbuchung #1 löschen?',
- 'Do you really want to delete AR transaction #1?' => 'Wollen Sie wirklich die Debitorenbuchung #1 löschen?',
- 'Do you really want to delete GL transaction #1?' => 'Wollen Sie wirklich die Dialogbuchung #1 löschen?',
- 'Do you really want to delete this group?' => 'Gruppe wirklich löschen?',
- 'Do you really want to delete this object?' => 'Wirklich löschen?',
- 'Do you really want to delete this warehouse?' => 'Wollen Sie dieses Lager wirklich löschen?',
- 'Do you want Lx-Office to create a group for access to all functions?' => 'Wollen Sie, dass Lx-Office eine Gruppe mit Zugriff auf alle Funktionen anlegt?',
- 'Do you want to <b>limit</b> your search?' => 'Wollen Sie Ihre Suche <b>spezialisieren</b>?',
- 'Do you want to carry this shipping address over to the new purchase order so that the vendor can deliver the goods directly to your customer?' => 'Wollen Sie diese Lieferadresse in den neuen Lieferantenauftrag übernehmen, damit der Händler die Waren direkt an Ihren Kunden liefern kann?',
- 'Do you want to store the existing onhand values into a new warehouse?' => 'Möchten Sie die vorhandenen Mengendaten in ein Lager übertragen?',
- 'Document' => 'Dokument',
- 'Document Project Number' => 'Projektnummer des Belegs',
- 'Documents in the WebDAV repository' => 'Dokumente im WebDAV-Repository',
- 'Done' => 'Fertig',
- 'Download SEPA XML export file' => 'SEPA-XML-Exportdatei herunterladen',
- 'Download sample file' => 'Beispieldatei herunterladen',
- 'Download the backup' => 'Die Sicherungsdatei herunterladen',
- 'Draft saved.' => 'Entwurf gespeichert.',
- 'Drawing' => 'Zeichnung',
- 'Driver' => 'Treiber',
- 'Dropdown Limit' => 'Auswahllistenbegrenzung',
- 'Due' => 'Fällig',
- 'Due Date' => 'Fälligkeitsdatum',
- 'Due Date missing!' => 'Fälligkeitsdatum fehlt!',
- 'Due to security concerns these files have to be deleted or moved after the migration before you can continue using Lx-Office.' => 'Aus Sicherheitsgründen müssen diese Dateien nach erfolgter Migration gelöscht oder verschoben werden, bevor Lx-Office weiter genutzt werden kann.',
- 'Duedate +Days' => 'Fällikeitsdatum +Tage',
- 'Dunning' => 'Mahnung',
- 'Dunning Amount' => 'gemahnter Betrag',
- 'Dunning Date' => 'Mahndatum',
- 'Dunning Date from' => 'Mahnungen von',
- 'Dunning Description' => 'Mahnstufenbeschreibung',
- 'Dunning Description missing in row ' => 'Mahnstufenbeschreibung fehlt in Zeile ',
- 'Dunning Duedate' => 'Zahlbar bis',
- 'Dunning Level' => 'Mahnlevel',
- 'Dunning Level missing in row ' => 'Mahnlevel fehlt in ',
- 'Dunning Process Config saved!' => 'Mahnwesenkonfiguration gespeichert!',
- 'Dunning Process started for selected invoices!' => 'Mahnprozess für selektierte Rechnungen gestartet',
- 'Dunning number' => 'Mahnungsnummer',
- 'Dunning overview' => 'Mahnungsübersicht',
- 'Dunnings' => 'Mahnungen',
- 'Duplicate in CSV file' => 'Duplikat in CSV-Datei',
- 'Duplicate in database' => 'Duplikat in Datenbank',
- 'During this user migration Lx-Office can create such a group for you and grant all users access to all of Lx-Office\'s functions.' => 'Im Rahmen dieser Benutzerdatenmigration kann Lx-Office eine solche Gruppe für Sie anlegen und allen Benutzern Zugriff auf alle Lx-Office-Funktionen gewähren.',
- 'E-mail' => 'eMail',
- 'E-mail Statement to' => 'Fälligkeitsabrechnung als eMail an',
- 'E-mail address missing!' => 'E-Mail-Adresse fehlt!',
- 'EAN' => 'EAN',
- 'EAN-Code' => 'EAN-Code',
- 'EB-Wert' => 'EB-Wert',
- 'EK' => 'EK',
- 'ELSE' => 'Zusatz',
- 'ELSTER Export (Taxbird)' => 'ELSTER-Export nach Taxbird',
- 'ELSTER Export (Winston)' => 'ELSTER Export nach Winston',
- 'ELSTER Export nach Winston' => 'ELSTER Export nach Winston',
- 'ELSTER Tax Number' => 'ELSTER-Steuernummer',
- 'EQUITY' => 'EIGENTUM',
- 'EU with VAT ID' => 'EU mit UstId-Nummer',
- 'EU without VAT ID' => 'EU ohne UstId-Nummer',
- 'EUER' => 'Einnahmen-/Überschussrechnung',
- 'EUR' => 'E/Ü-Rechnung',
- 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => 'Frühere Versionen von Lx-Office enthielten Bugs, die zu falschen Einträgen im Hauptbuch geführt haben können.',
- 'Edit' => 'Bearbeiten',
- 'Edit Access Rights' => 'Zugriffsrechte',
- 'Edit Access Rights for Follow-Ups' => 'Zugriff auf meine Wiedervorlagen regeln',
- 'Edit Account' => 'Kontodaten bearbeiten',
- 'Edit Accounting Group' => 'Buchungsgruppe bearbeiten',
- 'Edit Accounts Payables Transaction' => 'Kreditorenbuchung bearbeiten',
- 'Edit Accounts Receivables Transaction' => 'Debitorenbuchung bearbeiten',
- 'Edit Assembly' => 'Erzeugnis bearbeiten',
- 'Edit Bins' => 'Lagerplätze bearbeiten',
- 'Edit Buchungsgruppe' => 'Buchungsgruppe bearbeiten',
- 'Edit Credit Note' => 'Gutschrift bearbeiten',
- 'Edit Customer' => 'Kunde editieren',
- 'Edit Dunning' => 'Mahnungen konfigurieren',
- 'Edit Dunning Process Config' => 'Mahnwesenkonfiguration bearbeiten',
- 'Edit Employee #1' => 'Benutzer #1 bearbeiten',
- 'Edit Follow-Up' => 'Wiedervorlage bearbeiten',
- 'Edit Follow-Up for #1' => 'Wiedervorlage für #1 bearbeiten',
- 'Edit General Ledger Transaction' => 'Buchung im Hauptbuch bearbeiten',
- 'Edit Group' => 'Warengruppe editieren',
- 'Edit Language' => 'Sprache bearbeiten',
- 'Edit Lead' => 'Kundenquelle bearbeiten',
- 'Edit Part' => 'Artikel bearbeiten',
- 'Edit Preferences for #1' => 'Meine Einstellungen: #1',
- 'Edit Price Factor' => 'Preisfaktor bearbeiten',
- 'Edit Pricegroup' => 'Preisgruppe bearbeiten',
- 'Edit Printer' => 'Drucker bearbeiten',
- 'Edit Project' => 'Projekt bearbeiten',
- 'Edit Purchase Delivery Order' => 'Lieferschein (Einkauf) bearbeiten',
- 'Edit Purchase Order' => 'Lieferantenaufrag bearbeiten',
- 'Edit Quotation' => 'Angebot bearbeiten',
- 'Edit Request for Quotation' => 'Anfrage bearbeiten',
- 'Edit SEPA strings' => 'Begriffe bei SEPA-Überweisungen bearbeiten',
- 'Edit Sales Delivery Order' => 'Lieferschein (Verkauf) bearbeiten',
- 'Edit Sales Invoice' => 'Rechnung bearbeiten',
- 'Edit Sales Order' => 'Auftrag bearbeiten',
- 'Edit Service' => 'Dienstleistung bearbeiten',
- 'Edit Storno Credit Note' => 'Storno Gutschrift bearbeiten',
- 'Edit Storno Invoice' => 'Stornorechnung bearbeiten',
- 'Edit User' => 'Benutzerdaten bearbeiten',
- 'Edit Vendor' => 'Lieferant editieren',
- 'Edit Vendor Invoice' => 'Einkaufsrechnung bearbeiten',
- 'Edit Warehouse' => 'Lager bearbeiten',
- 'Edit and delete a group' => 'Gruppen bearbeiten und Rechte festlegen',
- 'Edit bank account' => 'Bankkonto bearbeiten',
- 'Edit business' => 'Kunden-/Lieferantentyp bearbeiten',
- 'Edit custom variable' => 'Benutzerdefinierte Variable bearbeiten',
- 'Edit department' => 'Abteilung bearbeiten',
- 'Edit file' => 'Datei bearbeiten',
- 'Edit greetings' => 'Anreden bearbeiten',
- 'Edit group ' => 'Gruppe bearbeiten',
- 'Edit group membership' => 'Gruppenmitgliedschaften bearbeiten',
- 'Edit groups' => 'Gruppen bearbeiten',
- 'Edit membership' => 'Mitglieder',
- 'Edit note' => 'Notiz bearbeiten',
- 'Edit payment term' => 'Zahlungsbedingungen bearbeiten',
- 'Edit prices and discount (if not used, textfield is ONLY set readonly)' => 'Preise und Rabatt in Formularen frei anpassen (falls deaktiviert, wird allerdings NUR das textfield auf READONLY gesetzt / kann je nach Browserversion und technischen Fähigkeiten des Anwenders noch umgangen werden)',
- 'Edit rights' => 'Rechte bearbeiten',
- 'Edit templates' => 'Vorlagen bearbeiten',
- 'Edit the Delivery Order' => 'Lieferschein bearbeiten',
- 'Edit the configuration for periodic invoices' => 'Konfiguration für wiederkehrende Rechnungen bearbeiten',
- 'Edit the membership of all users in all groups:' => 'Bearbeiten der Mitgliedschaft aller Benutzer in allen Gruppen:',
- 'Edit the purchase_order' => 'Bearbeiten des Lieferantenauftrags',
- 'Edit the request_quotation' => 'Bearbeiten der Preisanfrage',
- 'Edit the sales_order' => 'Bearbeiten des Auftrags',
- 'Edit the sales_quotation' => 'Bearbeiten des Angebots',
- 'Edit the stylesheet' => 'CSS bearbeiten (Oberfläche)',
- 'Edit units' => 'Einheiten bearbeiten',
- 'Editable' => 'Bearbeitbar',
- 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => 'Entweder gibt es keine offenen Rechnungen, oder es wurden bereits Überweisungen über die offenen Beträge aller offenen Rechnungen erstellt.',
- 'Element disabled' => 'Element deaktiviert',
- 'Employee' => 'Bearbeiter',
- 'Employee #1 saved!' => 'Benutzer #1 gespeichert!',
- 'Employees' => 'Benutzer',
- 'Empty transaction!' => 'Buchung ist leer!',
- 'End date' => 'Enddatum',
- 'Enter a description for this new draft.' => 'Geben Sie eine Beschreibung für diesen Entwurf ein.',
- 'Enter longdescription' => 'Langtext eingeben',
- 'Enter the requested execution date or leave empty for the quickest possible execution:' => 'Geben Sie das jeweils gewünschte Ausführungsdatum an, oder lassen Sie das Feld leer für die schnellstmögliche Ausführung:',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Geben Sie Ihre und weitere Währungen mit bis zu drei Buchstaben pro Währung und Währungen durch Doppelpunkte getrennt ein (z.B. EUR:USD:CAD)',
- 'Equity' => 'Passiva',
- 'Error' => 'Fehler',
- 'Error in database control file \'%s\': %s' => 'Fehler in Datenbankupgradekontrolldatei \'%s\': %s',
- 'Error in position #1: You must either assign no stock at all or the full quantity of #2 #3.' => 'Fehler in Position #1: Sie müssen einer Position entweder gar keinen Lagereingang oder die vollständige im Lieferschein vermerkte Menge von #2 #3 zuweisen.',
- 'Error in position #1: You must either assign no transfer at all or the full quantity of #2 #3.' => 'Fehler in Position #1: Sie müssen einer Position entweder gar keinen Lagerausgang oder die vollständige im Lieferschein vermerkte Menge von #2 #3 zuweisen.',
- 'Error in row #1: The quantity you entered is bigger than the stocked quantity.' => 'Fehler in Zeile #1: Die angegebene Menge ist größer als die vorhandene Menge.',
- 'Error message from the database driver:' => 'Fehlermeldung des Datenbanktreibers:',
- 'Error when saving: #1' => 'Fehler beim Speichern: #2',
- 'Error!' => 'Fehler!',
- 'Error: Buchungsgruppe missing or invalid' => 'Fehler: Buchungsgruppe fehlt oder ungültig',
- 'Error: Customer/vendor not found' => 'Fehler: Kunde/Lieferant nicht gefunden',
- 'Error: Gender (cp_gender) missing or invalid' => 'Fehler: Geschlecht (cp_gender) fehlt oder ungültig',
- 'Error: Invalid business' => 'Fehler: Kunden-/Lieferantentyp ungültig',
- 'Error: Invalid language' => 'Fehler: Sprache ungültig',
- 'Error: Invalid part type' => 'Fehler: Artikeltyp ungültig',
- 'Error: Invalid parts group' => 'Fehler: Warengruppe ungültig',
- 'Error: Invalid payment terms' => 'Fehler: Zahlungsbedingungen ungültig',
- 'Error: Invalid price factor' => 'Fehler: Preisfaktor ungültig',
- 'Error: Invalid vendor in column make_#1' => 'Fehler: Lieferant ungültig in Spalte make_#1',
- 'Error: Name missing' => 'Fehler: Name fehlt',
- 'Error: Unit missing or invalid' => 'Fehler: Einheit fehlt oder ungültig',
- 'Errors' => 'Fehler',
- 'Ertrag' => 'Ertrag',
- 'Ertrag prozentual' => 'Ertrag prozentual',
- 'Escape character' => 'Escape-Zeichen',
- 'Exact' => 'Genau',
- 'Example: http://lx-office.org' => 'Beispiel: http://lx-office.org',
- 'Excel' => 'Excel',
- 'Exch' => 'Wechselkurs.',
- 'Exchangerate' => 'Wechselkurs',
- 'Exchangerate Difference' => 'Wechselkursunterschied',
- 'Exchangerate for payment missing!' => 'Es fehlt der Wechselkurs für die Bezahlung!',
- 'Exchangerate missing!' => 'Es fehlt der Wechselkurs!',
- 'Executed' => 'Ausgeführt',
- 'Execution date' => 'Ausführungsdatum',
- 'Execution date from' => 'Ausführungsdatum von',
- 'Execution date to' => 'Ausführungsdatum bis',
- 'Existing Buchungsgruppen' => 'Existierende Buchungsgruppen',
- 'Existing Datasets' => 'Existierende Datenbanken',
- 'Existing file on server' => 'Auf dem Server existierende Datei',
- 'Existing pending follow-ups for this item' => 'Noch nicht erledigte Wiedervorlagen für dieses Dokument',
- 'Existing profiles' => 'Existierende Profile',
- 'Expected Tax' => 'Erwartete Steuern',
- 'Expense' => 'Aufwandskonto',
- 'Expense Account' => 'Aufwandskonto',
- 'Expense accno' => 'Aufwandskonto',
- 'Expense/Asset' => 'Aufwand/Anlagen',
- 'Expenses EU with UStId' => 'Aufwand EU m. UStId',
- 'Expenses EU without UStId' => 'Aufwand EU o. UStId',
- 'Export Buchungsdaten' => 'Export Buchungsdaten',
- 'Export Stammdaten' => 'Export Stammdaten',
- 'Export as CSV' => 'Als CSV exportieren',
- 'Export as PDF' => 'Als PDF exportieren',
- 'Export date' => 'Exportdatum',
- 'Export date from' => 'Exportdatum von',
- 'Export date to' => 'Exportdatum bis',
- 'Extend automatically by n months' => 'Automatische Verlängerung um x Monate',
- 'Extended' => 'Gesamt',
- 'Extension Of Time' => 'Dauerfristverlängerung',
- 'Factor' => 'Faktor',
- 'Factor missing!' => 'Der Faktor fehlt.',
- 'Falsches Datumsformat!' => 'Falsches Datumsformat!',
- 'Fax' => 'Fax',
- 'Feb' => 'Feb',
- 'February' => 'Februar',
- 'Fee' => 'Gebühr',
- 'Field' => 'Feld',
- 'File' => 'Datei',
- 'File name' => 'Dateiname',
- 'Files created by Lx-Office\'s "Backup Dataset" function are such files.' => 'Dateien, die von Lx-Office\' Funktion "Datenbank sichern" erstellt wurden, erfüllen diese Kriterien.',
- 'Filter' => 'Suche eingrenzen',
- 'Filter date by' => 'Datum filtern nach',
- 'Finish' => 'Abschließen',
- 'Fix transaction' => 'Buchung korrigieren',
- 'Fix transactions' => 'Buchungen korrigieren',
- 'Folgekonto' => 'Folgekonto',
- 'Follow-Up' => 'Wiedervorlage',
- 'Follow-Up Date' => 'Wiedervorlagedatum',
- 'Follow-Up On' => 'Wiedervorlage am',
- 'Follow-Up done' => 'Wiedervorlage erledigt',
- 'Follow-Up for' => 'Wiedervorlage für',
- 'Follow-Up for user' => 'Wiedervorlage für Benutzer',
- 'Follow-Up saved.' => 'Wiedervorlage gespeichert.',
- 'Follow-Ups' => 'Wiedervorlagen',
- 'Follow-up for' => 'Wiedervorlage für',
- 'Font' => 'Schriftart',
- 'Font size' => 'Schriftgröße',
- 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => 'Bei Kreditorenbuchungen werden die Umsatzsteuer-Steuerschlüssel durch Vorsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
- 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => 'Bei Debitorenbuchungen werden die Vorsteuer-Steuerschlüssel durch Umsatzsteuer-Steuerschlüssel mit demselben Steuersatz ersetzt.',
- 'For each unit there\'s either no or exactly one base unit. If you chose a base unit then you also have to chose a factor. That way the new unit will be defined as a multiple of the base unit. The base unit must be the "smaller" one. A factor may not be less than 1. Therefore you may define "kg" with the base unit "g" and a factor of "1", but not the other way round.' => 'Einheiten haben entweder keine oder genau eine Basiseinheit, von der sie ein Vielfaches sind. Wenn Sie eine Basiseinheit auswählen, dann müssen Sie auch einen Faktor eingeben. Sie müssen Einheiten als ein Vielfaches einer kleineren Einheit eingeben. So ist die Definition von "kg" mit der Basiseinheit "g" und dem Faktor 1000 zulässig, die Definition von "g" mit der Basiseinheit "kg" und dem Faktor "0,001" hingegen nicht.',
- 'For further information read this: ' => 'Für weitere Informationen zu diesem Thema lesen Sie bitte: ',
- 'For type "customer" the perl module JSON is required. Please check this on system level: $ ./scripts/installation_check.pl' => 'Für den Typ "Kunde" wird das Perl Module JSON benötigt. Überprüfbar im Installationspfad mit: $ ./scripts/installation_check.pl',
- 'Foreign Exchange Gain' => 'Wechselkurserträge',
- 'Foreign Exchange Loss' => 'Wechselkursaufwendungen',
- 'Foreign Expenses' => 'Aufwand Ausland',
- 'Foreign Revenues' => 'Erlöse Ausland',
- 'Form details (second row)' => 'Formulardetails (zweite Positionszeile)',
- 'Formula' => 'Formel',
- 'Found #1 errors.' => '#1 Fehler gefunden.',
- 'Found #1 objects of which #2 can be imported.' => 'Es wurden #1 Objekte gefunden, von denen #2 importiert werden können.',
- 'Free report period' => 'Freier Zeitraum',
- 'Free-form text' => 'Textzeile',
- 'Fristsetzung' => 'Fristsetzung',
- 'From' => 'Von',
- 'From Date' => 'Von',
- 'Full Access' => 'Vollzugriff',
- 'Full access to all functions' => 'Vollzugriff auf alle Funktionen',
- 'Fwd' => 'Vorwärts',
- 'GL Transaction' => 'Dialogbuchung',
- 'Gegenkonto' => 'Gegenkonto',
- 'Gender' => 'Geschlecht',
- 'General Ledger' => 'Buchhaltung',
- 'General Ledger Corrections' => 'Korrekturen im Hauptbuch',
- 'General Ledger Transaction' => 'Dialogbuchung',
- 'General ledger and cash' => 'Finanzbuchhaltung und Zahlungsverkehr',
- 'General ledger corrections' => 'Korrekturen im Hauptbuch',
- 'Generic Tax Report' => 'USTVA Bericht',
- 'Given Name' => 'Vorname',
- 'Go one step back' => 'Einen Schritt zurück',
- 'Go one step forward' => 'Einen Schritt vorwärts',
- 'Greeting' => 'Anrede',
- 'Greetings' => 'Anreden',
- 'Group' => 'Warengruppe',
- 'Group Invoices' => 'Rechnungen zusammenfassen',
- 'Group Items' => 'Waren gruppieren',
- 'Group deleted!' => 'Warengruppe gelöscht!',
- 'Group membership' => 'Gruppenzugehörigkeit',
- 'Group missing!' => 'Warengruppe fehlt!',
- 'Group saved!' => 'Warengruppe gespeichert!',
- 'Groups' => 'Warengruppen',
- 'HTML' => 'HTML',
- 'HTML Templates' => 'HTML-Vorlagen',
- 'Hardcopy' => 'Seite drucken',
- 'Has serial number' => 'Hat eine Serienummer',
- 'Heading' => 'Überschrift',
- 'Headings' => 'Überschriften',
- 'Help' => 'Hilfe',
- 'Help Template Variables' => 'Hilfe zu Dokumenten-Variablen',
- 'Help on column names' => 'Hilfe zu Spaltennamen',
- 'Here\'s an example command line:' => 'Hier ist eine Kommandozeile, die als Beispiel dient:',
- 'Hide by default' => 'Standardmäßig verstecken',
- 'Hide help text' => 'Hilfetext verbergen',
- 'History' => 'Historie',
- 'History Search' => 'Historien Suche',
- 'History Search Engine' => 'Historien Suchmaschine',
- 'Homepage' => 'Homepage',
- 'Host' => 'Datenbankcomputer',
- 'However, you can create a new part which will then be selected.' => 'Sie können jedoch einen neuen Artikel anlegen, der dann automatisch ausgewählt wird.',
- 'I' => 'I',
- 'IBAN' => 'IBAN',
- 'ID' => 'Buchungsnummer',
- 'ID-Nummer' => 'ID-Nummer (intern)',
- 'II' => 'II',
- 'III' => 'III',
- 'IMPORTANT NOTE: You cannot safely change currencies, IF you have already booking entries!' => 'WICHTIGER HINWEIS: Falls schon Buchungen im Mandanten vorhanden sind, kann man nicht mehr UNKRITISCH neue oder andere Währungen konfigurieren!',
- 'IV' => 'IV',
- 'If checked the taxkey will not be exported in the DATEV Export, but only IF chart taxkeys differ from general ledger taxkeys' => 'Falls angehakt wird der DATEV-Steuerschlüssel bei Buchungen auf dieses Konto nicht beim DATEV-Export mitexportiert, allerdings nur wenn zusätzlich der Konto-Steuerschlüssel vom Buchungs (Hauptbuch) Steuerschlüssel abweicht',
- 'If the article type is set to \'mixed\' then a column called \'type\' must be present.' => 'Falls der Artikeltyp auf \'gemischt\' gestellt wird, muss eine Spalte namens \'type\' vorhanden sein.',
- 'If the automatic creation of invoices for fees and interest is switched on for a dunning level then the following accounts will be used for the invoice.' => 'Wenn das automatische Erstellen einer Rechnung über Mahngebühren und Zinsen für ein Mahnlevel aktiviert ist, so werden die folgenden Konten für die Rechnung benutzt.',
- 'If the database user listed above does not have the right to create a database then enter the name and password of the superuser below:' => 'Falls der oben genannte Datenbankbenutzer nicht die Berechtigung zum Anlegen neuer Datenbanken hat, so können Sie hier den Namen und das Passwort des Datenbankadministratoraccounts angeben:',
- 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => 'Falls Sie sich entscheiden, Lx-Office die Migration durchführen zu lassen, so wird Lx-Office ein Backup der alten Dateien im Verzeichnis "#1" erstellen und die Dateien anschließend löschen.',
- 'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => 'Wenn Sie für die Artikelnummer und / oder die Beschreibung etwas eingeben, so werden nur die Lagerplätze angezeigt, in denen Waren eingelagert sind, die Ihre Suchbegriffe enthalten.',
- 'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => 'Wenn Sie diese Meldung sehen haben Sie wahrscheinlich ein frisches LX-Office Setup und noch keine Buchungsgruppen eingerichtet. Ein Administrator kann dies im Systemmenü erledigen.',
- 'If you select a base unit then you also have to enter a factor.' => 'Wenn Sie eine Basiseinheit auswählen, dann müssen Sie auch einen Faktor eingeben.',
- 'If you want to change any of these parameters then press the "Back" button, edit the file "config/lx_office.conf" and login into the admin module again.' => 'Wenn Sie einen der Parameter ändern wollen, so drücken Sie auf den "Zurück"-Button, bearbeiten Sie die Datei "config/lx_office.conf", und melden Sie sich erneut im Administrationsbereich an.',
- 'If you want to delete such a dataset you have to edit the user(s) that are using the dataset in question and have them use another dataset.' => 'Wenn Sie eine solche Datenbank löschen wollen, so müssen Sie zuerst die Benutzer bearbeiten, die die fragliche Datenbank benutzen, und sie so ändern, dass sie eine andere Datenbank benutzen.',
- 'If you want to set up the authentication database yourself then log in to the administration panel. Lx-Office will then create the database and tables for you.' => 'Wenn Sie die Authentifizierungsdatenbank selber einrichten wollen, so melden Sie sich an der Administrationsoberfläche an. Lx-Office wird dann die Datenbank und die Tabellen für Sie anlegen.',
- 'If you yourself want to upgrade the installation then please read the file "doc/UPGRADE" and follow the steps outlined in this file.' => 'Wenn Sie selber die Aktualisierung bzw. Einrichtung übernehmen wollen, so lesen Sie bitte die Datei "doc/UPGRADE" und folgen Sie den dort beschriebenen Schritten.',
- 'Image' => 'Grafik',
- 'Import' => 'Import',
- 'Import CSV' => 'CSV-Import',
- 'Import file' => 'Import-Datei',
- 'Import preview' => 'Import-Vorschau',
- 'Import profiles' => 'Import-Profil',
- 'Import result' => 'Import-Ergebnis',
- 'Import summary' => 'Import-Zusammenfassung',
- 'In Lx-Office 2.4.0 the administrator has to enter a list of units in the administrative section.' => 'In Lx-Office 2.4.0 muss der Administrator in den Systemeinstellungen eine Liste von verwendbaren Einheiten angeben.',
- 'In order to do that hit the button "Delete transaction".' => 'Drücken Sie dafür auf den Button "Buchung löschen".',
- 'In the latter case the tables needed by Lx-Office will be created in that database.' => 'In letzterem Fall werden die von Lx-Office benötigten Tabellen in dieser existierenden Datenbank angelegt.',
- 'In-line' => 'im Text',
- 'Inactive' => 'Inaktiv',
- 'Include Exchangerate Difference' => 'Wechselkursunterschied einbeziehen',
- 'Include column headings' => 'Spaltenüberschriften erzeugen',
- 'Include empty bins' => 'Leere Lagerplätze anzeigen',
- 'Include in Report' => 'In Bericht aufnehmen',
- 'Include in drop-down menus' => 'In Aufklappmenü aufnehmen',
- 'Include invalid warehouses ' => 'Ungültige Lager berücksichtigen',
- 'Includeable in reports' => 'In Berichten anzeigbar',
- 'Including' => 'Enthaltene',
- 'Income Statement' => 'GuV (EÜR)',
- 'Income accno' => 'Erlöskonto',
- 'Incoming Payments' => 'Zahlungseingänge',
- 'Incoming invoice number' => 'Eingangsrechnungsnummer',
- 'Incorrect Password!' => 'Passwort falsch!',
- 'Incorrect username or password!' => 'Ungültiger Benutzername oder falsches Passwort!',
- 'Increase' => 'Erhöhen',
- 'Individual Items' => 'Einzelteile',
- 'Information' => 'Information',
- 'Insert with new part number' => 'Mit neuer Artikelnummer einfügen',
- 'Interest' => 'Zinsen',
- 'Interest Rate' => 'Zinssatz',
- 'Internal Notes' => 'Interne Hinweise',
- 'International' => 'Ausland',
- 'Internet' => 'Internet',
- 'Introduction of Buchungsgruppen' => 'Einführung von Buchungsgruppen',
- 'Introduction of units' => 'Einführung von Einheiten',
- 'Inv. Duedate' => 'Rg. Fälligkeit',
- 'Invalid' => 'Ungültig',
- 'Invalid follow-up ID.' => 'Ungültige Wiedervorlage-ID.',
- 'Invalid quantity.' => 'Die Mengenangabe ist ungültig.',
- 'Invdate' => 'Rechnungsdatum',
- 'Invdate from' => 'Rechnungen von',
- 'Inventory' => 'Inventar',
- 'Inventory Account' => 'Warenbestand',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'Bevor dieses Erzeugnis als ungültig markiert werden kann, muß das Inventar auf Null sein!',
- 'Inventory quantity must be zero before you can set this part obsolete!' => 'Bevor diese Ware als ungültig markiert werden kann, muß das Inventar Null sein!',
- 'Inventory system' => 'Warenbuchungsmethode',
- 'Invno.' => 'Rg. Nr.',
- 'Invnumber' => 'Rechnungsnummer',
- 'Invnumber missing!' => 'Rechnungsnummer fehlt!',
- 'Invoice' => 'Rechnung',
- 'Invoice (one letter abbreviation)' => 'R',
- 'Invoice Date' => 'Rechnungsdatum',
- 'Invoice Date missing!' => 'Rechnungsdatum fehlt!',
- 'Invoice Duedate' => 'Fälligkeitsdatum',
- 'Invoice Number' => 'Rechnungsnummer',
- 'Invoice Number missing!' => 'Rechnungsnummer fehlt!',
- 'Invoice deleted!' => 'Rechnung gelöscht!',
- 'Invoice for fees' => 'Rechnung über Gebühren',
- 'Invoice has already been storno\'d!' => 'Diese Rechnung wurde bereits storniert.',
- 'Invoice number' => 'Rechnungsnummer',
- 'Invoice total' => 'Die Rechnungssumme',
- 'Invoice total less discount' => 'Rechnungssumme abzüglich Skonto',
- 'Invoice with Storno (abbreviation)' => 'R(S)',
- 'Invoices' => 'Rechnungen',
- 'Is Searchable' => 'Durchsuchbar',
- 'Is this a summary account to record' => 'Buchungskonto in',
- 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => 'Auch nach einer Korrektur kann es mit dieser Buchung noch weitere Probleme geben (z.B. nicht zum Steuerschlüssel passende Steuern), weshalb ein erneutes Ausführen der Hauptbuchanalyse empfohlen wird.',
- 'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => 'Es ist möglich, dies für einige, aber nicht für alle Buchungsgruppen automatisch zu erledigen.',
- 'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => 'Das ist für einige Einheiten automatisch möglich, aber bei anderen muss der Benutzer die neue Einheit auswählen.',
- 'It may optionally be compressed with "gzip".' => 'Sie darf optional mit "gzip" komprimiert sein.',
- 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => 'Es wird einfach die Steuerschlüssel auf 0 setzen, was "keine Steuer" bedeutet und für solche Warenbestandsbuchungen der richtige Wert ist.',
- 'Item deleted!' => 'Artikel gelöscht!',
- 'Item not on file!' => 'Dieser Artikel ist nicht in der Datenbank!',
- 'Jahresverkehrszahlen neu' => 'Jahresverkehrszahlen neu',
- 'Jan' => 'Jan',
- 'January' => 'Januar',
- 'Journal' => 'Buchungsjournal',
- 'Jul' => 'Jul',
- 'July' => 'Juli',
- 'Jump to' => 'Springe zu',
- 'Jun' => 'Jun',
- 'June' => 'Juni',
- 'KNE-Export erfolgreich!' => 'KNE-Export erfolgreich!',
- 'KNr. beim Kunden' => 'KNr. beim Kunden',
- 'Keine Suchergebnisse gefunden!' => 'Keine Suchergebnisse gefunden!',
- 'Konten' => 'Konten',
- 'L' => 'L',
- 'LIABILITIES' => 'PASSIVA',
- 'LP' => 'LP',
- 'LaTeX Templates' => 'LaTeX-Vorlagen',
- 'Landscape' => 'Querformat',
- 'Language' => 'Sprache',
- 'Language (database ID)' => 'Sprache (Datenbank-ID)',
- 'Language (name)' => 'Sprache (Name)',
- 'Language Values' => 'Sprachübersetzungen',
- 'Language deleted!' => 'Sprache gelöscht!',
- 'Language missing!' => 'Sprache fehlt!',
- 'Language saved!' => 'Sprache gespeichert!',
- 'Languages' => 'Sprachen',
- 'Last Article Number' => 'Letzte Artikelnummer',
- 'Last Cost' => 'Einkaufspreis',
- 'Last Credit Note Number' => 'Letzte Gutschriftnummer',
- 'Last Customer Number' => 'Letzte Kundennummer',
- 'Last Invoice Number' => 'Letzte Rechnungsnummer',
- 'Last Purchase Delivery Order Number' => 'Letzte Lieferscheinnummer (Einkauf)',
- 'Last Purchase Order Number' => 'Letzte Lieferantenautragsnummer',
- 'Last RFQ Number' => 'Letzte Anfragenummer',
- 'Last Sales Delivery Order Number' => 'Letzte Lieferscheinnummer (Verkauf)',
- 'Last Sales Order Number' => 'Letzte Auftragsnummer',
- 'Last Sales Quotation Number' => 'Letzte Angebotsnummer',
- 'Last Service Number' => 'Letzte Dienstleistungsnr.',
- 'Last Transaction' => 'Letzte Buchung',
- 'Last Vendor Number' => 'Letzte Lieferantennummer',
- 'Lead' => 'Kundenquelle',
- 'Leave host and port field empty unless you want to make a remote connection.' => 'Für lokale Verbindungen "Rechner" und "Port" freilassen.',
- 'Left' => 'Links',
- 'Liability' => 'Passiva/Mittelherkunft',
- 'Limit part selection' => 'Artikelauswahl eingrenzen',
- 'Line Total' => 'Zeilensumme',
- 'Line and column' => 'Zeile und Spalte',
- 'Line endings' => 'Zeilenumbrüche',
- 'List' => 'Anzeigen',
- 'List Accounting Groups' => 'Buchungsgruppen anzeigen',
- 'List Accounts' => 'Konten anzeigen',
- 'List Businesses' => 'Kunden-/Lieferantentypen anzeigen',
- 'List Departments' => 'Abteilungen anzeigen',
- 'List Groups' => 'Warengruppen anzeigen',
- 'List Languages' => 'Sprachen anzeigen',
- 'List Lead' => 'Kundenquelle anzeigen',
- 'List Payment Terms' => 'Zahlungskonditionen anzeigen',
- 'List Price' => 'Listenpreis',
- 'List Price Factors' => 'Preisfaktoren anzeigen',
- 'List Pricegroups' => 'Preisgruppen anzeigen',
- 'List Transactions' => 'Buchungsliste',
- 'List Warehouses' => 'Lager anzeigen',
- 'List bank accounts' => 'Bankkonten anzeigen',
- 'List export' => 'Export anzeigen',
- 'List of bank accounts' => 'Liste der Bankkonten',
- 'List of bank collections' => 'Bankeinzugsliste',
- 'List of bank transfers' => 'Überweisungsliste',
- 'List of custom variables' => 'Erweiterte Datenfelder verwalten',
- 'List open SEPA exports' => 'Noch nicht ausgeführte SEPA-Exporte anzeigen',
- 'Load draft' => 'Entwurf laden',
- 'Load profile' => 'Profil laden',
- 'Local Tax Office Preferences' => 'Angaben zum Finanzamt',
- 'Lock System' => 'System sperren',
- 'Lockfile created!' => 'System gesperrt!',
- 'Lockfile removed!' => 'System entsperrt!',
- 'Login' => 'Anmelden',
- 'Login Name' => 'Benutzer',
- 'Login name missing!' => 'Benutzer - Feld darf nicht leer sein!',
- 'Login of User' => 'Login',
- 'Logout' => 'Abmelden',
- 'Logout now' => 'Lx-Office jetzt verlassen',
- 'Long Dates' => 'Lange Monatsnamen',
- 'Long Description' => 'Langtext',
- 'Lx-Office' => 'Lx-Office',
- 'Lx-Office 2.4.0 introduces two new concepts: tax zones and Buchungsgruppen.' => 'Lx-Office 2.4.0 führt zwei neue Konzepte ein: Steuerzonen und Buchungsgruppen.',
- 'Lx-Office Homepage' => 'Infos zu Lx-Office',
- 'Lx-Office can fix these problems automatically.' => 'Lx-Office kann solche Probleme automatisch beheben.',
- 'Lx-Office has been switched to group-based access restrictions.' => 'Lx-Office wurde auf eine gruppenbasierte Benutzerzugriffsverwaltung umgestellt.',
- 'Lx-Office has found one or more problems in the general ledger.' => 'Lx-Office hat ein oder mehrere Probleme im Hauptbuch gefunden.',
- 'Lx-Office is about to update the database [ #1 ].' => 'Lx-Office wird gleich die Datenbank [ #1 ] aktualisieren.',
- 'Lx-Office is now able to manage warehouses instead of just tracking the amount of goods in your system.' => 'Lx-Office enthält jetzt auch echte Lagerverwaultung anstatt reiner Mengenzählung.',
- 'Lx-Office needs to update the authentication database before you can proceed.' => 'Lx-Office muss die Authentifizierungsdatenbank aktualisieren, bevor Sie fortfahren können.',
- 'Lx-Office will then update the database automatically.' => 'Lx-Office wird die Datenbank daraufhin automatisch aktualisieren.',
- 'MAILED' => 'Gesendet',
- 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' => 'Ihr Browser kann leider keine eingebetteten Frames anzeigen. Bitte wählen Sie ein anderes Menü in der Benutzerkonfiguration im Administrationsmenü aus.',
- 'Main Preferences' => 'Grundeinstellungen',
- 'Main sorting' => 'Hauptsortierung',
- 'Make' => 'Lieferant',
- 'Make (with X being a number)' => 'Lieferant (X ist eine fortlaufende Zahl)',
- 'Make default profile' => 'Zu Standardprofil machen',
- 'Manage Custom Variables' => 'Erweiterte Datenfelder',
- 'Mandantennummer' => 'Mandantennummer',
- 'Mandatory Departments' => 'Benutzer muss Abteilungen vergeben',
- 'Mar' => 'März',
- 'March' => 'März',
- 'Margepercent' => 'Ertrag prozentual',
- 'Margetotal' => 'Ertrag',
- 'Margins' => 'Seitenränder',
- 'Mark as closed' => 'Abschließen',
- 'Mark as paid?' => 'Als bezahlt markieren?',
- 'Mark as shop article if column missing' => 'Als Shopartikel setzen, falls Spalte nicht vorhanden',
- 'Mark closed' => 'Als geschlossen markieren',
- 'Marked as paid' => 'Als bezahlt markiert',
- 'Marked entries printed!' => 'Markierte Einträge wurden gedruckt!',
- 'Master Data' => 'Stammdaten',
- 'Max. Dunning Level' => 'höchste Mahnstufe',
- 'May' => 'Mai',
- 'May ' => 'Mai',
- 'May set the BCC field when sending emails' => 'Beim Verschicken von Emails das Feld \'BCC\' setzen',
- 'Meaning' => 'Bedeutung',
- 'Medium Number' => 'Datenträgernummer',
- 'Memo' => 'Memo',
- 'Menu' => 'Menü',
- 'Message' => 'Nachricht',
- 'Method' => 'Verfahren',
- 'Microfiche' => 'Mikrofilm',
- 'Minimum Amount' => 'Mindestbetrag',
- 'Miscellaneous' => 'Verschiedenes',
- 'Missing \'description\' field.' => 'Fehlendes Feld \'description\'.',
- 'Missing \'tag\' field.' => 'Fehlendes Feld \'tag\'.',
- 'Missing Method!' => 'Fehlender Voranmeldungszeitraum',
- 'Missing Tax Authoritys Preferences' => 'Fehlende Angaben zum Finanzamt!',
- 'Missing amount' => 'Fehlbetrag',
- 'Missing parameter #1 in call to sub #2.' => 'Fehlernder Parameter \'#1\' in Funktionsaufruf \'#2\'.',
- 'Missing parameter (at least one of #1) in call to sub #2.' => 'Fehlernder Parameter (mindestens einer aus \'#1\') in Funktionsaufruf \'#2\'.',
- 'Missing taxkeys in invoices with taxes.' => 'Fehlende Steuerschlüssel in Rechnungen mit Steuern',
- 'Missing user id!' => 'Benutzer ID fehlt!',
- 'Mitarbeiter' => 'Mitarbeiter',
- 'Mixed (requires column "type")' => 'Gemischt (erfordert Spalte "type")',
- 'Mobile' => 'Mobiltelefon',
- 'Mobile1' => 'Mobil 1',
- 'Mobile2' => 'Mobil 2',
- 'Model' => 'Lieferanten-Art-Nr.',
- 'Model (with X being a number)' => 'Lieferanten-Art-Nr. (X ist eine fortlaufende Zahl)',
- 'Module' => 'Modul',
- 'Module home page' => 'Modul-Webseite',
- 'Module name' => 'Modulname',
- 'Monat' => 'Monat',
- 'Monthly' => 'monatlich',
- 'More than one #1 found matching, please be more specific.' => 'Mehr als ein #1 wurde gefunden, bitte geben Sie den Namen genauer an.',
- 'More than one control file with the tag \'%s\' exist.' => 'Es gibt mehr als eine Kontrolldatei mit dem Tag \'%s\'.',
- 'Multi mode not supported.' => 'Multimodus wird nicht unterstützt.',
- 'Multibyte Encoding' => 'Zeichenkodierung',
- 'MwSt. inkl.' => 'MwSt. inkl.',
- 'Name' => 'Name',
- 'Name missing!' => 'Name fehlt!',
- 'National' => 'Inand',
- 'National Expenses' => 'Aufwand Inland',
- 'National Revenues' => 'Erlöse Inland',
- 'Net amount' => 'Nettobetrag',
- 'Netto Terms' => 'Zahlungsziel netto',
- 'New Buchungsgruppe #1' => 'Neue Buchungsgruppe #1',
- 'New Templates' => 'Erzeuge Vorlagen, Name',
- 'New Win/Tab' => 'Neues Fenster',
- 'New assembly' => 'Neues Erzeugnis',
- 'New bank account' => 'Neues Bankkonto',
- 'New contact' => 'Neuer Ansprechpartner',
- 'New customer' => 'Neuer Kunde',
- 'New invoice' => 'Neue Rechnung',
- 'New part' => 'Neue Ware',
- 'New sales order' => 'Neuer Auftrag',
- 'New service' => 'Neue Dienstleistung',
- 'New shipto' => 'Neue Lieferadresse',
- 'New unit' => 'Neue Einheit',
- 'New vendor' => 'Neuer Lieferant',
- 'Next Dunning Level' => 'Nächste Mahnstufe',
- 'No' => 'Nein',
- 'No %s was found matching the search parameters.' => 'Es wurde kein %s gefunden, auf den die Suchparameter zutreffen.',
- 'No Company Address given' => 'Keine Firmenadresse hinterlegt!',
- 'No Company Name given' => 'Kein Firmenname hinterlegt!',
- 'No Customer was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Endkunde gefunden',
- 'No Database Drivers available!' => 'Kein Datenbanktreiber verfügbar!',
- 'No Dataset selected!' => 'Keine Datenbank ausgewählt!',
- 'No Vendor was found matching the search parameters.' => 'Zu dem Suchbegriff wurde kein Händler gefunden',
- 'No action defined.' => 'Keine Aktion definiert.',
- 'No backup file has been uploaded.' => 'Es wurde keine Sicherungsdatei hochgeladen.',
- 'No bank information has been entered in this customer\'s master data entry. You cannot create bank collections unless you enter bank information.' => 'Für diesen Kunden wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
- 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => 'Für diesen Lieferanten wurden in seinen Stammdaten keine Kontodaten hinterlegt. Solange dies nicht geschehen ist, können Sie keine Überweisungen für den Lieferanten anlegen.',
- 'No bins have been added to this warehouse yet.' => 'Es wurden zu diesem Lager noch keine Lagerplätze angelegt.',
- 'No business has been created yet.' => 'Es wurden noch kein Kunden-/Lieferantentyp erfasst.',
- 'No contact selected to delete' => 'Kein Ansprechpartner zum Löschen ausgewählt',
- 'No customer has been selected yet.' => 'Es wurde noch kein Kunde ausgewählt.',
- 'No data was found.' => 'Es wurden keine Daten gefunden.',
- 'No databases have been found on this server.' => 'Auf diesem Server wurden keine Datenbanken gefunden.',
- 'No datasets have been selected.' => 'Es wurden keine Datenbanken ausgewählt.',
- 'No department has been created yet.' => 'Es wurde noch keine Abteilung erfasst.',
- 'No dunnings have been selected for printing.' => 'Es wurden keine Mahnungen zum Drucken ausgewählt.',
- 'No entries were found which had no unit assigned to them.' => 'Es wurden keine Einträge gefunden, denen keine Einheit zugeordnet war.',
- 'No file has been uploaded yet.' => 'Es wurde noch keine Datei hochgeladen.',
- 'No group has been selected, or the group does not exist anymore.' => 'Es wurde keine Gruppe ausgewählt, oder die Gruppe wurde in der Zwischenzeit gelöscht.',
- 'No groups have been added yet.' => 'Es wurden noch keine Gruppen angelegt.',
- 'No or an unknown authenticantion module specified in "config/lx_office.conf".' => 'Es wurde kein oder ein unbekanntes Authentifizierungsmodul in "config/lx_office.conf" angegeben.',
- 'No part was found matching the search parameters.' => 'Es wurde kein Artikel gefunden, auf den die Suchparameter zutreffen.',
- 'No payment term has been created yet.' => 'Es wurden noch keine Zahlungsbedingungen angelegt.',
- 'No prices will be updated because no prices have been entered.' => 'Es werden keine Preise aktualisiert, weil keine gültigen Preisänderungen eingegeben wurden.',
- 'No problems were recognized.' => 'Es wurden keine Probleme gefunden.',
- 'No shipto selected to delete' => 'Keine Lieferadresse zum Löschen ausgewählt',
- 'No transaction selected!' => 'Bitte mindestens einen Haken in der Spalte "auswählen" setzen.',
- 'No transfers were executed in this export.' => 'In diesem SEPA-Export wurden keine Überweisungen ausgeführt.',
- 'No unknown units where found.' => 'Es wurden keine unbekannten Einheiten gefunden.',
- 'No valid number entered for pricegroup "#1".' => 'Für Preisgruppe "#1" wurde keine gültige Nummer eingegeben.',
- 'No vendor has been selected yet.' => 'Es wurde noch kein Lieferant ausgewählt.',
- 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => 'Es wurde noch kein Lager angelegt, bzw. die dazugehörigen Lagerplätze sind noch nicht konfiguriert.',
- 'No.' => 'Position',
- 'Non-taxable Purchases' => 'Nicht zu versteuernde Einkäufe',
- 'Non-taxable Sales' => 'Nicht zu versteuernde Verkäufe',
- 'None' => 'Kein',
- 'Not Discountable' => 'Nicht rabattierfähig',
- 'Not delivered' => 'Nicht geliefert',
- 'Not done yet' => 'Noch nicht fertig',
- 'Not obsolete' => 'Gültig',
- 'Note' => 'Hinweis',
- 'Note: Taxkeys must have a "valid from" date, and will not behave correctly without.' => 'Hinweis: Steuerschlüssel sind fehlerhaft ohne "Gültig ab" Datum',
- 'Notes' => 'Notizen',
- 'Notes (translation for #1)' => 'Bemerkungen (Übersetzung für #1)',
- 'Notes (will appear on hard copy)' => 'Hinweise (erscheinen auf Ausdruck)',
- 'Nothing has been selected for removal.' => 'Es wurde nichts für eine Entnahme ausgewählt.',
- 'Nothing has been selected for transfer.' => 'Es wurde nichts zum Umlagern ausgewählt.',
- 'Nothing selected!' => 'Es wurde nichts ausgewählt!',
- 'Nothing to delete!' => 'Es konnte nichts gelöscht werden!',
- 'Nov' => 'Nov',
- 'November' => 'November',
- 'Now the user must select a single Buchungsgruppe for each part instead of three distinct accounts.' => 'Der Benutzer muss nun für jeden Artikel nur noch die Buchungsgruppe anstelle der drei einzelnen Konten auswählen.',
- 'Number' => 'Nummer',
- 'Number Format' => 'Zahlenformat',
- 'Number missing in Row' => 'Nummer fehlt in Zeile',
- 'Number of bins' => 'Anzahl Lagerplätze',
- 'Number of copies' => 'Anzahl Kopien',
- 'Number of entries changed: #1' => 'Anzahl geänderter Einträge: #1',
- 'Number of new bins' => 'Anzahl neuer Lagerplätze',
- 'Number pages' => 'Seiten nummerieren',
- 'Number variables: \'PRECISION=n\' forces numbers to be shown with exactly n decimal places.' => 'Zahlenvariablen: Mit \'PRECISION=n\' erzwingt man, dass Zahlen mit n Nachkommastellen formatiert werden.',
- 'OB Transaction' => 'EB-Buchung',
- 'OBE-Export erfolgreich!' => 'OBE-Export erfolgreich!',
- 'Objects have been imported.' => 'Objekte wurden importiert.',
- 'Obsolete' => 'Ungültig',
- 'Oct' => 'Okt',
- 'October' => 'Oktober',
- 'Off' => 'Aus',
- 'Old (on the side)' => 'Links (HTML)',
- 'Old configuration files' => 'Alte Konfigurationsdateien',
- 'On' => 'An',
- 'On Hand' => 'Auf Lager',
- 'On Order' => 'Ist bestellt',
- 'One or more Perl modules missing' => 'Ein oder mehr Perl-Module fehlen',
- 'Only due follow-ups' => 'Nur fällige Wiedervorlagen',
- 'Oops. No valid action found to dispatch. Please report this case to the Lx-Office team.' => 'Ups. Es wurde keine gültige Funktion zum Aufrufen gefunden. Bitte berichten Sie diesen Fall den Lx-Office-Entwicklern.',
- 'Open' => 'Offen',
- 'Open Amount' => 'Offener Betrag',
- 'Open a further Lx-Office Window or Tab' => 'Neues Fenster bzw. Tab öffnen',
- 'Open amount' => 'offener Betrag',
- 'Open in new window' => 'In neuem Fenster öffnen.',
- 'Open this Website' => 'Homepage in neuem Fenster öffnen',
- 'OpenDocument/OASIS' => 'OpenDocument/OASIS',
- 'Openings' => 'Öffnungszeiten',
- 'Optional comment' => 'Optionaler Kommentar',
- 'Options' => 'Optionen',
- 'Or download the whole Installation Documentation as PDF (350kB) for off-line study (currently in German Language): ' => 'Oder laden Sie die komplette Installationsbeschreibung als PDF (350kB) herunter: ',
- 'Order' => 'Auftrag',
- 'Order Date' => 'Auftragsdatum',
- 'Order Date missing!' => 'Auftragsdatum fehlt!',
- 'Order Number' => 'Auftragsnummer',
- 'Order Number missing!' => 'Auftragsnummer fehlt!',
- 'Order deleted!' => 'Auftrag gelöscht!',
- 'Ordered' => 'Vom Kunde bestellt',
- 'Orientation' => 'Seitenformat',
- 'Orphaned' => 'Nie benutzt',
- 'Other users\' follow-ups' => 'Wiedervorlagen anderer Benutzer',
- 'Other values are ignored.' => 'Andere Eingaben werden ignoriert.',
- 'Others' => 'Andere',
- 'Otherwise all users will only have access to their own settings.' => 'Andernfalls haben alle Benutzer nur Zugriff auf ihre Einstellungen.',
- 'Otherwise the variable is only available for printing.' => 'Andernfalls steht die Variable nur beim Ausdruck zur Verfügung.',
- 'Out of balance transaction!' => 'Buchung ist nicht ausgeglichen!',
- 'Out of balance!' => 'Summen stimmen nicht berein!',
- 'Output Number Format' => 'Zahlenformat (Ausgabe)',
- 'Outputformat' => 'Ausgabeformat',
- 'Overdue sales quotations and requests for quotations' => 'Überfällige Angebote und Preisanfragen',
- 'Override invoice language' => 'Diese Sprache verwenden',
- 'PAYMENT POSTED' => 'Rechung gebucht',
- 'PDF' => 'PDF',
- 'PDF (OpenDocument/OASIS)' => 'PDF (OpenDocument/OASIS)',
- 'PDF export -- options' => 'PDF-Export -- Optionen',
- 'POSTED' => 'Gebucht',
- 'POSTED AS NEW' => 'Als neu gebucht',
- 'PRINTED' => 'Gedruckt',
- 'Packing Lists' => 'Lieferschein',
- 'Page' => '',
- 'Page #1/#2' => 'Seite #1/#2',
- 'Paid' => 'bezahlt',
- 'Part' => 'Ware',
- 'Part Description' => 'Artikelbezeichnung',
- 'Part Description missing!' => 'Artikelbezeichnung fehlt!',
- 'Part Notes' => 'Artikelbeschreibung (Langtext)',
- 'Part Number' => 'Artikelnummer',
- 'Part Number missing!' => 'Artikelnummer fehlt!',
- 'Partnumber must not be set to empty!' => 'Die Artikelnummer darf nicht auf leer geändert werden.',
- 'Partnumber not unique!' => 'Artikelnummer bereits vorhanden!',
- 'Parts' => 'Artikel',
- 'Parts Inventory' => 'Warenliste',
- 'Parts must have an entry type.' => 'Waren müssen eine Buchungsgruppe haben.',
- 'Parts with existing part numbers' => 'Artikel mit existierender Artikelnummer',
- 'Parts, services and assemblies' => 'Waren, Dienstleistungen und Erzeugnisse',
- 'Partsgroup (database ID)' => 'Warengruppe (Datenbank-ID)',
- 'Partsgroup (name)' => 'Warengruppe (Name)',
- 'Password' => 'Passwort',
- 'Payables' => 'Verbindlichkeiten',
- 'Payment' => 'Zahlungsausgang',
- 'Payment Reminder' => 'Zahlungserinnerung',
- 'Payment Terms' => 'Zahlungskonditionen',
- 'Payment Terms missing in row ' => 'Zahlungsfrist fehlt in Zeile ',
- 'Payment date missing!' => 'Tag der Zahlung fehlt!',
- 'Payment description' => 'Beschreibung der Zahlungsbedingung',
- 'Payment description detail' => 'Langtext (Detail) der Zahlungsbedingung',
- 'Payment list as PDF' => 'Zahlungsliste als PDF',
- 'Payment posted!' => 'Zahlung gebucht!',
- 'Payment terms' => 'Zahlungsbedingungen',
- 'Payment terms (database ID)' => 'Zahlungsbedingungen (Datenbank-ID)',
- 'Payment terms (name)' => 'Zahlungsbedingungen (Name)',
- 'Payments' => 'Zahlungsausgänge',
- 'Per. Inv.' => 'Wied. Rech.',
- 'Period' => 'Zeitraum',
- 'Period:' => 'Zeitraum:',
- 'Periodic Invoices' => 'Wiederkehrende Rechnungen',
- 'Periodic invoices active' => 'Wiederkehrende Rechnungen aktiv',
- 'Periodic invoices inactive' => 'Wiederkehrende Rechnungen inaktiv',
- 'Periodicity' => 'Periodizität',
- 'Personal settings' => 'Meine Daten',
- 'Pg Database Administration' => 'Datenbankadministration',
- 'Phone' => 'Telefon',
- 'Phone1' => 'Telefon 1 ',
- 'Phone2' => 'Telefon 2',
- 'Pick List' => 'Sammelliste',
- 'Please Check the bank information for each customer:' => 'Bitte überprüfen Sie die Bankinformationen der Kunden:',
- 'Please Check the bank information for each vendor:' => 'Bitte überprüfen Sie die Kontoinformationen der Lieferanten:',
- 'Please ask your administrator to create warehouses and bins.' => 'Bitten Sie Ihren Administrator, dass er Lager und Lagerplätze anlegt.',
- 'Please contact your administrator.' => 'Bitte wenden Sie sich an Ihren Administrator.',
- 'Please enter a profile name.' => 'Bitte geben Sie einen Profilnamen an.',
- 'Please enter the login for the new user.' => 'Bitte geben Sie das Login für den neuen Benutzer ein.',
- 'Please enter the name of the database that will be used as the template for the new database:' => 'Bitte geben Sie den Namen der Datenbank an, die als Vorlage für die neue Datenbank benutzt wird:',
- 'Please enter the name of the dataset you want to restore the backup in.' => 'Bitte geben Sie den Namen der Datenbank ein, in der Sie die Sicherung wiederherstellen wollen.',
- 'Please enter the sales tax identification number.' => 'Bitte geben Sie die Umsatzsteueridentifikationsnummer an.',
- 'Please enter the taxnumber in the administration menu user preferences' => 'Bitte bei den Einstellungen des aktuellen Benutzers im Administrationsmodul angeben.',
- 'Please enter values' => 'Bitte Werte eingeben',
- 'Please insert object dimensions below.' => 'Bitte geben Sie die Abmessungen unten ein',
- 'Please insert your language values below' => 'Bitte die Übersetzungen unten eintragen',
- 'Please insert your longdescription below' => 'Bitte den Langtext eingeben',
- 'Please install the below listed modules or ask your system administrator to.' => 'Bitte installieren Sie die unten aufgeführten Module, oder bitten Sie Ihren Administrator darum.',
- 'Please log in to the administration panel.' => 'Bitte melden Sie sich im Administrationsbereich an.',
- 'Please re-run the analysis for broken general ledger entries by clicking this button:' => 'Bitte wiederholen Sie die Analyse der Hauptbucheinträge, indem Sie auf diesen Button klicken:',
- 'Please read the file' => 'Bitte lesen Sie die Datei',
- 'Please select a customer from the list below.' => 'Bitte einen Endkunden aus der Liste auswählen',
- 'Please select a part from the list below.' => 'Bitte wählen Sie einen Artikel aus der Liste aus.',
- 'Please select a user' => 'Bitte wÀhlen Sie einen Benutzer aus',
- 'Please select a vendor from the list below.' => 'Bitte einen Händler aus der Liste auswählen',
- 'Please select the chart of accounts this installation is using from the list below.' => 'Bitte wählen Sie den Kontenrahmen aus, der bei dieser Installation verwendet wird.',
- 'Please select the database you want to backup' => 'Bitte wählen Sie die zu sichernde Datenbank gefunden',
- 'Please select the destination bank account for the collections:' => 'Bitte wählen Sie das Bankkonto als Ziel für die Einzüge aus:',
- 'Please select the source bank account for the transfers:' => 'Bitte wählen Sie das Bankkonto als Quelle für die Überweisungen aus:',
- 'Please seletct the dataset you want to delete:' => 'Bitte wählen Sie die zu löschende Datenbank aus:',
- 'Please specify a description for the warehouse designated for these goods.' => 'Bitte geben Sie den Namen des Ziellagers für die übernommenen Daten ein.',
- 'Please wait...' => 'Bitte warten...',
- 'Plural' => 'Plural',
- 'Port' => 'Port',
- 'Portrait' => 'Hochformat',
- 'Post' => 'Buchen',
- 'Post Payment' => 'Zahlung buchen',
- 'Post payments' => 'Zahlungen buchen',
- 'Postscript' => 'Postscript',
- 'Posustva_coa' => 'USTVA Kennz.',
- 'Preferences' => 'Einstellungen',
- 'Preferences saved!' => 'Einstellungen gespeichert!',
- 'Prefix for the new bins\' names' => 'Namenspräfix für die neuen Lagerplätze',
- 'Preis' => 'Preis',
- 'Preisklasse' => 'Preisgruppe',
- 'Prepare bank collection via SEPA XML' => 'Einzug via SEPA XML vorbereiten',
- 'Prepare bank transfer via SEPA XML' => 'Überweisung via SEPA XML vorbereiten',
- 'Prepayment' => 'Vorauszahlung',
- 'Preview' => 'Druckvorschau',
- 'Previous transdate text' => 'wurde gespeichert am',
- 'Previous transnumber text' => 'Letzte Buchung mit der Buchungsnummer',
- 'Price' => 'Preis',
- 'Price Factor' => 'Preisfaktor',
- 'Price Factors' => 'Preisfaktoren',
- 'Price factor (database ID)' => 'Preisfaktor (Datenbank-ID)',
- 'Price factor (name)' => 'Preisfaktor (Name)',
- 'Price factor deleted!' => 'Preisfaktor gelöscht.',
- 'Price factor saved!' => 'Preisfaktor gespeichert.',
- 'Price information' => '',
- 'Pricegroup' => 'Preisgruppe',
- 'Pricegroup deleted!' => 'Preisgruppe gelöscht!',
- 'Pricegroup missing!' => 'Preisgruppe fehlt!',
- 'Pricegroup saved!' => 'Preisgruppe gespeichert!',
- 'Pricegroups' => 'Preisgruppen',
- 'Print' => 'Drucken',
- 'Print and Post' => 'Drucken und Buchen',
- 'Print automatically' => 'Automatisch ausdrucken',
- 'Print dunnings' => 'Mahnungen drucken',
- 'Print list' => 'Liste ausdrucken',
- 'Print options' => 'Drucken',
- 'Printer' => 'Drucker',
- 'Printer Command' => 'Druckbefehl',
- 'Printer Command missing!' => 'Druckbefehl fehlt',
- 'Printer Management' => 'Druckeradministration',
- 'Printers are created for a user database. Please select a user. The associated database will be edited.' => 'Drucker werden fÌr eine Benutzerdatenbank erzeugt. Bitte wÀhlen Sie einen Benutzer aus. Die Drucker werden in der verknÌpften Datenbank angelegt.',
- 'Printing ... ' => 'Es wird gedruckt.',
- 'Prior to Lx-Office v2.4.0 the user could enter arbitrary strings as units for parts, services and in invoices, sales quotations etc.' => 'Vor Lx-Office 2.4.0 konnte der Benutzer bei Artikeln, Dienstleistungen und Rechnungen, Angeboten etc beliebige Einheiten angeben.',
- 'Prior to Lx-Office v2.4.0 the user had to chose the accounts for each part and service.' => 'Vor Lx-Office 2.4.0 musste der Benutzer die Konten bei jeder Ware und jeder Dienstleistung einzeln auswählen.',
- 'Private E-mail' => 'Private eMail',
- 'Private Phone' => 'Privates Tel.',
- 'Problem' => 'Problem',
- 'Produce Assembly' => 'Erzeugnis fertigen',
- 'Productivity' => 'Produktivität',
- 'Profit determination' => 'Gewinnermittlung',
- 'Proforma Invoice' => 'Proformarechnung',
- 'Program' => 'Programm',
- 'Project' => 'Projekt',
- 'Project Description' => 'Projektbeschreibung',
- 'Project Number' => 'Projektnummer',
- 'Project Number missing!' => 'Projektnummer fehlt!',
- 'Project Numbers' => 'Projektnummern',
- 'Project Transactions' => 'Projektbuchungen',
- 'Project deleted!' => 'Projekt gelöscht!',
- 'Project not on file!' => 'Dieses Projekt ist nicht in der Datenbank!',
- 'Project saved!' => 'Projekt gespeichert!',
- 'Projects' => 'Projekte',
- 'Projecttransactions' => 'Projektbuchungen',
- 'Prozentual/Absolut' => 'Prozentual/Absolut',
- 'Purchase Invoice' => 'Einkaufsrechnung',
- 'Purchase Order' => 'Lieferantenauftrag',
- 'Purchase Orders' => 'Einkaufsbestellungen',
- 'Purchase Price' => 'Einkaufspreis',
- 'Purchase Prices' => 'Einkaufspreise',
- 'Purchase delivery order' => 'Lieferschein (Einkauf)',
- 'Purchase invoices' => 'Einkaufsrechnungen',
- 'Purchase net amount' => 'EK-Summe',
- 'Purchase price' => 'EK-Preis',
- 'Purchase price total' => 'EK-Summe',
- 'Purpose' => 'Verwendungszweck',
- 'Qty' => 'Menge',
- 'Qty according to delivery order' => 'Menge laut Lieferschein',
- 'Qty in Selected Records' => 'Menge in gewählten Belegen',
- 'Qty in stock' => 'Lagerbestand',
- 'Quantity' => 'Menge',
- 'Quantity missing.' => 'Die Mengenangabe fehlt.',
- 'Quartal' => 'Quartal',
- 'Quarter' => 'Quartal',
- 'Quarterly' => 'quartalsweise',
- 'Queue' => 'Warteschlange',
- 'Quotation' => 'Angebot',
- 'Quotation Date' => 'Angebotsdatum',
- 'Quotation Date missing!' => 'Angebotsdatum fehlt!',
- 'Quotation Number' => 'Angebotsnummer',
- 'Quotation Number missing!' => 'Angebotsnummer fehlt!',
- 'Quotation deleted!' => 'Angebot wurde gelöscht.',
- 'Quotations' => 'Angebote',
- 'Quote character' => 'Anführungszeichen-Symbol',
- 'Quote chararacter' => 'Anführungszeichen',
- 'Quoted' => 'Angeboten',
- 'Quotes' => 'Doppelte Anführungszeichen',
- 'RFQ' => 'Anfrage',
- 'RFQ Date' => 'Anfragedatum',
- 'RFQ Number' => 'Anfragenummer',
- 'RFQs' => 'Preisanfragen',
- 'ROP' => 'Mindestlagerbestand',
- 'Ranges of numbers' => 'Nummernkreise',
- 'Ranges of numbers and default accounts' => 'Nummernkreise und Standardkonten',
- 'Re-run analysis' => 'Analyse wiederholen',
- 'Receipt' => 'Zahlungseingang',
- 'Receipt posted!' => 'Beleg gebucht!',
- 'Receipt, payment, reconciliation' => 'Zahlungseingang, Zahlungsausgang, Kontenabgleich',
- 'Receipts' => 'Zahlungseingänge',
- 'Receivables' => 'Forderungen',
- 'Rechnungsnummer' => 'Rechnungsnummer',
- 'Reconciliation' => 'Kontenabgleich',
- 'Record Vendor Invoice' => 'Eingangsrechnung eingeben',
- 'Record in' => 'Buchen auf',
- 'Recorded Tax' => 'Gespeicherte Steuern',
- 'Recorded taxkey' => 'Gespeicherter Steuerschlüssel',
- 'Reference' => 'Referenz',
- 'Reference missing!' => 'Referenz fehlt!',
- 'Release From Stock' => 'Lagerausgang',
- 'Remaining' => 'Rest',
- 'Remittance information prefix' => 'Verwendungszweckvorbelegung (Präfix)',
- 'Removal' => 'Entnahme',
- 'Removal from Warehouse' => 'Lagerentnahme',
- 'Removal from warehouse' => 'Entnahme aus Lager',
- 'Removal qty' => 'Entnahmemenge',
- 'Remove' => 'Entfernen',
- 'Remove Draft' => 'Entwurf löschen',
- 'Remove draft when posting' => 'Entwurf beim Buchen löschen',
- 'Removed spoolfiles!' => 'Druckdateien entfernt!',
- 'Removing marked entries from queue ...' => 'Markierte Einträge werden von der Warteschlange entfernt ...',
- 'Rename the group' => 'Gruppe umbenennen',
- 'Report Positions' => 'Berichte',
- 'Report about warehouse contents' => 'Lagerbestand anzeigen',
- 'Report about warehouse transactions' => 'Lagerbuchungen anzeigen',
- 'Report and misc. Preferences' => 'Sonstige Einstellungen',
- 'Report for' => 'Bericht für',
- 'Reports' => 'Berichte',
- 'Representative' => 'Vertreter',
- 'Reqdate' => 'Lieferdatum',
- 'Request for Quotation' => 'Anfrage',
- 'Request for Quotations' => 'Anfragen',
- 'Request quotation' => 'Preisanfrage',
- 'Requested execution date' => 'Gewünschtes Ausführungsdatum',
- 'Requested execution date from' => 'Gewünschtes Ausführungsdatum von',
- 'Requested execution date to' => 'Gewünschtes Ausführungsdatum bis',
- 'Required by' => 'Lieferdatum',
- 'Restore Dataset' => 'Datenbank wiederherstellen',
- 'Revenue' => 'Erlöskonto',
- 'Revenue Account' => 'Erlöskonto',
- 'Revenues EU with UStId' => 'Erlöse EU m. UStId',
- 'Revenues EU without UStId' => 'Erlöse EU o. UStId',
- 'Review of Aging list' => 'Altersstrukturliste',
- 'Right' => 'Rechts',
- 'SAVED' => 'Gespeichert',
- 'SAVED FOR DUNNING' => 'Gespeichert',
- 'SCREENED' => 'Angezeigt',
- 'SEPA XML download' => 'SEPA-XML-Download',
- 'SEPA creditor ID' => 'SEPA-Kreditoren-Identifikation',
- 'SEPA exports:' => 'SEPA-Exporte:',
- 'SEPA strings' => 'SEPA-Überweisungen',
- 'Saldo Credit' => 'Saldo Haben',
- 'Saldo Debit' => 'Saldo Soll',
- 'Saldo neu' => 'Saldo neu',
- 'Saldo per' => 'Saldo per',
- 'Sale Prices' => 'Verkaufspreise',
- 'Sales Invoice' => 'Rechnung',
- 'Sales Invoices' => 'Ausgangsrechnungen',
- 'Sales Order' => 'Kundenauftrag',
- 'Sales Orders' => 'Aufträge',
- 'Sales Price information' => '',
- 'Sales Report' => 'Verkaufsbericht',
- 'Sales and purchase invoices with inventory transactions with taxkeys' => 'Einkaufs- und Verkaufsrechnungen mit Warenbestandsbuchungen mit Steuerschlüsseln',
- 'Sales delivery order' => 'Lieferschein (Verkauf)',
- 'Sales invoice number' => 'Ausgangsrechnungsnummer',
- 'Sales invoices' => 'Verkaufsrechnungen',
- 'Sales margin' => 'Marge',
- 'Sales margin %' => 'Marge prozentual',
- 'Sales net amount' => 'VK-Netto',
- 'Sales price' => 'VK-Preis',
- 'Sales price total' => 'VK-Summe',
- 'Sales quotation' => 'Angebot',
- 'Salesman' => 'Verkäufer/in',
- 'Salesperson' => 'Verkäufer',
- 'Same as the quote character' => 'Wie Anführungszeichen',
- 'Sat. Fax' => 'Sat. Fax',
- 'Sat. Phone' => 'Sat. Tel.',
- 'Satz %' => 'Satz %',
- 'Save' => 'Speichern',
- 'Save Draft' => 'Entwurf speichern',
- 'Save account first to insert taxkeys' => 'Einstellungen sind nach dem Speichern des Kontos verfügbar...',
- 'Save and AP Transaction' => 'Speichern und Kreditorenbuchung erfassen',
- 'Save and AR Transaction' => 'Speichern und Debitorenbuchung erfassen',
- 'Save and Close' => 'Speichern und schließen',
- 'Save and Invoice' => 'Speichern und Rechnung erfassen',
- 'Save and Order' => 'Speichern und Auftrag erfassen',
- 'Save and Quotation' => 'Speichern und Angebot',
- 'Save and RFQ' => 'Speichern und Lieferantenanfrage',
- 'Save and close' => 'Speichern und schließen',
- 'Save as new' => 'als neu speichern',
- 'Save draft' => 'Entwurf speichern',
- 'Save profile' => 'Profil speichern',
- 'Save settings as' => 'Einstellungen speichern unter',
- 'Saving the file \'%s\' failed. OS error message: %s' => 'Das Speichern der Datei \'%s\' schlug fehl. Fehlermeldung des Betriebssystems: %s',
- 'Screen' => 'Bildschirm',
- 'Search AP Aging' => 'Offene Verbindlichkeiten',
- 'Search AR Aging' => 'Offene Forderungen',
- 'Searchable' => 'Durchsuchbar',
- 'Select' => 'auswählen',
- 'Select a Customer' => 'Endkunde auswählen',
- 'Select a customer' => 'Einen Kunden auswählen',
- 'Select a part' => 'Artikel auswählen',
- 'Select a part or assembly' => 'Artikel oder Erzeugnis auswählen',
- 'Select a period' => 'Bitte Zeitraum auswählen',
- 'Select a vendor' => 'Einen Lieferanten auswählen',
- 'Select all' => 'Alle auswählen',
- 'Select federal state...' => 'Bundesland auswählen...',
- 'Select from one of the items below' => 'Wählen Sie einen der untenstehenden Einträge',
- 'Select from one of the names below' => 'Wählen Sie einen der untenstehenden Namen',
- 'Select from one of the projects below' => 'Wählen Sie eines der untenstehenden Projekte',
- 'Select postscript or PDF!' => 'Postscript oder PDF auswählen!',
- 'Select tax office...' => 'Finanzamt auswählen...',
- 'Select the chart of accounts in use' => 'Benutzten Kontenrahmen auswählen',
- 'Select the checkboxes that match users to the groups they should belong to.' => 'Wählen Sie diejenigen Checkboxen aus, die die Benutzer zu den gewüschten Gruppen zuordnen.',
- 'Select type of removal' => 'Grund der Entnahme auswählen',
- 'Select type of transfer' => 'Grund der Umlagerung auswählen',
- 'Selected' => 'Ausgewählt',
- 'Selection' => 'Auswahlbox',
- 'Selection fields: The option field must contain the available options for the selection. Options are separated by \'##\', for example \'Early##Normal##Late\'.' => 'Auswahlboxen: Das Optionenfeld muss die für die Auswahl verfügbaren Einträge enthalten. Die Einträge werden mit \'##\' voneinander getrennt. Beispiel: \'Früh##Normal##Spät\'.',
- 'Sell Price' => 'Verkaufspreis',
- 'Sellprice' => 'Verkaufspreis',
- 'Sellprice adjustment' => 'Verkaufspreis: Preisanpassung',
- 'Sellprice for price group \'#1\'' => 'Verkaufspreis für Preisgruppe \'#1\'',
- 'Sellprice significant places' => 'Verkaufspreis: Nachkommastellen',
- 'Semicolon' => 'Semikolon',
- 'Send the backup via Email' => 'Die Sicherungsdatei per Email verschicken',
- 'Sep' => 'Sep',
- 'Separator' => 'Trennzeichen',
- 'Separator chararacter' => 'Feldtrennzeichen',
- 'September' => 'September',
- 'Serial No.' => 'Seriennummer',
- 'Serial Number' => 'Seriennummer',
- 'Service' => 'Dienstleistung',
- 'Service Items' => 'Dienstleistungen',
- 'Service Number missing!' => 'Dienstleistungsnummer fehlt!',
- 'Service unit' => 'Dienstleistungseinheit',
- 'Services' => 'Dienstleistungen',
- 'Set Language Values' => 'Spracheinstellungen',
- 'Set eMail text' => 'eMail Text eingeben',
- 'Settings' => 'Einstellungen',
- 'Setup Menu' => 'Menü-Variante',
- 'Setup Templates' => 'Vorlagen auswählen',
- 'Ship to' => 'Lieferadresse',
- 'Ship via' => 'Transportmittel',
- 'Shipping Address' => 'Lieferadresse',
- 'Shipping Point' => 'Versandort',
- 'Shipto' => 'Lieferanschriften',
- 'Shipto deleted.' => 'Lieferadresse gelöscht',
- 'Shipto is in use and was flagged invalid.' => 'Lieferadresse ist noch in Verwendung, und wurde als ungültig markiert.',
- 'Shopartikel' => 'Shopartikel',
- 'Short' => 'Knapp',
- 'Show' => 'Zeigen',
- 'Show Salesman' => 'Verkäufer anzeigen',
- 'Show TODO list' => 'Meine Aufgaben',
- 'Show by default' => 'Standardmäßig anzeigen',
- 'Show custom variable search inputs' => 'Suche in erweiterten Datenfeldern',
- 'Show details' => 'Detailsanzeige',
- 'Show follow ups...' => 'Zeige Wiedervorlagen...',
- 'Show help text' => 'Hilfetext anzeigen',
- 'Show old dunnings' => 'Alte Mahnungen anzeigen',
- 'Show overdue sales quotations and requests for quotations...' => 'Überfällige Angebote und Preisanfragen anzeigen...',
- 'Show your TODO list after loggin in' => 'Aufgabenliste nach dem Anmelden anzeigen',
- 'Signature' => 'Unterschrift',
- 'Since bin is not enforced in the parts data, please specify a bin where goods without a specified bin will be put.' => 'Da Lagerplätze kein Pflichtfeld sind, geben Sie bitte einen Lagerplatz an, in dem Waren ohne spezifizierten Lagerplatz eingelagert werden sollen.',
- 'Single quotes' => 'Einfache Anführungszeichen',
- 'Skip' => 'Überspringen',
- 'Skonto' => 'Skonto',
- 'Skonto Terms' => 'Zahlungsziel Skonto',
- 'Sold' => 'Verkauft',
- 'Solution' => 'Lösung',
- 'Sort By' => '',
- 'Source' => 'Beleg',
- 'Source BIC' => 'Quell-BIC',
- 'Source IBAN' => 'Quell-IBAN',
- 'Source bank account' => 'Quellkonto',
- 'Source bin' => 'von Lagerplatz',
- 'Space' => 'Leerzeichen',
- 'Split entry detected. The values you have entered will result in an entry with more than one position on both debit and credit. Due to known problems involving accounting software Lx-Office does not allow these.' => 'Splitbuchung! Die eingebenen Werte würden eine Buchung auslösen, die jeweils mehr als eine Position auf Soll und Haben hätte. Um Kompatibilität mit DATEV zu gewährleisten erlaubt Lx-Office keine Splitbuchungen.',
- 'Spoolfile' => 'Druckdatei',
- 'Start Dunning Process' => 'Neue Mahnung',
- 'Start analysis' => 'Analyse beginnen',
- 'Start date' => 'Startdatum',
- 'Start the correction assistant' => 'Korrekturassistenten starten',
- 'Startdate_coa' => 'Gültig ab',
- 'Starting Balance' => 'Eröffnungsbilanzwerte',
- 'Starting with Lx-Office 2.6.3 the configuration files in "config" have been consolidated.' => 'Mit Lx-Office 2.6.3 wurden die Konfigurationsdateien im Verzeichnis "config" vereinheitlicht.',
- 'Statement' => 'Sammelrechnung',
- 'Statement Balance' => 'Sammelrechnungsbilanz',
- 'Statement sent to' => 'Sammelrechnung verschickt an',
- 'Statements sent to printer!' => 'Sammelrechnungen an Drucker geschickt!',
- 'Status' => 'Status',
- 'Step 1 of 3: Parts' => 'Schritt 1 von 3: Waren',
- 'Step 2' => 'Schritt 2',
- 'Step 2 of 3: Services' => 'Schritt 2 von 3: Dienstleistungen',
- 'Step 3 of 3: Assemblies' => 'Schritt 3 von 3: Erzeugnisse',
- 'Step 3 of 3: Default units' => 'Schritt 3 von 3: Standardeinheiten',
- 'Steuersatz' => 'Steuersatz',
- 'Stock' => 'Einlagern',
- 'Stock Qty for Date' => 'Lagerbestand am',
- 'Stock value' => 'Bestandswert',
- 'Stocked Qty' => 'Lagermenge',
- 'Storno' => 'Storno',
- 'Storno (one letter abbreviation)' => 'S',
- 'Storno Invoice' => 'Stornorechnung',
- 'Street' => 'Straße',
- 'Stylesheet' => 'Erscheinungsbild',
- 'Subject' => 'Betreff',
- 'Subject:' => 'Betreff:',
- 'Subtotal' => 'Zwischensumme',
- 'Subtotal cannot distinguish betweens record types. Only one of the selected record types will be displayed: #1' => 'Zwischensummen können nicht zwischen den einzelnen Belegen unterscheiden, es wird nur "#1" angezeigt',
- 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => 'Solche Einträge sind aber nicht DATEV-exportiertbar und müssen ebenfalls korrigiert werden.',
- 'Sum Credit' => 'Summe Haben',
- 'Sum Debit' => 'Summe Soll',
- 'Sum for' => 'Summe für',
- 'Sum per' => 'Summe per',
- 'Summen- und Saldenliste' => 'Summen- und Saldenliste',
- 'Superuser name' => 'Datenbankadministrator',
- 'Supplies' => 'Lieferungen',
- 'Switch Menu on / off' => 'Menü ein- / ausklappen',
- 'System' => 'System',
- 'System currently down for maintenance!' => 'Lx-Office ist momentan zwecks Wartungsarbeiten nicht zugänglich.',
- 'TODO list' => 'Meine Aufgaben',
- 'TODO list options' => 'Aufgaben',
- 'TOP100' => 'Top 100',
- 'TOTAL' => 'TOTAL',
- 'Tab' => 'Tabulator',
- 'Target bank account' => 'Zielkonto',
- 'Target table' => 'Zieltabelle',
- 'Tax' => 'Steuer',
- 'Tax Consultant' => 'Steuerberater/-in',
- 'Tax Included' => 'Steuer im Preis inbegriffen',
- 'Tax Number' => 'Steuernummer',
- 'Tax Number / SSN' => 'Steuernummer',
- 'Tax Office' => 'Finanzamt',
- 'Tax Office Preferences' => 'Finanzamt - Einstellungen',
- 'Tax Percent is a number between 0 and 100' => 'Prozentsatz muss zwischen
- 1% und 100% liegen',
- 'Tax Period' => 'Voranmeldungszeitraum',
- 'Tax Position' => 'Position',
- 'Tax collected' => 'vereinnahmte Steuer',
- 'Tax deleted!' => 'Steuer gelöscht!',
- 'Tax number' => 'Steuernummer',
- 'Tax paid' => 'Vorsteuer',
- 'Tax saved!' => 'Steuer gespeichert!',
- 'Tax-O-Matic' => 'Steuer',
- 'Tax-o-matic Account' => 'Automatikbuchung auf Konto',
- 'Taxaccount_coa' => 'Automatikkonto',
- 'Taxation' => 'Versteuerungs Verfahren',
- 'Taxdescription missing!' => 'Steuername fehlt!',
- 'Taxdescription_coa' => 'Steuer',
- 'Taxes' => 'Steuern',
- 'Taxkey' => 'Steuerschlüssel',
- 'Taxkey missing!' => 'Steuerschlüssel fehlt!',
- 'Taxkey_coa' => 'Steuerschlüssel',
- 'Taxkeys and Taxreport Preferences' => 'Steuerautomatik und UStVA',
- 'Taxlink_coa' => 'Steuerautomatik',
- 'Taxnumber' => 'Steuernummer',
- 'Taxrate missing!' => 'Prozentsatz fehlt!',
- 'Tel' => 'Tel',
- 'Tel.' => 'Telefon',
- 'Telephone' => 'Telefon',
- 'Template' => 'Druckvorlage',
- 'Template Code' => 'Vorlagenkürzel',
- 'Template Code missing!' => 'Vorlagenkürzel fehlt!',
- 'Template database' => 'Datenbankvorlage',
- 'Templates' => 'Vorlagen',
- 'Terms missing in row ' => '+Tage fehlen in Zeile ',
- 'Test and preview' => 'Test und Vorschau',
- 'Test connection' => 'Verbindung testen',
- 'Text field' => 'Textfeld',
- 'Text field variables: \'WIDTH=w HEIGHT=h\' sets the width and height of the text field. They default to 30 and 5 respectively.' => 'Textfelder: \'WIDTH=w HEIGHT=h\' setzen die Breite und die Höhe des Textfeldes. Wenn nicht anders angegeben, so werden sie 30 Zeichen breit und fünf Zeichen hoch dargestellt.',
- 'Text variables: \'MAXLENGTH=n\' sets the maximum entry length to \'n\'.' => 'Textzeilen: \'MAXLENGTH=n\' setzt eine Maximallänge von n Zeichen.',
- 'Text, text field and number variables: The default value will be used as-is.' => 'Textzeilen, Textfelder und Zahlenvariablen: Der Standardwert wird so wie er ist übernommen.',
- 'That export does not exist.' => 'Dieser Export existiert nicht.',
- 'The \'tag\' field must only consist of alphanumeric characters or the carachters - _ ( )' => 'Das Feld \'tag\' darf nur aus alphanumerischen Zeichen und den Zeichen - _ ( ) bestehen.',
- 'The AP transaction #1 has been deleted.' => 'Die Kreditorenbuchung #1 wurde gelöscht.',
- 'The AR transaction #1 has been deleted.' => 'Die Debitorenbuchung #1 wurde gelöscht.',
- 'The GL transaction #1 has been deleted.' => 'Die Dialogbuchung #1 wurde gelöscht.',
- 'The LDAP server "#1:#2" is unreachable. Please check config/lx_office.conf.' => 'Der LDAP-Server "#1:#2" ist nicht erreichbar. Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
- 'The SEPA export has been created.' => 'Der SEPA-Export wurde erstellt',
- 'The SEPA strings have been saved.' => 'Die bei SEPA-Überweisungen verwendeten Begriffe wurden gespeichert.',
- 'The access rights have been saved.' => 'Die Zugriffsrechte wurden gespeichert.',
- 'The account 3804 already exists, the update will be skipped.' => 'Das Konto 3804 existiert schon, das Update wird ÃŒbersprungen.',
- 'The account 3804 will not be added automatically.' => 'Das Konto 3804 wird nicht automatisch hinzugefÃŒgt.',
- 'The application "#1" was not found on the system.' => 'Die Anwendung "#1" wurde auf dem System nicht gefunden.',
- 'The assembly has been created.' => 'Das Erzeugnis wurde hergestellt.',
- 'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => 'Der Korrekturassistent konnte kein Problem bei #1 feststellen. Eventuell wurde das Problem in der Zwischenzeit bereits behoben.',
- 'The authentication configuration file "config/lx_office.conf" does not exist. This Lx-Office installation has probably not been updated correctly yet. Please contact your administrator.' => 'Die Konfigurationsdatei für die Authentifizierung "config/lx_office.conf" wurde nicht gefunden. Diese Lx-Office-Installation wurde vermutlich noch nicht vollständig aktualisiert oder eingerichtet. Bitte wenden Sie sich an Ihren Administrator.',
- 'The authentication database is not reachable at the moment. Either it hasn\'t been set up yet or the database server might be down. Please contact your administrator.' => 'Die Authentifizierungsdatenbank kann momentan nicht erreicht werden. Entweder wurde sie noch nicht eingerichtet, oder der Datenbankserver antwortet nicht. Bitte wenden Sie sich an Ihren Administrator.',
- 'The available options depend on the varibale type:' => 'Die verfügbaren Optionen hängen vom Datenfeldtypen ab:',
- 'The backup you upload here has to be a file created with "pg_dump -o -Ft".' => 'Die von Ihnen hochzuladende Sicherungsdatei muss mit dem Programm und den Parametern "pg_dump -o -Ft" erstellt worden sein.',
- 'The bank information must not be empty.' => 'Die Bankinformationen müssen vollständig ausgefüllt werden.',
- 'The base unit does not exist or it is about to be deleted in row %d.' => 'Die Basiseinheit in Zeile %d existiert nicht oder soll gelöscht werden.',
- 'The base unit does not exist.' => 'Die Basiseinheit existiert nicht.',
- 'The base unit relations must not contain loops (e.g. by saying that unit A\'s base unit is B, B\'s base unit is C and C\'s base unit is A) in row %d.' => 'Die Beziehungen der Einheiten dürfen keine Schleifen beinhalten (z.B. wenn gesagt wird, dass Einheit As Basiseinheit B, Bs Basiseinheit C und Cs Basiseinheit A ist) in Zeile %d.',
- 'The business has been created.' => 'Der Kunden-/Lieferantentyp wurde erfasst.',
- 'The business has been deleted.' => 'Der Kunden-/Lieferantentyp wurde gelöscht.',
- 'The business has been saved.' => 'Der Kunden-/Lieferantentyp wurde gespeichert.',
- 'The business is in use and cannot be deleted.' => 'Der Kunden-/Lieferantentyp wird benutzt und kann nicht gelöscht werden.',
- 'The changing of tax-o-matic account is NOT recommended, but if you do so please also (re)configure buchungsgruppen and reconfigure ALL charts which point to this tax-o-matic account. ' => 'Es wird nicht empfohlen Steuerkonten (Umsatzsteuer oder Vorsteuer) "umzuhängen", aber falls es gemacht wird, bitte auch entsprechend konsequent die Buchungsgruppen und die Konten die mit dieser Steuer verknüpft sind umkonfigurieren.',
- 'The columns "Dunning Duedate", "Total Fees" and "Interest" show data for the previous dunning created for this invoice.' => 'Die Spalten "Zahlbar bis", "Kumulierte Gebühren" und "Zinsen" zeigen Daten der letzten für diese Rechnung erzeugten Mahnung.',
- 'The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/lx_office.conf.' => 'Die Verbindung zum LDAP-Server kann nicht verschlüsselt werden (Fehler bei SSL/TLS-Initialisierung). Bitte überprüfen Sie die Angaben in config/lx_office.conf.',
- 'The connection to the authentication database failed:' => 'Die Verbindung zur Authentifizierungsdatenbank schlug fehl:',
- 'The connection to the database could not be established.' => 'Die Verbindung zur Datenbank konnte nicht hergestellt werden.',
- 'The connection to the template database failed:' => 'Die Verbindung zur Vorlagendatenbank schlug fehl:',
- 'The connection was established successfully.' => 'Die Verbindung zur Datenbank wurde erfolgreich hergestellt.',
- 'The creation of the authentication database failed:' => 'Das Anlegen der Authentifizierungsdatenbank schlug fehl:',
- 'The custom variable has been deleted.' => 'Das Datenfeld wurde gelöscht.',
- 'The custom variable has been saved.' => 'Das Datenfeld wurde gespeichert.',
- 'The database #1 has been successfully deleted.' => 'Die Datenbank #1 wurde erfolgreich gelöscht.',
- 'The database for user management and authentication does not exist. You can create let Lx-Office create it with the following parameters:' => 'Die Datenbank zur Verwaltung der Benutzerdaten und zur Authentifizierung existiert nicht. Sie können Lx-Office diese Datenbank mit den folgenden Parametern anlegen lassen:',
- 'The database update/creation did not succeed. The file #1 contained the following error:' => 'Die Datenbankaktualisierung/erstellung schlug fehl. Die Datei #1 enthielt den folgenden Fehler:',
- 'The database upgrade for the introduction of Buchungsgruppen is now complete.' => 'Das Datenbankupgrade für die Einführung von Buchungsgruppen ist jetzt beendet.',
- 'The database upgrade for the introduction of units is now complete.' => 'Das Datenbankupgrade zwecks Einführung von Einheiten ist nun beendet.',
- 'The dataset #1 has been successfully created.' => 'Die Datenbank #1 wurde erfolgreich angelegt.',
- 'The dataset backup has been sent via email to #1.' => 'Die Datenbanksicherung wurde per Email an #1 verschickt.',
- 'The dataset has to exist before a restoration can be started.' => 'Die Datenbank muss vor der Wiederherstellung bereits angelegt worden sein.',
- 'The dataset name is missing.' => 'Der Datenbankname fehlt.',
- 'The deductible amount' => 'Der abziehbare Skontobetrag',
- 'The default value depends on the variable type:' => 'Die Bedeutung des Standardwertes hängt vom Datenfeldtypen ab:',
- 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => 'Der Lieferschein wurde nicht als geliefert markiert. Der Lagerinhalt wurde nicht verändert.',
- 'The department has been created.' => 'Die Abteilung wurde angelegt.',
- 'The department has been deleted.' => 'Die Abteiltung wurde gelöscht.',
- 'The department has been saved.' => 'Die abteilung wurde gespeichert.',
- 'The department is in use and cannot be deleted.' => 'Die Abteilung wird benutzt und kann nicht gelöscht werden.',
- 'The description is missing.' => 'Die Beschreibung fehlt.',
- 'The description is shown on the form. Chose something short and descriptive.' => 'Die Beschreibung wird in der jeweiligen Maske angezeigt. Sie sollte kurz und prägnant sein.',
- 'The directory "%s" could not be created:\n%s' => 'Das Verzeichnis "%s" konnte nicht erstellt werden:\n%s',
- 'The directory %s does not exist.' => 'Das Verzeichnis %s existiert nicht.',
- 'The discount in percent' => 'Der prozentuale Rabatt',
- 'The discount must be less than 100%.' => 'Der Rabatt muss kleiner als 100% sein.',
- 'The discount must not be negative.' => 'Der Rabatt darf nicht negativ sein.',
- 'The dunning process started' => 'Der Mahnprozess ist gestartet.',
- 'The dunnings have been printed.' => 'Die Mahnung(en) wurden gedruckt.',
- 'The email address is missing.' => 'Die Emailadresse fehlt.',
- 'The end date is the last day for which invoices will possibly be created.' => 'Das Enddatum ist das letztmögliche Datum, an dem eine Rechnung erzeugt wird.',
- 'The factor is missing in row %d.' => 'Der Faktor fehlt in Zeile %d.',
- 'The factor is missing.' => 'Der Faktor fehlt.',
- 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => 'Zum Einen gab es einen Bug in Lx-Office, der dazu führte, dass bei Buchungen mit verschiedenen Steuerschlüssel auf ein Konto teilweise falsche Steuerschlüssel gespeichert wurden.',
- 'The follow-up date is missing.' => 'Das Wiedervorlagedatum fehlt.',
- 'The following Buchungsgruppen have already been created:' => 'Die folgenden Buchungsgruppen wurden bereits angelegt:',
- 'The following Datasets need to be updated' => 'Folgende Datenbanken müssen aktualisiert werden',
- 'The following drafts have been saved and can be loaded.' => 'Die folgenden Entwürfe wurden gespeichert und können geladen werden.',
- 'The following old files whose settings have to be merged manually into the new configuration file "config/lx_office.conf" still exist:' => 'Es existieren noch die folgenden alten Dateien, deren Einstellungen manuell in die neue Konfiguratsdatei "config/lx_office.conf" migriert werden müssen:',
- 'The following transaction contains wrong taxes:' => 'Die folgende Buchung enthält falsche Steuern:',
- 'The following transaction contains wrong taxkeys:' => 'Die folgende Buchung enthält falsche Steuerschlüssel:',
- 'The following units are unknown.' => 'Die folgenden Einheiten sind unbekannt.',
- 'The following units exist already:' => 'Die folgenden Einheiten existieren bereits:',
- 'The following users have been migrated into the authentication database:' => 'Die folgenden Benutzer wurden in die Authentifizierungsdatenbank migriert:',
- 'The following warnings occured during an upgrade to the document templates:' => 'Die folgenden Warnungen traten während einer Aktualisierung der Dokumentenvorlagen auf:',
- 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => 'Die Formeln müssen in der folgenden Syntax eingegeben werden:<br>Bei normalen Artikeln:<br>Variablenname = Variable Einheit;<br>Variablenname2 = Variable2 Einheit2;<br>...<br>###<br>Variable + Variable2 * ( Variable - Variable2 )<br>Variablennamen und Einheiten dürfen nur aus alphanumerischen Zeichen bestehen.<br>Es muss jeweils die Gesamte Zeile eingegeben werden',
- 'The greetings have been saved.' => 'Die Anreden wurden gespeichert',
- 'The group has been added.' => 'Die neue Gruppe wurde angelegt.',
- 'The group has been deleted.' => 'Die Gruppe wurde gelöscht.',
- 'The group has been saved.' => 'Die Gruppe wurde gespeichert.',
- 'The group memberships have been saved.' => 'Die Gruppenmitgliedschaften wurden gespeichert.',
- 'The group name is missing.' => 'Der Gruppenname fehlt.',
- 'The list has been printed.' => 'Die Liste wurde ausgedruckt.',
- 'The long description is missing.' => 'Der Langtext fehlt.',
- 'The name in row %d has already been used before.' => 'Der Name in Zeile %d wurde vorher bereits benutzt.',
- 'The name is missing in row %d.' => 'Der Name fehlt in Zeile %d.',
- 'The name is missing.' => 'Der Name fehlt.',
- 'The name must only consist of letters, numbers and underscores and start with a letter.' => 'Der Name darf nur aus Buchstaben (keine Umlaute), Ziffern und Unterstrichen bestehen und muss mit einem Buchstaben beginnen.',
- 'The number of days for full payment' => 'Die Anzahl Tage, bis die Rechnung in voller Höhe bezahlt werden muss',
- 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => 'Die alte Datei mit den Benutzerdaten existiert in dieser Installation noch immer ("#1"). Wollen Sie diese Benutzer in die neue Authentifizierungsdatenbank migrieren lassen? Falls nicht, so werden Sie sich nicht mehr mit den Benutzerdaten aus der alten Mitgliedsdatei anmelden können.',
- 'The option field is empty.' => 'Das Optionsfeld ist leer.',
- 'The parts for this delivery order have already been transferred in.' => 'Die Artikel dieses Lieferscheins wurden bereits eingelagert.',
- 'The parts for this delivery order have already been transferred out.' => 'Die Artikel dieses Lieferscheins wurden bereits ausgelagert.',
- 'The parts have been removed.' => 'Die Waren wurden aus dem Lager entnommen.',
- 'The parts have been stocked.' => 'Die Artikel wurden eingelagert.',
- 'The parts have been transferred.' => 'Die Waren wurden umgelagert.',
- 'The password is too long (maximum length: #1).' => 'Das Passwort ist zu lang (maximale Länge: #1).',
- 'The password is too short (minimum length: #1).' => 'Das Password ist zu kurz (minimale Länge: #1).',
- 'The password is weak (e.g. it can be found in a dictionary).' => 'Das Passwort ist schwach (z.B. wenn es in einem Wörterbuch steht).',
- 'The payment term has been created.' => 'Die Zahlungsbedingungen wurden angelegt.',
- 'The payment term has been deleted.' => 'Die Zahlungsbedingungen wurden gelöscht.',
- 'The payment term has been saved.' => 'Die Zahlungsbedingungen wurden gespeichert.',
- 'The payment term is in use and cannot be deleted.' => 'Die Zahlungsbedingungen werden bereits benutzt und können nicht gelöscht werden.',
- 'The payments have been posted.' => 'Die Zahlungen wurden gebucht.',
- 'The pg_dump process could not be started.' => 'Der pg_dump-Prozess konnte nicht gestartet werden.',
- 'The pg_restore process could not be started.' => 'Der pg_restore-Prozess konnte nicht gestartet werden.',
- 'The preferred one is to install packages provided by your operating system distribution (e.g. Debian or RPM packages).' => 'Die bevorzugte Art, ein Perl-Modul zu installieren, ist durch Installation eines von Ihrem Betriebssystem zur Verfügung gestellten Paketes (z.B. Debian-Pakete oder RPM).',
- 'The profile \'#1\' has been deleted.' => 'Das Profil \'#1\' wurde gelöscht.',
- 'The profile has been saved under the name \'#1\'.' => 'Das Profil wurde unter dem Namen \'#1\' gespeichert.',
- 'The program\'s exit code was #1 ("0" usually means that everything went OK).' => 'Der Exitcode des Programms war #1 ("0" bedeutet normalerweise, dass die Wiederherstellung erfolgreich war).',
- 'The project has been added.' => 'Das neue Projekt wurde angelegt.',
- 'The project has been saved.' => 'Das Projekt wurde gespeichert.',
- 'The restoration process has started. Here\'s the output of the "pg_restore" command:' => 'Der Wiederherstellungsprozess wurde gestartet. Hier ist die Ausgabe des "pg_restore"-Programmes:',
- 'The restoration process is complete. Please review "pg_restore"\'s output to find out if the restoration was successful.' => 'Die Wiederherstellung ist abgeschlossen. Bitte sehen Sie sich die Ausgabe von "pg_restore" an, um festzustellen, ob die Wiederherstellung erfolgreich war.',
- 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => 'Zum Anderen war es möglich, die Steuern unabhängig vom ausgewählten Steuerschlüssel selber einzugeben.',
- 'The second way is to use Perl\'s CPAN module and let it download and install the module for you.' => 'Die zweite Variante besteht darin, Perls CPAN-Modul zu benutzen und es das Modul für Sie installieren zu lassen.',
- 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Die ausgewählte PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Deshalb müssen Sie Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
- 'The selected bank account does not exist anymore.' => 'Das ausgewählte Bankkonto existiert nicht mehr.',
- 'The selected bin does not exist.' => 'Der ausgewählte Lagerplatz existiert nicht.',
- 'The selected currency' => 'Die ausgewählte Währung',
- 'The selected exports have been closed.' => 'Die ausgewählten Exporte wurden abgeschlossen.',
- 'The selected warehouse does not exist.' => 'Das ausgewählte Lager existiert nicht.',
- 'The selected warehouse is empty, or no stocked items where found that match the filter settings.' => 'Das ausgewählte Lager ist leer, oder die Suche ergab keine Übereinstimmungen.',
- 'The session is invalid or has expired.' => 'Sie sind von Lx-Office abgemeldet.',
- 'The settings were saved, but the password was not changed.' => 'Die Einstellungen wurden gespeichert, aber das Passwort wurde nicht geändert.',
- 'The source warehouse does not contain any bins.' => 'Das Quelllager enthält keine Lagerplätze.',
- 'The start date is missing.' => 'Das Startdatum fehlt.',
- 'The subject is missing.' => 'Der Betreff fehlt.',
- 'The tables for user management and authentication do not exist. They will be created in the next step in the following database:' => 'Die Tabellen zum Speichern der Benutzerdaten und zur Benutzerauthentifizierung wurden nicht gefunden. Sie werden in der folgenden Datenbank angelegt:',
- 'The tabulator character' => 'Das Tabulator-Symbol',
- 'The third way is to download the module from the above mentioned URL and to install the module manually following the installations instructions contained in the source archive.' => 'Die dritte Variante besteht darin, das Paket von der oben genannten URL herunterzuladen und es manuell zu installieren. Beachten Sie dabei die im Paket enthaltenen Installationsanweisungen.',
- 'The transaction is shown below in its current state.' => 'Nachfolgend wird angezeigt, wie die Buchung momentan aussieht.',
- 'The unit has been saved.' => 'Die Einheit wurde gespeichert.',
- 'The unit in row %d has been deleted in the meantime.' => 'Die Einheit in Zeile %d ist in der Zwischentzeit gelöscht worden.',
- 'The unit in row %d has been used in the meantime and cannot be changed anymore.' => 'Die Einheit in Zeile %d wurde in der Zwischenzeit benutzt und kann nicht mehr geändert werden.',
- 'The units have been saved.' => 'Die Einheiten wurden gespeichert.',
- 'The user is a member in the following group(s):' => 'Der Benutzer ist Mitglied in den folgenden Gruppen:',
- 'The user migration process is complete.' => 'Der Prozess der Benutzerdatenmigration ist abgeschlossen.',
- 'The variable name must only consist of letters, numbers and underscores. It must begin with a letter. Example: send_christmas_present' => 'Der Datenfeldname darf nur aus Zeichen (keine Umlaute), Ziffern und Unterstrichen bestehen. Er muss mit einem Buchstaben beginnen. <br> Beispiel: <i>cebit_teilnahme_2011</i>',
- 'The warehouse could not be deleted because it has already been used.' => 'Das Lager konnte nicht gelöscht werden, da es bereits in Benutzung war.',
- 'The warehouse does not contain any bins.' => 'Das Lager enthält keine Lagerplätze.',
- 'The warehouse or the bin is missing.' => 'Das Lager oder der Lagerplatz fehlen.',
- 'The wrong taxkeys for AP and AR transactions have been fixed.' => 'Die Probleme mit falschen Steuerschlüssel bei Kreditoren- und Debitorenbuchungen wurden behoben.',
- 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => 'Die falschen Steuerschlüssel für Warenbestandsbuchungen bei Einkaufs- und Verkaufsrechnungen wurden behoben.',
- 'The wrong taxkeys have been fixed.' => 'Die Steuerschlüssel wurden nach Ihrer Auswahl korrigiert.',
- 'There are #1 more open invoices for this customer with other currencies.' => 'Es gibt #1 weitere offene Rechnungen für diesen Kunden, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 more open invoices from this vendor with other currencies.' => 'Es gibt #1 weitere offene Rechnungen von diesem Lieferanten, die in anderen Währungen ausgestellt wurden.',
- 'There are #1 unfinished follow-ups of which #2 are due.' => 'Es gibt #1 Wiedervorlage(n), von denen #2 fällig ist/sind.',
- 'There are bookings to the account 3803 after 01.01.2007. If you didn\'t change this account manually to 19% the bookings are probably incorrect.' => 'Das Konto 3803 wurde nach dem 01.01.2007 bebucht. Falls Sie dieses Konto nicht manuell auf 19% gestellt haben sind die Buchungen wahrscheinlich mit falscher Umsatzsteuer gebucht worden.',
- 'There are four tax zones.' => 'Es gibt vier Steuerzonen.',
- 'There are no items in stock.' => 'Dieser Artikel ist nicht eingelagert.',
- 'There are no items on your TODO list at the moment.' => 'Ihre Aufgabenliste enthält momentan keine Einträge.',
- 'There are still entries in the database for which no unit has been assigned.' => 'Es gibt noch Einträge in der Datenbank, für die keine Einheit zugeordnet ist.',
- 'There are still transfers not matching the qty of the delivery order. Stock operations can not be changed later. Do you really want to proceed?' => 'Einige der Lagerbewegungen sind nicht vollständig und Lagerbewegungen können nachträglich nicht mehr verändert werden. Wollen Sie wirklich fortfahren?',
- 'There are usually three ways to install Perl modules.' => 'Es gibt normalerweise drei Arten, ein Perlmodul zu installieren.',
- 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => 'Es gibt mindestens eine Einkaufs- oder Verkaufsrechnung, für die Lx-Office einen Steuerschlüssel ungleich 0 verzeichnet hat, obwohl für Warenbestandsbuchugen bei Rechnungen nie Steuern gebucht werden.',
- 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => 'Es gibt mindestens eine Buchung, bei der ein logisch nicht passender Steuerschlüssel ausgewählt wurde.',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, #5, for the transfer of #6.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4, #5, nicht genügend eingelagert, um insgesamt #6 auszulagern.',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, for the transfer of #5.' => 'Von \'#1\' ist in Lager \'#2\', Lagerplatz \'#3\', #4 nicht genügend eingelagert, um insgesamt #5 auszulagern.',
- 'There is not enough left of \'#1\' in bin \'#2\' for the removal of #3.' => 'In Lagerplatz \'#2\' ist nicht genug von \'#1\' vorhanden, um #3 zu entnehmen.',
- 'There is nothing to do in this step.' => 'In diesem Schritt gibt es nichts mehr zu tun.',
- 'Therefore the definition of "kg" with the base unit "g" and a factor of 1000 is valid while defining "g" with a base unit of "kg" and a factor of "0.001" is not.' => 'So ist die Definition von "kg" mit der Basiseinheit "g" und dem Faktor 1000 zulässig, die Definition von "g" mit der Basiseinheit "kg" und dem Faktor "0,001" hingegen nicht.',
- 'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => 'Deswegen muss man den gleichen Artikel nicht mehr mehrmals anlegen, wenn er in verschiedenen Steuerzonen gehandelt werden soll.',
- 'These units can be based on other units so that Lx-Office can convert prices when the user switches from one unit to another.' => 'Diese Einheiten können auf anderen Einheiten basieren, sodass Lx-Office Preise umrechnen kann, wenn der Benutzer von einer Einheit zu einer anderen Wechselt.',
- 'These wrong entries cannot be fixed automatically.' => 'Diese Einträge können nicht automatisch bereinigt werden.',
- 'This corresponds to Lx-Office\'s behavior prior to version 2.4.4.' => 'Dieses entspricht dem Verhalten von Lx-Office vor Version 2.4.4.',
- 'This could have happened for two reasons:' => 'Dies kann aus zwei Gründen geschehen sein:',
- 'This customer number is already in use.' => 'Diese Kundennummer wird bereits verwendet.',
- 'This group will be called "Full Access".' => 'Diese Gruppe wird "Vollzugriff" genannt.',
- 'This installation uses an unknown chart of accounts ("#1"). This database upgrade cannot create standard buchungsgruppen automatically.' => 'Diese Installation benutzt einen unbekannten Kontenrahmen ("#1"). Dieses Datenbankupgrade kann die Standardbuchungsgruppen nicht automatisch anlegen.',
- 'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => 'In diesem Schritt werden bestehende Datenbanken gesucht. Es werden noch keine Änderungen vorgenommen!',
- 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => 'Diese Liste ist auf 15 Zeilen begrenzt. Wenn Sie eine vollständige Liste benötigen, erstellen Sie bitte einen Bericht.',
- 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => 'Das bedeutet, dass ein Benutzer eine Kreditorenbuchung angelegt und in ihr einen Umsatzsteuer-Steuerschlüssel verwendet oder eine Debitorenbuchung mit Vorsteuer-Steuerschlüssel angelegt hat.',
- 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => 'Dieses Modul kann Ihnen helfen, problematische Einträge im Hauptbuch zu identifizieren und teilweise zu beheben. Dabei werden je nach Problem mögliche Lösungen aufgezeigt, wobei Sie die entscheiden können, welche Probleme automatisch gelöst werden sollen.',
- 'This transaction has to be split into several transactions manually.' => 'Diese Buchung muss manuell in mehrere Buchungen aufgeteilt werden.',
- 'This update will change the nature the onhand of goods is tracked.' => 'Dieses update ändert die Art und Weise wie Lagermengen gezält werden.',
- 'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => 'Dieses Upgradescript versucht, bei allen bestehenden Artikeln neu erstellte Buchungsgruppen zuzuordnen.',
- 'This upgrade script tries to map all existing units in the database to the newly created units.' => 'Dieses Update-Script versucht, alle bestehenden Einheiten automatisch in die neuen Einheiten umzuwandeln.',
- 'This vendor number is already in use.' => 'Diese Lieferantennummer wird bereits verwendet.',
- 'Time period for the analysis:' => 'Analysezeitraum:',
- 'Timestamp' => 'Uhrzeit',
- 'Title' => 'Titel',
- 'To' => 'An',
- 'To (email)' => 'An',
- 'To (time)' => 'Bis',
- 'To Date' => 'Bis',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Um einer Gruppe einen neuen Benutzer hinzuzufügen, ändern und speichern Sie am einfachsten einen bestehenden Benutzernamen. Unter dem neuen Namen wird dann ein Benutzer mit denselben Einstellungen angelegt.',
- 'Top' => 'Oben',
- 'Top (CSS)' => 'Oben (mit CSS)',
- 'Top (CSS) new' => 'Oben (mit CSS, neu)',
- 'Top (Javascript)' => 'Oben (mit Javascript)',
- 'Top 100' => 'Top 100',
- 'Top 100 hinzufuegen' => 'Top 100 hinzufügen',
- 'Top Level' => 'Hauptartikelbezeichnung',
- 'Total' => 'Summe',
- 'Total Fees' => 'Kumulierte Gebühren',
- 'Total stock value' => 'Gesamter Bestandswert',
- 'Totals' => 'Summen',
- 'Trade Discount' => 'Rabatt',
- 'Trans Id' => 'Trans-ID',
- 'Trans Type' => 'Transfertyp',
- 'Transaction' => 'Buchung',
- 'Transaction %d cancelled.' => 'Buchung %d erfolgreich storniert.',
- 'Transaction Date missing!' => 'Buchungsdatum fehlt!',
- 'Transaction ID missing.' => 'Die Buchungs-ID fehlt.',
- 'Transaction deleted!' => 'Buchung gelöscht!',
- 'Transaction description' => 'Vorgangsbezeichnung',
- 'Transaction has already been cancelled!' => 'Diese Buchung wurde bereits storniert.',
- 'Transaction has been split on both the credit and the debit side' => 'Sowohl auf der Soll- als auch auf der Haben-Seite gesplittete Buchung',
- 'Transaction posted!' => 'Buchung verbucht!',
- 'Transactions, AR transactions, AP transactions' => 'Dialogbuchen, Debitorenrechnungen, Kreditorenrechnungen',
- 'Transdate' => 'Belegdatum',
- 'Transfer' => 'Umlagern',
- 'Transfer Quantity' => 'Umlagermenge',
- 'Transfer To Stock' => 'Lagereingang',
- 'Transfer from warehouse' => 'Von Lager',
- 'Transfer in' => 'Einlagern',
- 'Transfer out' => 'Auslagern',
- 'Transfer qty' => 'Umlagermenge',
- 'Translation' => 'Übersetzung',
- 'Trial Balance' => 'Summen / Salden',
- 'Trial balance between %s and %s' => 'Summen- und Saldenlisten vom %s bis zum %s',
- 'Trying to call a sub without a name' => 'Es wurde versucht, eine Unterfunktion ohne Namen aufzurufen.',
- 'Type' => 'Typ',
- 'Type can be either \'part\' or \'service\'.' => 'Der Typ kann entweder \'part\' (für Waren) oder \'service\' (für Dienstleistungen) enthalten.',
- 'Type of Business' => 'Kunden-/Lieferantentyp',
- 'Type of Customer' => 'Kundentyp',
- 'Type of Vendor' => 'Lieferantentyp',
- 'USTVA' => 'USTVA',
- 'USTVA 2004' => 'USTVA 2004',
- 'USTVA 2005' => 'USTVA 2005',
- 'USTVA 2006' => 'USTVA 2006',
- 'USTVA 2007' => 'USTVA 2007',
- 'USTVA-Hint: Method' => 'Wenn Sie Ist-Versteuert sind, wählen Sie die Einnahmen-/Überschuß-Rechnung aus. Sind Sie Soll-Versteuert und bilanzverpflichtet, dann wählen Sie Bilanz aus.',
- 'USTVA-Hint: Tax Authoritys' => 'Bitte das Bundesland UND die Stadt bzw. den Einzugsbereich Ihres zuständigen Finanzamts auswählen.',
- 'USt-IdNr.' => 'USt-IdNr.',
- 'USt-Konto' => 'USt-Konto',
- 'UStVA' => 'UStVA',
- 'UStVA (PDF-Dokument)' => 'UStVa als PDF-Dokument',
- 'UStVa' => 'UStVa',
- 'UStVa Einstellungen' => 'UStVa Einstellungen',
- 'Unbalanced Ledger' => 'Bilanzfehler',
- 'Unchecked custom variables will not appear in orders and invoices.' => 'Unmarkierte Datenfelder werden für diesen Artikel nicht in Aufträgen und Rechnungen angezeigt.',
- 'Unfinished follow-ups' => 'Nicht erledigte Wiedervorlagen',
- 'Unit' => 'Einheit',
- 'Unit (if missing or empty default unit will be used)' => 'Einheit (falls nicht vorhanden oder leer wird die Standardeinheit benutzt)',
- 'Unit missing.' => 'Die Einheit fehlt.',
- 'Unit of measure' => 'Maßeinheit',
- 'Units marked for deletion will be deleted upon saving.' => 'Einheiten, die zum Löschen markiert sind, werden beim Speichern gelöscht.',
- 'Units that have already been used (e.g. for parts and services or in invoices or warehouse transactions) cannot be changed.' => 'Einheiten, die bereits in Benutzung sind (z.B. bei einer Warendefinition, einer Rechnung oder bei einer Lagerbuchung) können nachträglich nicht mehr verändert werden.',
- 'Unknown Category' => 'Unbekannte Kategorie',
- 'Unknown Link' => 'Unbekannte Verknüpfung',
- 'Unknown chart of accounts' => 'Unbekannter Kontenrahmen',
- 'Unknown dependency \'%s\'.' => 'Unbekannte Abhängigkeit \'%s\'.',
- 'Unknown problem type.' => 'Unbekannter Problem-Typ',
- 'Unlock System' => 'System entsperren',
- 'Until' => 'Bis',
- 'Update' => 'Erneuern',
- 'Update Dataset' => 'Datenbank aktualisieren',
- 'Update Prices' => 'Preise aktualisieren',
- 'Update SKR04: new tax account 3804 (19%)' => 'Update SKR04: neues Steuerkonto 3804 (19%) fÃŒr innergemeinschaftlichen Erwerb',
- 'Update complete' => 'Update beendet.',
- 'Update prices' => 'Preise aktualisieren',
- 'Update prices of existing entries' => 'Preise von vorhandenen Artikeln aktualisieren',
- 'Update?' => 'Aktualisieren?',
- 'Updated' => 'Erneuert am',
- 'Updating prices of existing entry in database' => 'Preis des Eintrags in der Datenbank wird aktualisiert',
- 'Uploaded on #1, size #2 kB' => 'Am #1 hochgeladen, Größe #2 kB',
- 'Use As Template' => 'Als Vorlage verwenden',
- 'Use Templates' => 'Benutze Vorlagen',
- 'User' => 'Benutzer',
- 'User Config' => 'Einstellungen',
- 'User Login' => 'Als Benutzer anmelden',
- 'User data migration' => 'Benutzerdatenmigration',
- 'User deleted!' => 'Benutzer gelöscht!',
- 'User migration complete' => 'Benutzermigration abgeschlossen',
- 'User name' => 'Benutzername',
- 'User saved!' => 'Benutzer gespeichert!',
- 'Username' => 'Benutzername',
- 'Users in this group' => 'Mitglieder dieser Gruppe',
- 'Ust-IDNr' => 'USt-IdNr.',
- 'Valid from' => 'Gültig ab',
- 'Valid until' => 'gültig bis',
- 'Value' => 'Wert',
- 'Variable' => 'Variable',
- 'Variable Description' => 'Datenfeldbezeichnung',
- 'Variable Name' => 'Datenfeldname (intern)',
- 'Vendor' => 'Lieferant',
- 'Vendor (name)' => 'Lieferant (Name)',
- 'Vendor Invoice' => 'Einkaufsrechnung',
- 'Vendor Invoices' => 'Rechnungseingänge',
- 'Vendor Name' => 'Lieferantenname',
- 'Vendor Number' => 'Lieferantennummer',
- 'Vendor Order Number' => 'Bestellnummer beim Lieferanten',
- 'Vendor deleted!' => 'Lieferant gelöscht!',
- 'Vendor details' => 'Lieferantendetails',
- 'Vendor missing!' => 'Lieferant fehlt!',
- 'Vendor not on file or locked!' => 'Dieser Lieferant existiert nicht oder ist gesperrt.',
- 'Vendor not on file!' => 'Lieferant ist nicht in der Datenbank!',
- 'Vendor saved!' => 'Lieferant gespeichert!',
- 'Vendor type' => 'Lieferantentyp',
- 'Vendors' => 'Lieferanten',
- 'Verrechnungseinheit' => 'Verrechnungseinheit',
- 'Version' => 'Version',
- 'View SEPA export' => 'SEPA-Export-Details ansehen',
- 'View warehouse content' => 'Lagerbestand ansehen',
- 'View/edit all employees sales documents' => 'Bearbeiten/ansehen der Verkaufsdokumente aller Mitarbeiter',
- 'Von Konto: ' => 'von Konto: ',
- 'WHJournal' => 'Lagerbuchungen',
- 'Warehouse' => 'Lager',
- 'Warehouse From' => 'von Lager',
- 'Warehouse Migration' => 'Lagermigration',
- 'Warehouse To' => 'nach Lager',
- 'Warehouse content' => 'Lagerbestand',
- 'Warehouse deleted.' => 'Lager gelöscht.',
- 'Warehouse management' => 'Lagerverwaltung/Bestandsveränderung',
- 'Warehouse saved.' => 'Lager gespeichert.',
- 'Warehouses' => 'Lager',
- 'Warning' => 'Warnung',
- 'Warnings during template upgrade' => 'Warnungen bei Aktualisierung der Dokumentenvorlagen',
- 'WebDAV link' => 'WebDAV-Link',
- 'Webserver interface' => 'Webserver nutzt',
- 'Weight' => 'Gewicht',
- 'Weight unit' => 'Gewichtseinheit',
- 'What <b>term</b> you are looking for?' => 'Nach welchem <b>Begriff</b> wollen Sie suchen?',
- 'What type of item is this?' => 'Was ist dieser Artikel?',
- 'Which is located at doc/Lx-Office-Dokumentation.pdf. Click here: ' => 'Zu finden in doc/Lx-Office-Dokumentation.pdf. Oder hier klicken: ',
- 'With Extension Of Time' => 'mit Dauerfristverlängerung',
- 'Workflow Delivery Order' => 'Workflow Lieferschein',
- 'Workflow purchase_order' => 'Workflow Lieferantenauftrag',
- 'Workflow request_quotation' => 'Workflow Preisanfrage',
- 'Workflow sales_order' => 'Workflow Auftrag',
- 'Workflow sales_quotation' => 'Workflow Angebot',
- 'Wrong Period' => 'Falscher Zeitraum',
- 'Wrong date format!' => 'Falsches Datumsformat!',
- 'Wrong tax keys recorded' => 'Gespeicherte Steuerschlüssel sind falsch',
- 'Wrong taxes recorded' => 'Gespeicherte Steuern passen nicht zum Steuerschlüssel',
- 'YYYY' => 'JJJJ',
- 'Year' => 'Jahr',
- 'Yearly' => 'jährlich',
- 'Yearly taxreport not yet implemented' => 'Jährlicher Steuerreport für dieses Ausgabeformat noch nicht implementiert',
- 'Yes' => 'Ja',
- 'Yes, included by default' => 'Ja, standardmäßig an',
- 'Yes/No (Checkbox)' => 'Ja/Nein (Checkbox)',
- 'You are logged out!' => 'Auf Wiedersehen!',
- 'You can also create new units now.' => 'Sie können jetzt auch neue Einheiten anlegen.',
- 'You can also delete this transaction and re-enter it manually.' => 'Alternativ können Sie die Buchung auch mit löschen lassen und sie anschließend neu eingeben.',
- 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => 'Sie haben die Möglichkeit, die Buchung zu korrigieren, indem Sie in den Drop-Down-Boxen die richtigen Steuerschlüssel auswählen und anschließend auf den Button "Buchung korrigieren" drücken.',
- 'You can create a missing dataset by going back and chosing "Create Dataset".' => 'Sie können eine fehlende Datenbank erstellen, indem Sie jetzt zuück gehen und den Punkt "Neue Datenbank anlegen" wählen.',
- 'You can create warehouses and bins via the menu "System -> Warehouses".' => 'Sie können Lager und Lagerplätze über das Menü "System -> Lager" anlegen.',
- 'You can declare different translations for singular and plural for each unit (e.g. "day" and "days).' => 'Bei den Übersetzungen können Sie unterschiedliche Varianten für singular und plural angeben (z.B. "day" und "days").',
- 'You can either create a new database or chose an existing database.' => 'Sie können entweder eine neue Datenbank erstellen oder eine existierende auswählen.',
- 'You can find information on the migration in the upgrade chapter of the documentation.' => 'Informationen über die Migration sind in der Upgrade Kapitel in der Dokumentation zu finden.',
- 'You can only delete datasets that are not in use.' => 'Sie können nur Datenbanken löschen, die momentan nicht in Benutzung sind.',
- 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => 'Sie können im Langtext und allen Übersetzungen die folgenden Variablen benutzen, die vor der Ausgabe von Lx-Office automatisch ersetzt werden:',
- 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => 'Sie können den Preis für Preisgruppe "#1" um einen negativen Prozentwert anpassen.',
- 'You cannot continue before all required modules are installed.' => 'Sie können nicht fortfahren, bevor alle benötigten Pakete installiert sind.',
- 'You cannot continue until all unknown units have been mapped to known ones.' => 'Sie können nicht fortfahren, bis alle unbekannten Einheiten in neue Einheiten umgewandelt wurden.',
- 'You cannot create an invoice for delivery orders for different customers.' => 'Sie können keine Rechnung zu Lieferscheinen für verschiedene Kunden erstellen.',
- 'You cannot create an invoice for delivery orders from different vendors.' => 'Sie können keine Rechnung aus Lieferscheinen von verschiedenen Lieferanten erstellen.',
- 'You did not enter a name!' => 'Sie haben keinen Namen eingegeben!',
- 'You do not have the permissions to access this function.' => 'Sie verfügen nicht über die notwendigen Rechte, um auf diese Funktion zuzugreifen.',
- 'You have entered or selected the following shipping address for this customer:' => 'Sie haben die folgende Lieferadresse eingegeben oder ausgewählt:',
- 'You have not added bank accounts yet.' => 'Sie haben noch keine Bankkonten angelegt.',
- 'You have not selected any delivery order.' => 'Sie haben keinen Lieferschein ausgewählt.',
- 'You have not selected any export.' => 'Sie haben keinen Export ausgewählt.',
- 'You have not selected any item.' => 'Sie haben keine noch nicht gebuchten Einträge ausgewählt.',
- 'You have selected none of the invoices.' => 'Sie haben keine der Rechnungen ausgewählt.',
- 'You have to chose a dimension unit and a service unit which will then be assigned to those entries.' => 'Sie müssen eine Maß- und eine Dienstleistungseinheit auswählen, die diesen Waren und Dienstleistungen, denen noch keine Einheit zugeordnet ist, zugeordnet wird.',
- 'You have to chose which unit to save for each of them.' => 'Sie müssen für jeden Artikel die neue Einheit auswählen.',
- 'You have to create at least one group, grant it access to Lx-Office\'s functions and assign users to it.' => 'Sie müssen mindestens eine Benutzergruppe anlegen, ihr Zugriff auf die verschiedenen Funktionsbereiche von Lx-Office gewähren und Benutzer dieser Gruppe zuordnen.',
- 'You have to create new Buchungsgruppen for all the combinations of inventory, income and expense accounts that have been used already.' => 'Sie müssen neue Buchungsgruppen für alle Kombinationen aus Inventar-, Erlös- und Aufwandskonto, die bereits benutzt wurden.',
- 'You have to define a unit as a multiple of a smaller unit.' => 'Sie müssen Einheiten als ein Vielfaches einer kleineren Einheit eingeben.',
- 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to enter the SEPA creditor ID in your user preferences (see the "Program" menu, "Preferences").' => 'Sie müssen einen Firmennamen in Ihren Einstellungen angeben (siehe Menü "Programm", "Einstellungen").',
- 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => 'Sie müssen zumindest die Kontonummer, die Bankleitzahl, die IBAN und den BIC angeben.',
- 'You have to specify a department.' => 'Sie müssen eine Abteilung wählen.',
- 'You have to specify an execution date for each antry.' => 'Sie müssen für jeden zu buchenden Eintrag ein Ausführungsdatum angeben.',
- 'You must chose a user.' => 'Sie müssen einen Benutzer auswählen.',
- 'You should create a backup of the database before proceeding because the backup might not be reversible.' => 'Sie sollten eine Sicherungskopie der Datenbank erstellen, bevor Sie fortfahren, da die Aktualisierung unter Umständen nicht umkehrbar ist.',
- 'You will now be forwarded to the administration panel.' => 'Sie werden nun zum Administrationsbereich weitergeleitet.',
- 'You\'re not editing a file.' => 'Sie bearbeiten momentan keine Datei.',
- 'You\'ve already chosen the following limitations:' => 'Sie haben bereits die folgenden Einschränkungen vorgenommen:',
- 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => 'Ihre PostgreSQL-Installation benutzt UTF-8 als Zeichensatz. Sie müssen deshalb Lx-Office so konfigurieren, dass es ebenfalls UTF-8 als Zeichensatz benutzt.',
- 'Your TODO list' => 'Meine Aufgaben',
- 'Your account number' => 'Ihre Kontonummer',
- 'Your bank' => 'Der Name Ihrer Bank',
- 'Your bank code' => 'Die Bankleitzahl Ihrer Bank',
- 'Your browser does not currently support Javascript.' => 'Ihr Browser unterstützt im Moment kein Javascript!',
- 'Your download does not exist anymore. Please re-run the DATEV export assistant.' => 'Ihr Download existiert nicht mehr. Bitte starten Sie den DATEV-Exportassistenten erneut.',
- 'Zeitpunkt' => 'Zeitpunkt',
- 'Zeitraum' => 'Zeitraum',
- 'Zero amount posting!' => 'Buchung ohne Wert',
- 'Zip, City' => 'PLZ, Ort',
- 'Zipcode' => 'PLZ',
- 'Zusatz' => 'Zusatz',
- '[email]' => '[email]',
- 'absolute' => 'absolut',
- 'account_description' => 'Beschreibung',
- 'accrual' => 'Bilanzierung (Soll-Versteuerung)',
- 'action= not defined!' => 'action= nicht definiert!',
- 'active' => 'aktiv',
- 'all entries' => 'alle Einträge',
- 'ap_aging_list' => 'liste_offene_verbindlichkeiten',
- 'ar_aging_list' => 'liste_offene_forderungen',
- 'as at' => 'zum Stand',
- 'assembly_list' => 'erzeugnisliste',
- 'back' => 'zurück',
- 'balance' => 'Betriebsvermögensvergleich/Bilanzierung',
- 'bank_collection_payment_list_#1' => 'bankeinzugszahlungsliste_#1',
- 'bank_transfer_payment_list_#1' => 'ueberweisungs_zahlungsliste_#1',
- 'bankaccounts' => 'Bankkonten',
- 'banktransfers' => 'ueberweisungen',
- 'bestbefore #1' => 'Mindesthaltbarkeit #1',
- 'bin_list' => 'Lagerliste',
- 'bis' => 'bis',
- 'button' => 'Kal.',
- 'cash' => 'E/Ü-Rechnung (Ist-Versteuerung)',
- 'chargenumber #1' => 'Chargennummer #1',
- 'chart_of_accounts' => 'kontenuebersicht',
- 'choice' => 'auswählen',
- 'choice part' => 'Artikel auswählen',
- 'click here to edit cvars' => 'Hier klicken, um erweiterte Datenfeldern einzublenden',
- 'close' => 'schließen',
- 'closed' => 'geschlossen',
- 'companylogo_subtitle' => 'Warenwirtschaft und Finanzbuchhaltung',
- 'config/lx_office.conf: Key "DB_config" is missing.' => 'config/lx_office.conf: Das Schlüsselwort "DB_config" fehlt.',
- 'config/lx_office.conf: Key "authentication/ldap" is missing.' => 'config/lx_office.conf: Der Schlüssel "authentication/ldap" fehlt.',
- 'config/lx_office.conf: Missing parameters in "authentication/database". Required parameters are "host", "db" and "user".' => 'config/lx_office.conf: Fehlende Parameter in "authentication/database". Benötigte Parameter sind "host", "db" und "user".',
- 'config/lx_office.conf: Missing parameters in "authentication/ldap". Required parameters are "host", "attribute" and "base_dn".' => 'config/lx_office.conf: Fehlende Parameter in "authentication/ldap". Benötigt werden "host", "attribute" und "base_dn".',
- 'continue' => 'weiter',
- 'correction' => 'Korrektur',
- 'cp_greeting to cp_gender migration' => 'Datenumwandlung von Titel nach Geschlecht (cp_greeting to cp_gender)',
- 'customer' => 'Kunde',
- 'customer_list' => 'kundenliste',
- 'debug' => 'Debug',
- 'delete' => 'Löschen',
- 'delivered' => '',
- 'deliverydate' => 'Lieferdatum',
- 'direct debit' => 'Lastschrift',
- 'disposed' => 'Entsorgung',
- 'do not include' => 'Nicht aufnehmen',
- 'done' => 'erledigt',
- 'down' => 'runter',
- 'dunning_list' => 'mahnungsliste',
- 'eMail Send?' => 'eMail-Versand?',
- 'eMail?' => 'eMail?',
- 'ea' => 'St.',
- 'emailed to' => 'gemailt an',
- 'executed' => 'ausgeführt',
- 'female' => 'weiblich',
- 'follow_up_list' => 'wiedervorlageliste',
- 'for' => 'für',
- 'for Period' => 'für den Zeitraum',
- 'found' => 'Gefunden',
- 'from (time)' => 'von',
- 'general_ledger_list' => 'buchungsjournal',
- 'history' => 'Historie',
- 'history search engine' => 'Historien Suchmaschine',
- 'inactive' => 'inaktiv',
- 'income' => 'Einnahmen-Überschuß-Rechnung',
- 'invoice' => 'Rechnung',
- 'invoice_list' => 'debitorenbuchungsliste',
- 'lead deleted!' => 'Kundenquelle gelöscht',
- 'lead saved!' => 'Kundenquelle geichert',
- 'list' => 'auflisten',
- 'list_of_payments' => 'zahlungsausgaenge',
- 'list_of_receipts' => 'zahlungseingaenge',
- 'list_of_transactions' => 'buchungsliste',
- 'loading' => 'wird geladen',
- 'logout' => 'abmelden',
- 'male' => 'männlich',
- 'mark as paid' => 'als bezahlt markieren',
- 'missing' => 'Fehlbestand',
- 'month' => 'Monatliche Abgabe',
- 'monthly' => 'monatlich',
- 'new Window' => 'neues Fenster',
- 'next' => 'nächster',
- 'no' => 'nein',
- 'no bestbefore' => 'keine Mindesthaltbarkeit',
- 'no chargenumber' => 'keine Chargennummer',
- 'none (pricegroup)' => 'keine',
- 'not configured' => 'nicht konfiguriert',
- 'not delivered' => '',
- 'not executed' => 'nicht ausgeführt',
- 'not transferred in yet' => 'noch nicht eingelagert',
- 'not transferred out yet' => 'noch nicht ausgelagert',
- 'not yet executed' => 'Noch nicht ausgeführt',
- 'number' => 'Nummer',
- 'oe.pl::search called with unknown type' => 'oe.pl::search mit unbekanntem Typ aufgerufen',
- 'only OB Transactions' => 'nur EB-Buchungen',
- 'open' => 'Offen',
- 'order' => 'Reihenfolge',
- 'our vendor number at customer' => 'Unsere Lieferanten-Nr. beim Kunden',
- 'part_list' => 'warenliste',
- 'percental' => 'prozentual',
- 'periodic' => 'Aufwandsmethode',
- 'perpetual' => 'Bestandsmethode',
- 'pick_list' => 'Entnahmeliste',
- 'plural first char' => 'P',
- 'pos_bilanz' => 'Bilanz',
- 'pos_bwa' => 'BWA',
- 'pos_eur' => 'E/ÜR',
- 'pos_ustva' => 'UStVA',
- 'posted!' => 'gebucht',
- 'prev' => 'vorheriger',
- 'print' => 'drucken',
- 'proforma' => 'Proforma',
- 'project_list' => 'projektliste',
- 'purchase_delivery_order_list' => 'lieferscheinliste_einkauf',
- 'purchase_order' => 'Auftrag',
- 'purchase_order_list' => 'lieferantenauftragsliste',
- 'quarter' => 'Vierteljährliche (quartalsweise) Abgabe',
- 'quarterly' => 'quartalsweise',
- 'quotation_list' => 'angebotsliste',
- 'release_material' => 'Materialausgabebe',
- 'reorder item' => 'Eintrag umsortieren',
- 'report_generator_dispatch_to is not defined.' => 'report_generator_dispatch_to ist nicht definiert.',
- 'report_generator_nextsub is not defined.' => 'report_generator_nextsub ist nicht definiert.',
- 'request_quotation' => 'Angebotsanforderung',
- 'reset' => 'zurücksetzen',
- 'return_material' => 'Materialrückgabe',
- 'rfq_list' => 'anfragenliste',
- 'sales tax identification number' => 'USt-IdNr.',
- 'sales_delivery_order_list' => 'lieferscheinliste_verkauf',
- 'sales_order' => 'Kundenauftrag',
- 'sales_order_list' => 'auftragsliste',
- 'sales_quotation' => 'Verkaufsangebot',
- 'saved' => 'gespeichert',
- 'saved!' => 'gespeichert',
- 'sent' => 'gesendet',
- 'sent to printer' => 'an Drucker geschickt',
- 'service_list' => 'dienstleistungsliste',
- 'shipped' => 'verschickt',
- 'singular first char' => 'S',
- 'soldtotal' => 'Verkaufte Anzahl',
- 'stock' => 'Einlagerung',
- 'submit' => 'abschicken',
- 'tax_chartaccno' => 'Automatikkonto',
- 'tax_percent' => 'Prozentsatz',
- 'tax_rate' => 'Prozent',
- 'tax_taxdescription' => 'Steuername',
- 'tax_taxkey' => 'Steuerschlüssel',
- 'taxnumber' => 'Automatikkonto',
- 'terminated' => 'gekündigt',
- 'to (date)' => 'bis',
- 'to (time)' => 'bis',
- 'transfer' => 'Umlagerung',
- 'transferred in' => 'eingelagert',
- 'transferred out' => 'ausgelagert',
- 'trial_balance' => 'susa',
- 'up' => 'hoch',
- 'use program settings' => 'benutze Programmeinstellungen',
- 'used' => 'Verbraucht',
- 'valid from' => 'Gültig ab',
- 'vendor' => 'Lieferant',
- 'vendor_invoice_list' => 'kreditorenbuchungsliste',
- 'vendor_list' => 'lieferantenliste',
- 'warehouse_journal_list' => 'lagerbuchungsliste',
- 'warehouse_report_list' => 'lagerbestandsliste',
- 'wrongformat' => 'Falsches Format',
- 'yearly' => 'jährlich',
- 'yes' => 'ja',
-};
-
-1;
+++ /dev/null
-[HTML]
-order=& ä ö ü Ä Ö Ü ß " < >
-ä=ä
-ö=ö
-ü=ü
-Ä=Ä
-Ö=Ö
-Ü=Ü
-ß=ß
-"="
-&=&
-<=<
->=>
-
-[URL@HTML]
-order="
-"="
-
-[Template/HTML]
-order=< > \n
-<=<
->=>
-\n=<br>
-
-[Template/XML]
-order=< > \n
-<=<
->=>
-\n=<br>
-
-[Template/LaTeX]
-order=\\ <pagebreak> & \n \r " $ <bullet> % _ # ^ { } < > £ ± \xe1 ² ³
-\\=\\textbackslash\s
-<pagebreak>=
-"=''
-&=\\&
-$=\\$
-<bullet>=$\\bullet$
-%=\\%
-_=\\_
-#=\\#
-{=\\{
-}=\\}
-<=$<$
->=$>$
-£=\\pounds\s
-\n=\\newline\s
-\r=
-±=$\\pm$
-^=\\^\\\s
-²=$^2$
-³=$^3$
-
-[Template/OpenDocument]
-order=& < > " ' \x80 \n \r
-<=<
->=>
-"="
-'='
-&=&
-# Euro sign:
-\x80=\xa4
-\n=<text:line-break/>
-\r=
-
-[filenames]
-order=ä ö ü Ä Ö Ü ß
-ä=ae
-ö=oe
-ü=ue
-Ä=Ae
-Ö=Oe
-Ü=Ue
-ß=ss
'AP Transaction Storno (one letter abbreviation)' => '',
'AP Transaction with Storno (abbreviation)' => '',
'AP Transactions' => 'Purchase Transactions',
+ 'AP transactions changeable' => '',
'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => '',
'AR' => 'Sales',
'AR Aging' => 'Debtor Aging',
'AR Transaction' => 'Sales Transaction',
'AR Transaction (abbreviation)' => '',
'AR Transactions' => 'Sales Transactions',
+ 'AR transactions changeable' => '',
'ASSETS' => '',
+ 'ATTENTION! If you enabled this feature you can not simply turn it off again without taking care that best_before fields are emptied in the database.' => '',
+ 'ATTENTION! You can not simply change it from periodic to perpetual once you started posting.' => '',
'Abort' => '',
'Abrechnungsnummer' => '',
'Abteilung' => '',
'An upper-case character is required.' => '',
'Annotations' => '',
'Another user with the login #1 does already exist.' => '',
+ 'Any stock contents containing a best before date will be impossible to stock out otherwise.' => '',
'Ap aging on %s' => '',
'Application Error. No Format given' => '',
'Application Error. Wrong Format' => '',
'Check' => 'Cheque',
'Check Details' => '',
'Check for duplicates' => '',
+ 'Check on ap transaction' => '',
+ 'Check on ar transaction' => '',
+ 'Check on gl transaction' => '',
+ 'Check on purchase invoice' => '',
+ 'Check on sales invoice' => '',
'Checks' => '',
'Choose Customer' => '',
'Choose Outputformat' => '',
'Cleared Balance' => '',
'Clearing Tax Received (No 71)' => '',
'Click on login name to edit!' => '',
+ 'Client Configuration' => '',
+ 'Client Configuration saved!' => '',
'Close' => '',
'Close Books up to' => '',
'Close Dialog' => '',
'DATEV - Export Assistent' => '',
'DATEV Angaben' => '',
'DATEV Export' => '',
+ 'DATEV check configuration' => '',
'DATEV check returned errors:' => '',
'DATEX - Export Assistent' => '',
'DELETED' => '',
'Full access to all functions' => '',
'Fwd' => 'Forward',
'GL Transaction' => '',
+ 'GL transactions changeable' => '',
'Gegenkonto' => '',
'Gender' => '',
'General Ledger' => '',
'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => '',
'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => '',
'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => '',
+ 'It is possible to make a quick DATEV export everytime you post a record to ensure things work nicely with their data requirements. This will result in a slight overhead though you can enable this for each type of record independantly.' => '',
'It may optionally be compressed with "gzip".' => '',
'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => '',
'Item deleted!' => '',
'KNE-Export erfolgreich!' => '',
'KNr. beim Kunden' => '',
'Keine Suchergebnisse gefunden!' => '',
- 'Kivitendo needs to update the authentication database before you can proceed.' => '',
- 'Kivitendo will then update the database automatically.' => '',
+ 'kivitendo needs to update the authentication database before you can proceed.' => '',
+ 'kivitendo will then update the database automatically.' => '',
'Konten' => '',
'L' => '',
'LIABILITIES' => '',
'Order Number missing!' => '',
'Order deleted!' => '',
'Ordered' => '',
+ 'Orders / Delivery Orders deleteable' => '',
'Orientation' => '',
'Orphaned' => '',
'Other users\' follow-ups' => '',
'Payment terms (database ID)' => '',
'Payment terms (name)' => '',
'Payments' => '',
+ 'Payments Changeable' => '',
'Per. Inv.' => '',
+ 'Perform check when a gl transaction is posted?' => '',
+ 'Perform check when a purchase invoice or a payment for a purchase invoice is posted?' => '',
+ 'Perform check when a sales invoice or a payment for a sales invoice is posted?' => '',
+ 'Perform check when an ap transaction is posted?' => '',
+ 'Perform check when an ar transaction is posted?' => '',
'Period' => '',
'Period:' => '',
'Periodic Invoices' => '',
'Post' => '',
'Post Payment' => '',
'Post payments' => '',
+ 'Posting Configuration' => '',
'Postscript' => '',
'Posustva_coa' => '',
'Preferences' => '',
'Projects' => '',
'Projecttransactions' => '',
'Prozentual/Absolut' => '',
+ 'Purchase Delivery Orders deleteable' => '',
'Purchase Invoice' => '',
'Purchase Order' => '',
'Purchase Orders' => '',
+ 'Purchase Orders deleteable' => '',
'Purchase Price' => '',
'Purchase Prices' => '',
'Purchase delivery order' => '',
'Purchase invoices' => '',
+ 'Purchase invoices changeable' => '',
'Purchase net amount' => '',
'Purchase price' => '',
'Purchase price total' => '',
'Saldo neu' => '',
'Saldo per' => '',
'Sale Prices' => '',
+ 'Sales Delivery Orders deleteable' => '',
'Sales Invoice' => '',
'Sales Invoices' => '',
'Sales Order' => '',
'Sales Orders' => '',
+ 'Sales Orders deleteable' => '',
'Sales Price information' => '',
'Sales Report' => '',
'Sales and purchase invoices with inventory transactions with taxkeys' => '',
'Sales delivery order' => '',
'Sales invoice number' => '',
'Sales invoices' => '',
+ 'Sales invoices changeable' => '',
'Sales margin' => '',
'Sales margin %' => '',
'Sales net amount' => '',
'Shipto is in use and was flagged invalid.' => '',
'Shopartikel' => '',
'Short' => '',
+ 'Should ap transactions be and when should they be changeable or deleteable after posting?' => '',
+ 'Should ar transactions be and when should they be changeable or deleteable after posting?' => '',
+ 'Should gl transactions be and when should they be changeable or deleteable after posting?' => '',
+ 'Should payments be and when should they be changeable after posting?' => '',
+ 'Should purchase invoices be and when should they be deleteable after posting?' => '',
+ 'Should sales invoices be and when should they be changeable or deleteable after posting?' => '',
+ 'Should the "mark as paid" button showed in ap transactions?' => '',
+ 'Should the "mark as paid" button showed in ar transactions?' => '',
+ 'Should the "mark as paid" button showed in purchase invoices?' => '',
+ 'Should the "mark as paid" button showed on sales invoices?' => '',
'Show' => '',
+ 'Show "mark as paid" in ap transactions' => '',
+ 'Show "mark as paid" in ar transactions' => '',
+ 'Show "mark as paid" in purchase invoices' => '',
+ 'Show "mark as paid" in sales invoices' => '',
+ 'Show Bestbefore' => '',
'Show Filter' => '',
'Show Salesman' => '',
'Show TODO list' => '',
'Show by default' => '',
'Show custom variable search inputs' => '',
+ 'Show delete button in purchase delivery orders?' => '',
+ 'Show delete button in purchase orders?' => '',
+ 'Show delete button in sales delivery orders?' => '',
+ 'Show delete button in sales orders?' => '',
'Show details' => '',
+ 'Show fields used for the best before date?' => '',
'Show follow ups...' => '',
'Show help text' => '',
'Show items from invoices individually' => '',
'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => '',
'These units can be based on other units so that kivitendo can convert prices when the user switches from one unit to another.' => '',
'These wrong entries cannot be fixed automatically.' => '',
+ 'This can be done with the following query:' => '',
'This corresponds to kivitendo\'s behavior prior to version 2.4.4.' => '',
'This could have happened for two reasons:' => '',
'This customer number is already in use.' => '',
'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => '',
'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => '',
'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => '',
+ 'This option controls the inventory system.' => '',
+ 'This option controls the method used for profit determination.' => '',
+ 'This option controls the posting and calculation behavior for the accounting method.' => '',
'This transaction has to be split into several transactions manually.' => '',
'This update will change the nature the onhand of goods is tracked.' => '',
'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => '',
'Weight unit' => '',
'What <b>term</b> you are looking for?' => '',
'What type of item is this?' => '',
- 'Which is located at doc/Kivitendo-Dokumentation.pdf. Click here: ' => '',
+ 'Which is located at doc/kivitendo-Dokumentation.pdf. Click here: ' => '',
'With Extension Of Time' => '',
'Workflow Delivery Order' => '',
'Workflow purchase_order' => '',
'ea' => '',
'emailed to' => '',
'empty' => '',
+ 'every time' => '',
'executed' => '',
'female' => '',
'follow_up_list' => '',
'missing' => '',
'month' => '',
'monthly' => '',
+ 'never' => '',
'new Window' => '',
'next' => '',
'no' => '',
'not yet executed' => '',
'number' => '',
'oe.pl::search called with unknown type' => '',
+ 'on the same day' => '',
'only OB Transactions' => '',
'open' => '',
'order' => '',
+++ /dev/null
-######################################################################
-# SQL-Ledger Accounting
-# Copyright (c) 2003
-#
-# French texts:
-#
-# Author: Sèbastien Brassard <sbrassar.cgocable.ca>
-# Oscar Buijten <oscar@elbie.com>
-# Wolfgang Sourdeau <wolfgang@contre.com>
-# Aguibou KONE <aguibou.kone@rocketmail.com>
-# Jens-Ingo Brodesser <jens-ingo@all2all.org>
-#
-# This program is free software; you can redistribute it and/or modify
-# it under the terms of the GNU General Public License as published by
-# the Free Software Foundation; either version 2 of the License, or
-# (at your option) any later version.
-#
-# This program is distributed in the hope that it will be useful,
-# but WITHOUT ANY WARRANTY; without even the implied warranty of
-# MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
-# GNU General Public License for more details.
-# You should have received a copy of the GNU General Public License
-# along with this program; if not, write to the Free Software
-# Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA.
-#
-#######################################################################
-
+++ /dev/null
-#!/usr/bin/perl
-# -*- coding: utf-8; -*-
-# vim: fenc=utf-8
-
-# These are all the texts to build the translations files.
-# The file has the form of 'english text' => 'foreign text',
-# you can add the translation in this file or in the 'missing' file
-# run locales.pl from this directory to rebuild the translation files
-
-$self->{texts} = {
- ' Date missing!' => '',
- ' Part Number missing!' => '',
- ' missing!' => '',
- '#1 prices were updated.' => '',
- '<%account_number%> -- Your account number' => '',
- '<%bank%> -- Your bank' => '',
- '<%bank_code%> -- Your bank code' => '',
- '<%currency%> -- The selected currency' => '',
- '<%invtotal%> -- Invoice total' => '',
- '<%invtotal_wo_skonto%> -- Invoice total less discount' => '',
- '<%netto_date%> -- Date the payment is due in full' => '',
- '<%skonto_amount%> -- The deductible amount' => '',
- '<%skonto_date%> -- Date the payment is due with discount' => '',
- '<%skonto_in_percent%> -- The discount in percent' => '',
- '<%terms_netto%> -- The number of days for full payment' => '',
- '<%total%> -- Amount payable' => '',
- '<%total_wo_skonto%> -- Amount payable less discount' => '',
- '*/' => '',
- '---please select---' => '',
- '...after loggin in' => '',
- '...done' => '',
- '...on the TODO list' => '',
- '1. Quarter' => '',
- '2. Quarter' => '',
- '3. Quarter' => '',
- '4. Quarter' => '',
- '<b>What</b> do you want to look for?' => '',
- 'A Buchungsgruppe consists of a descriptive name and the account numbers for the income and expense accounts for those four tax zones as well as the inventory account number.' => '',
- 'A group named "Full Access" has been created.' => '',
- 'A group with that name does already exist.' => '',
- 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => '',
- 'A temporary directory could not be created:' => '',
- 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => '',
- 'A temporary file could not be created:' => '',
- 'A unit with this name does already exist.' => '',
- 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => '',
- 'ADDED' => '',
- 'AP' => '',
- 'AP Aging' => '',
- 'AP Transaction' => '',
- 'AP Transaction (abbreviation)' => '',
- 'AP Transaction Storno (one letter abbreviation)' => '',
- 'AP Transaction with Storno (abbreviation)' => '',
- 'AP Transactions' => '',
- 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => '',
- 'AR' => '',
- 'AR Aging' => '',
- 'AR Transaction' => '',
- 'AR Transaction (abbreviation)' => '',
- 'AR Transactions' => '',
- 'ASSETS' => '',
- 'Abrechnungsnummer' => '',
- 'Abteilung' => '',
- 'Account' => '',
- 'Account Category A' => '',
- 'Account Category C' => '',
- 'Account Category E' => '',
- 'Account Category G' => '',
- 'Account Category I' => '',
- 'Account Category L' => '',
- 'Account Category Q' => '',
- 'Account Description missing!' => '',
- 'Account Link AP' => '',
- 'Account Link AP_amount' => '',
- 'Account Link AP_paid' => '',
- 'Account Link AP_tax' => '',
- 'Account Link AR' => '',
- 'Account Link AR_amount' => '',
- 'Account Link AR_paid' => '',
- 'Account Link AR_tax' => '',
- 'Account Link CT_tax' => '',
- 'Account Link IC' => '',
- 'Account Link IC_cogs' => '',
- 'Account Link IC_expense' => '',
- 'Account Link IC_income' => '',
- 'Account Link IC_sale' => '',
- 'Account Link IC_taxpart' => '',
- 'Account Link IC_taxservice' => '',
- 'Account Number' => '',
- 'Account Number already used!' => '',
- 'Account Number missing!' => '',
- 'Account Nummer' => '',
- 'Account Type' => '',
- 'Account Type missing!' => '',
- 'Account deleted!' => '',
- 'Account for fees' => '',
- 'Account for interest' => '',
- 'Account number' => '',
- 'Account number #1, bank code #2, #3' => '',
- 'Account saved!' => '',
- 'Accounting Group deleted!' => '',
- 'Accounting Group saved!' => '',
- 'Accrual' => '',
- 'Active' => '',
- 'Active?' => '',
- 'Add' => '',
- 'Add AP Transaction' => '',
- 'Add AR Transaction' => '',
- 'Add Account' => '',
- 'Add Accounting Group' => '',
- 'Add Accounts Payables Transaction' => '',
- 'Add Accounts Receivables Transaction' => '',
- 'Add Assembly' => '',
- 'Add Buchungsgruppe' => '',
- 'Add Business' => '',
- 'Add Credit Note' => '',
- 'Add Customer' => '',
- 'Add Delivery Order' => '',
- 'Add Department' => '',
- 'Add Dunning' => '',
- 'Add Exchangerate' => '',
- 'Add Follow-Up' => '',
- 'Add Follow-Up for #1' => '',
- 'Add General Ledger Transaction' => '',
- 'Add Group' => '',
- 'Add Language' => '',
- 'Add Lead' => '',
- 'Add License' => '',
- 'Add Part' => '',
- 'Add Payment Terms' => '',
- 'Add Price Factor' => '',
- 'Add Pricegroup' => '',
- 'Add Printer' => '',
- 'Add Project' => '',
- 'Add Purchase Delivery Order' => '',
- 'Add Purchase Order' => '',
- 'Add Quotation' => '',
- 'Add RFQ' => '',
- 'Add Request for Quotation' => '',
- 'Add Sales Delivery Order' => '',
- 'Add Sales Invoice' => '',
- 'Add Sales Order' => '',
- 'Add Service' => '',
- 'Add Storno Credit Note' => '',
- 'Add Transaction' => '',
- 'Add User' => '',
- 'Add Vendor' => '',
- 'Add Vendor Invoice' => '',
- 'Add Warehouse' => '',
- 'Add a new group' => '',
- 'Add and edit units' => '',
- 'Add bank account' => '',
- 'Add custom variable' => '',
- 'Add note' => '',
- 'Add to group' => '',
- 'Add unit' => '',
- 'Address' => '',
- 'Administration' => '',
- 'Administration area' => '',
- 'Advance turnover tax return' => '',
- 'Aktion' => '',
- 'All' => '',
- 'All Accounts' => '',
- 'All Datasets up to date!' => '',
- 'All changes in that file have been reverted.' => '',
- 'All database upgrades have been applied.' => '',
- 'All general ledger entries' => '',
- 'All of the exports you have selected were already closed.' => '',
- 'All reports' => '',
- 'All the selected exports have already been closed, or all of their items have already been executed.' => '',
- 'Allow access' => '',
- 'Allow the following users access to my follow-ups:' => '',
- 'Alternatively you can create a new part which will then be selected.' => '',
- 'Alternatively you can skip this step and create groups yourself.' => '',
- 'Amended Advance Turnover Tax Return' => '',
- 'Amended Advance Turnover Tax Return (Nr. 10)' => '',
- 'Amount' => '',
- 'Amount Due' => '',
- 'Annotations' => '',
- 'Another user with the login #1 does already exist.' => '',
- 'Ap aging on %s' => '',
- 'Application Error. No Format given' => '',
- 'Application Error. Wrong Format' => '',
- 'Applying #1:' => '',
- 'Approximately #1 prices will be updated.' => '',
- 'Apr' => '',
- 'April' => '',
- 'Ar aging on %s' => '',
- 'Are you sure you want to delete Delivery Order Number #1?' => '',
- 'Are you sure you want to delete Invoice Number' => '',
- 'Are you sure you want to delete Order Number' => '',
- 'Are you sure you want to delete Quotation Number' => '',
- 'Are you sure you want to delete Transaction' => '',
- 'Are you sure you want to remove the marked entries from the queue?' => '',
- 'Are you sure you want to update the prices' => '',
- 'Article Code' => '',
- 'Article Code missing!' => '',
- 'As a result, the saved onhand values of the present goods can be stored into a warehouse designated by you, or will be reset for a proper warehouse tracking' => '',
- 'Assemblies' => '',
- 'Assembly Description' => '',
- 'Assembly Number' => '',
- 'Assembly Number missing!' => '',
- 'Asset' => '',
- 'Assets' => '',
- 'Assign new units' => '',
- 'Assign units' => '',
- 'Assistant for general ledger corrections' => '',
- 'Assume Tax Consultant Data in Tax Computation?' => '',
- 'At least' => '',
- 'At least one Perl module that Lx-Office ERP requires for running is not installed on your system.' => '',
- 'At most' => '',
- 'At the moment the transaction looks like this:' => '',
- 'Attach PDF:' => '',
- 'Attachment' => '',
- 'Attachment name' => '',
- 'Attempt to call an undefined sub named \'%s\'' => '',
- 'Audit Control' => '',
- 'Aug' => '',
- 'August' => '',
- 'Authentification database creation' => '',
- 'Authentification tables creation' => '',
- 'Auto Send?' => '',
- 'Automatically created invoice for fee and interest for dunning %s' => '',
- 'Available qty' => '',
- 'BALANCE SHEET' => '',
- 'BIC' => '',
- 'BOM' => '',
- 'BWA' => '',
- 'Back' => '',
- 'Backup Dataset' => '',
- 'Backup file' => '',
- 'Backup of dataset' => '',
- 'Balance' => '',
- 'Balance Sheet' => '',
- 'Bank' => '',
- 'Bank Code' => '',
- 'Bank Code (long)' => '',
- 'Bank Code Number' => '',
- 'Bank Connection Tax Office' => '',
- 'Bank Connections' => '',
- 'Bank accounts' => '',
- 'Bank code' => '',
- 'Bank transfer amount' => '',
- 'Bank transfer payment list for export #1' => '',
- 'Bank transfer via SEPA' => '',
- 'Bank transfers via SEPA' => '',
- 'Base unit' => '',
- 'Basic data' => '',
- 'Batch Printing' => '',
- 'Bcc' => '',
- 'Belegnummer' => '',
- 'Beratername' => '',
- 'Beraternummer' => '',
- 'Best Before' => '',
- 'Bestandskonto' => '',
- 'Bilanz' => '',
- 'Billing Address' => '',
- 'Billing/shipping address (city)' => '',
- 'Billing/shipping address (street)' => '',
- 'Billing/shipping address (zipcode)' => '',
- 'Bin' => '',
- 'Bin From' => '',
- 'Bin List' => '',
- 'Bin To' => '',
- 'Binding to the LDAP server as "#1" failed. Please check config/lx_office.conf.' => '',
- 'Bins saved.' => '',
- 'Bins that have been used in the past cannot be deleted anymore. For these bins there\'s no checkbox in the "Delete" column.' => '',
- 'Birthday' => '',
- 'Bis' => '',
- 'Bis Konto: ' => '',
- 'Body' => '',
- 'Body:' => '',
- 'Books are open' => '',
- 'Books closed up to' => '',
- 'Boolean variables: If the default value is non-empty then the checkbox will be checked by default and unchecked otherwise.' => '',
- 'Both' => '',
- 'Bottom' => '',
- 'Bought' => '',
- 'Buchungsdatum' => '',
- 'Buchungsgruppe' => '',
- 'Buchungsgruppen' => '',
- 'Buchungskonto' => '',
- 'Buchungsnummer' => '',
- 'Business Number' => '',
- 'Business Volume' => '',
- 'Business deleted!' => '',
- 'Business saved!' => '',
- 'CANCELED' => '',
- 'CB Transaction' => '',
- 'CR' => '',
- 'CRM admin' => '',
- 'CRM create customers, vendors and contacts' => '',
- 'CRM follow up' => '',
- 'CRM know how' => '',
- 'CRM notices' => '',
- 'CRM opportunity' => '',
- 'CRM optional software' => '',
- 'CRM other' => '',
- 'CRM search' => '',
- 'CRM send email' => '',
- 'CRM services' => '',
- 'CRM status' => '',
- 'CRM termin' => '',
- 'CRM user' => '',
- 'CSV export -- options' => '',
- 'Calculate' => '',
- 'Can not create that quantity with current stock' => '',
- 'Cancel' => '',
- 'Cancel Accounts Payables Transaction' => '',
- 'Cancel Accounts Receivables Transaction' => '',
- 'Cannot create Lock!' => '',
- 'Cannot delete account!' => '',
- 'Cannot delete customer!' => '',
- 'Cannot delete default account!' => '',
- 'Cannot delete delivery order!' => '',
- 'Cannot delete invoice!' => '',
- 'Cannot delete item!' => '',
- 'Cannot delete order!' => '',
- 'Cannot delete quotation!' => '',
- 'Cannot delete transaction!' => '',
- 'Cannot delete vendor!' => '',
- 'Cannot have a value in both Debit and Credit!' => '',
- 'Cannot post Payment!' => '',
- 'Cannot post Receipt!' => '',
- 'Cannot post a transaction without a value!' => '',
- 'Cannot post invoice for a closed period!' => '',
- 'Cannot post invoice!' => '',
- 'Cannot post payment for a closed period!' => '',
- 'Cannot post payment!' => '',
- 'Cannot post transaction for a closed period!' => '',
- 'Cannot post transaction with a debit and credit entry for the same account!' => '',
- 'Cannot post transaction!' => '',
- 'Cannot process payment for a closed period!' => '',
- 'Cannot remove files!' => '',
- 'Cannot save account!' => '',
- 'Cannot save order!' => '',
- 'Cannot save preferences!' => '',
- 'Cannot save quotation!' => '',
- 'Cannot storno storno invoice!' => '',
- 'Carry over shipping address' => '',
- 'Cash' => '',
- 'Cc' => '',
- 'Change Lx-Office installation settings (all menu entries beneath \'System\')' => '',
- 'Change representative to' => '',
- 'Charge Number' => '',
- 'Charge number' => '',
- 'Chart' => '',
- 'Chart Type' => '',
- 'Chart balance' => '',
- 'Chart of Accounts' => '',
- 'Chart of accounts' => '',
- 'Chartaccounts connected to this Tax:' => '',
- 'Check' => '',
- 'Check Details' => '',
- 'Checks' => '',
- 'Choose Customer' => '',
- 'Choose Outputformat' => '',
- 'Choose Vendor' => '',
- 'Choose a Tax Number' => '',
- 'City' => '',
- 'Cleared Balance' => '',
- 'Clearing Tax Received (No 71)' => '',
- 'Click on login name to edit!' => '',
- 'Close' => '',
- 'Close Books up to' => '',
- 'Close SEPA exports' => '',
- 'Close Window' => '',
- 'Closed' => '',
- 'Collective Orders only work for orders from one customer!' => '',
- 'Comment' => '',
- 'Company' => '',
- 'Company Name' => '',
- 'Compare to' => '',
- 'Configuration of individual TODO items' => '',
- 'Confirm' => '',
- 'Confirm!' => '',
- 'Confirmation' => '',
- 'Contact' => '',
- 'Contact Person' => '',
- 'Contact person (surname)' => '',
- 'Contacts' => '',
- 'Continue' => '',
- 'Contra' => '',
- 'Copies' => '',
- 'Correct taxkey' => '',
- 'Corrections' => '',
- 'Cost Center' => '',
- 'Costs' => '',
- 'Could not copy %s to %s. Reason: %s' => '',
- 'Could not open the file users/members.' => '',
- 'Could not open the old memberfile.' => '',
- 'Could not print dunning.' => '',
- 'Could not rename %s to %s. Reason: %s' => '',
- 'Could not spawn ghostscript.' => '',
- 'Could not spawn the printer command.' => '',
- 'Could not update prices!' => '',
- 'Country' => '',
- 'Create Assembly' => '',
- 'Create Buchungsgruppen' => '',
- 'Create Chart of Accounts' => '',
- 'Create Dataset' => '',
- 'Create Date' => '',
- 'Create a standard group' => '',
- 'Create and edit RFQs' => '',
- 'Create and edit customers and vendors' => '',
- 'Create and edit dunnings' => '',
- 'Create and edit invoices and credit notes' => '',
- 'Create and edit parts, services, assemblies' => '',
- 'Create and edit projects' => '',
- 'Create and edit purchase delivery orders' => '',
- 'Create and edit purchase orders' => '',
- 'Create and edit sales delivery orders' => '',
- 'Create and edit sales orders' => '',
- 'Create and edit sales quotations' => '',
- 'Create and edit vendor invoices' => '',
- 'Create bank transfer' => '',
- 'Create bank transfer via SEPA XML' => '',
- 'Create invoice?' => '',
- 'Create new' => '',
- 'Create tables' => '',
- 'Created by' => '',
- 'Created for' => '',
- 'Created on' => '',
- 'Credit' => '',
- 'Credit (one letter abbreviation)' => '',
- 'Credit Account' => '',
- 'Credit Limit' => '',
- 'Credit Limit exceeded!!!' => '',
- 'Credit Note' => '',
- 'Credit Note Date' => '',
- 'Credit Note Number' => '',
- 'Credit Starting Balance' => '',
- 'Credit Tax' => '',
- 'Credit Tax Account' => '',
- 'Credit note (one letter abbreviation)' => '',
- 'Curr' => '',
- 'Currencies' => '',
- 'Currency' => '',
- 'Current / Next Level' => '',
- 'Current Earnings' => '',
- 'Current unit' => '',
- 'Current value:' => '',
- 'Custom Variables' => '',
- 'Custom variables for module' => '',
- 'Customer' => '',
- 'Customer Name' => '',
- 'Customer Number' => '',
- 'Customer Order Number' => '',
- 'Customer deleted!' => '',
- 'Customer details' => '',
- 'Customer missing!' => '',
- 'Customer not on file or locked!' => '',
- 'Customer not on file!' => '',
- 'Customer saved!' => '',
- 'Customer type' => '',
- 'Customername' => '',
- 'Customernumberinit' => '',
- 'Customers' => '',
- 'Customers and vendors' => '',
- 'Customized Report' => '',
- 'DATEV - Export Assistent' => '',
- 'DATEV Angaben' => '',
- 'DATEV Export' => '',
- 'DATEX - Export Assistent' => '',
- 'DELETED' => '',
- 'DFV-Kennzeichen' => '',
- 'DR' => '',
- 'DUNNING STARTED' => '',
- 'DUNS-Nr' => '',
- 'Database' => '',
- 'Database Administration' => '',
- 'Database Connection Test' => '',
- 'Database Host' => '',
- 'Database User missing!' => '',
- 'Database backups and restorations are disabled in lx_office.conf.' => '',
- 'Database name' => '',
- 'Database template' => '',
- 'Database update error:' => '',
- 'Dataset' => '',
- 'Dataset missing!' => '',
- 'Dataset name' => '',
- 'Dataset upgrade' => '',
- 'Date' => '',
- 'Date Format' => '',
- 'Date Paid' => '',
- 'Date and timestamp variables: If the default value equals \'NOW\' then the current date/current timestamp will be used. Otherwise the default value is copied as-is.' => '',
- 'Date missing!' => '',
- 'Datevautomatik' => '',
- 'Datum von' => '',
- 'Debit' => '',
- 'Debit (one letter abbreviation)' => '',
- 'Debit Account' => '',
- 'Debit Starting Balance' => '',
- 'Debit Tax' => '',
- 'Debit Tax Account' => '',
- 'Debit and credit out of balance!' => '',
- 'Dec' => '',
- 'December' => '',
- 'Decimalplaces' => '',
- 'Decrease' => '',
- 'Default (no language selected)' => '',
- 'Default Accounts' => '',
- 'Default output medium' => '',
- 'Default printer' => '',
- 'Default template format' => '',
- 'Default value' => '',
- 'Defaults saved.' => '',
- 'Delete' => '',
- 'Delete Account' => '',
- 'Delete Contact' => '',
- 'Delete Dataset' => '',
- 'Delete Shipto' => '',
- 'Delete delivery order' => '',
- 'Delete drafts' => '',
- 'Delete group' => '',
- 'Delete transaction' => '',
- 'Delivered' => '',
- 'Delivery Date' => '',
- 'Delivery Order' => '',
- 'Delivery Order Date' => '',
- 'Delivery Order Date missing!' => '',
- 'Delivery Order Number' => '',
- 'Delivery Order deleted!' => '',
- 'Delivery Orders' => '',
- 'Department' => '',
- 'Department deleted!' => '',
- 'Department saved!' => '',
- 'Departments' => '',
- 'Dependency loop detected:' => '',
- 'Deposit' => '',
- 'Description' => '',
- 'Description (Click on Description for details)' => '',
- 'Description missing!' => '',
- 'Description must not be empty!' => '',
- 'Destination BIC' => '',
- 'Destination IBAN' => '',
- 'Destination bin' => '',
- 'Destination warehouse' => '',
- 'Destination warehouse and bin' => '',
- 'Details (one letter abbreviation)' => '',
- 'Difference' => '',
- 'Dimension unit' => '',
- 'Directory' => '',
- 'Discount' => '',
- 'Display' => '',
- 'Display file' => '',
- 'Display options' => '',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => '',
- 'Do you really want to delete AP transaction #1?' => '',
- 'Do you really want to delete AR transaction #1?' => '',
- 'Do you really want to delete GL transaction #1?' => '',
- 'Do you really want to delete this group?' => '',
- 'Do you really want to delete this warehouse?' => '',
- 'Do you want Lx-Office to create a group for access to all functions?' => '',
- 'Do you want to <b>limit</b> your search?' => '',
- 'Do you want to carry this shipping address over to the new purchase order so that the vendor can deliver the goods directly to your customer?' => '',
- 'Do you want to store the existing onhand values into a new warehouse?' => '',
- 'Document' => '',
- 'Documents in the WebDAV repository' => '',
- 'Done' => '',
- 'Download SEPA XML export file' => '',
- 'Download the backup' => '',
- 'Draft saved.' => '',
- 'Drawing' => '',
- 'Driver' => '',
- 'Dropdown Limit' => '',
- 'Due' => '',
- 'Due Date' => '',
- 'Due Date missing!' => '',
- 'Duedate +Days' => '',
- 'Dunning' => '',
- 'Dunning Amount' => '',
- 'Dunning Date' => '',
- 'Dunning Date from' => '',
- 'Dunning Description' => '',
- 'Dunning Description missing in row ' => '',
- 'Dunning Duedate' => '',
- 'Dunning Level' => '',
- 'Dunning Level missing in row ' => '',
- 'Dunning Process Config saved!' => '',
- 'Dunning Process started for selected invoices!' => '',
- 'Dunning number' => '',
- 'Dunning overview' => '',
- 'Dunnings' => '',
- 'During this user migration Lx-Office can create such a group for you and grant all users access to all of Lx-Office\'s functions.' => '',
- 'E-mail' => '',
- 'E-mail Statement to' => '',
- 'E-mail address missing!' => '',
- 'EAN' => '',
- 'EAN-Code' => '',
- 'EB-Wert' => '',
- 'EK' => '',
- 'ELSE' => '',
- 'ELSTER Export (Taxbird)' => '',
- 'ELSTER Export (Winston)' => '',
- 'ELSTER Export nach Winston' => '',
- 'ELSTER Tax Number' => '',
- 'EQUITY' => '',
- 'EU with VAT ID' => '',
- 'EU without VAT ID' => '',
- 'EUER' => '',
- 'EUR' => '',
- 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => '',
- 'Edit' => '',
- 'Edit Access Rights' => '',
- 'Edit Access Rights for Follow-Ups' => '',
- 'Edit Account' => '',
- 'Edit Accounting Group' => '',
- 'Edit Accounts Payables Transaction' => '',
- 'Edit Accounts Receivables Transaction' => '',
- 'Edit Assembly' => '',
- 'Edit Bins' => '',
- 'Edit Buchungsgruppe' => '',
- 'Edit Business' => '',
- 'Edit Credit Note' => '',
- 'Edit Customer' => '',
- 'Edit Department' => '',
- 'Edit Dunning' => '',
- 'Edit Dunning Process Config' => '',
- 'Edit Follow-Up' => '',
- 'Edit Follow-Up for #1' => '',
- 'Edit General Ledger Transaction' => '',
- 'Edit Group' => '',
- 'Edit Language' => '',
- 'Edit Lead' => '',
- 'Edit Part' => '',
- 'Edit Payment Terms' => '',
- 'Edit Preferences for #1' => '',
- 'Edit Price Factor' => '',
- 'Edit Pricegroup' => '',
- 'Edit Printer' => '',
- 'Edit Project' => '',
- 'Edit Purchase Delivery Order' => '',
- 'Edit Purchase Order' => '',
- 'Edit Quotation' => '',
- 'Edit Request for Quotation' => '',
- 'Edit Sales Delivery Order' => '',
- 'Edit Sales Invoice' => '',
- 'Edit Sales Order' => '',
- 'Edit Service' => '',
- 'Edit Storno Credit Note' => '',
- 'Edit Storno Invoice' => '',
- 'Edit User' => '',
- 'Edit Vendor' => '',
- 'Edit Vendor Invoice' => '',
- 'Edit Warehouse' => '',
- 'Edit and delete a group' => '',
- 'Edit bank account' => '',
- 'Edit custom variable' => '',
- 'Edit file' => '',
- 'Edit greetings' => '',
- 'Edit group ' => '',
- 'Edit group membership' => '',
- 'Edit groups' => '',
- 'Edit note' => '',
- 'Edit rights' => '',
- 'Edit templates' => '',
- 'Edit the Delivery Order' => '',
- 'Edit the membership of all users in all groups:' => '',
- 'Edit the purchase_order' => '',
- 'Edit the request_quotation' => '',
- 'Edit the sales_order' => '',
- 'Edit the sales_quotation' => '',
- 'Edit the stylesheet' => '',
- 'Edit units' => '',
- 'Editable' => '',
- 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => '',
- 'Element disabled' => '',
- 'Employee' => '',
- 'Empty transaction!' => '',
- 'Enter a description for this new draft.' => '',
- 'Enter longdescription' => '',
- 'Enter the requested execution date or leave empty for the quickest possible execution:' => '',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => '',
- 'Equity' => '',
- 'Error' => '',
- 'Error in database control file \'%s\': %s' => '',
- 'Error in position #1: You must either assign no stock at all or the full quantity of #2 #3.' => '',
- 'Error in position #1: You must either assign no transfer at all or the full quantity of #2 #3.' => '',
- 'Error in row #1: The quantity you entered is bigger than the stocked quantity.' => '',
- 'Error message from the database driver:' => '',
- 'Error!' => '',
- 'Ertrag' => '',
- 'Ertrag prozentual' => '',
- 'Escape character' => '',
- 'Exact' => '',
- 'Excel' => '',
- 'Exch' => '',
- 'Exchangerate' => '',
- 'Exchangerate Difference' => '',
- 'Exchangerate for payment missing!' => '',
- 'Exchangerate missing!' => '',
- 'Executed' => '',
- 'Execution date' => '',
- 'Execution date from' => '',
- 'Execution date to' => '',
- 'Existing Buchungsgruppen' => '',
- 'Existing Datasets' => '',
- 'Existing pending follow-ups for this item' => '',
- 'Expected Tax' => '',
- 'Expense' => '',
- 'Expense Account' => '',
- 'Expense accno' => '',
- 'Expense/Asset' => '',
- 'Expenses EU with UStId' => '',
- 'Expenses EU without UStId' => '',
- 'Expired licenses' => '',
- 'Expiring in x month(s)' => '',
- 'Export Buchungsdaten' => '',
- 'Export Stammdaten' => '',
- 'Export as CSV' => '',
- 'Export as PDF' => '',
- 'Export date' => '',
- 'Export date from' => '',
- 'Export date to' => '',
- 'Extended' => '',
- 'Extension Of Time' => '',
- 'Factor' => '',
- 'Factor missing!' => '',
- 'Falsches Datumsformat!' => '',
- 'Favorites' => '',
- 'Fax' => '',
- 'Feb' => '',
- 'February' => '',
- 'Fee' => '',
- 'File' => '',
- 'File name' => '',
- 'Files created by Lx-Office\'s "Backup Dataset" function are such files.' => '',
- 'Filter' => '',
- 'Finish' => '',
- 'Fix transaction' => '',
- 'Fix transactions' => '',
- 'Folgekonto' => '',
- 'Follow-Up' => '',
- 'Follow-Up Date' => '',
- 'Follow-Up On' => '',
- 'Follow-Up done' => '',
- 'Follow-Up for' => '',
- 'Follow-Up for user' => '',
- 'Follow-Up saved.' => '',
- 'Follow-Ups' => '',
- 'Follow-up for' => '',
- 'Font' => '',
- 'Font size' => '',
- 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => '',
- 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => '',
- 'For each unit there\'s either no or exactly one base unit. If you chose a base unit then you also have to chose a factor. That way the new unit will be defined as a multiple of the base unit. The base unit must be the "smaller" one. A factor may not be less than 1. Therefore you may define "kg" with the base unit "g" and a factor of "1", but not the other way round.' => '',
- 'Foreign Exchange Gain' => '',
- 'Foreign Exchange Loss' => '',
- 'Foreign Expenses' => '',
- 'Foreign Revenues' => '',
- 'Form details (second row)' => '',
- 'Formula' => '',
- 'Free report period' => '',
- 'Free-form text' => '',
- 'Fristsetzung' => '',
- 'From' => '',
- 'From Date' => '',
- 'Full Access' => '',
- 'Full access to all functions' => '',
- 'Fwd' => '',
- 'GL Transaction' => '',
- 'Gegenkonto' => '',
- 'Gender' => '',
- 'General Ledger' => '',
- 'General Ledger Corrections' => '',
- 'General Ledger Transaction' => '',
- 'General ledger and cash' => '',
- 'General ledger corrections' => '',
- 'Generic Tax Report' => '',
- 'Given Name' => '',
- 'Go one step back' => '',
- 'Go one step forward' => '',
- 'Greeting' => '',
- 'Greetings' => '',
- 'Group' => '',
- 'Group Invoices' => '',
- 'Group Items' => '',
- 'Group deleted!' => '',
- 'Group membership' => '',
- 'Group missing!' => '',
- 'Group saved!' => '',
- 'Groups' => '',
- 'HTML' => '',
- 'HTML Templates' => '',
- 'Hardcopy' => '',
- 'Has serial number' => '',
- 'Header' => '',
- 'Heading' => '',
- 'Help' => '',
- 'Here\'s an example command line:' => '',
- 'Hide by default' => '',
- 'History' => '',
- 'History Search' => '',
- 'History Search Engine' => '',
- 'Homepage' => '',
- 'Host' => '',
- 'However, you can create a new part which will then be selected.' => '',
- 'I' => '',
- 'IBAN' => '',
- 'ID' => '',
- 'ID-Nummer' => '',
- 'II' => '',
- 'III' => '',
- 'IV' => '',
- 'If the automatic creation of invoices for fees and interest is switched on for a dunning level then the following accounts will be used for the invoice.' => '',
- 'If the database user listed above does not have the right to create a database then enter the name and password of the superuser below:' => '',
- 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => '',
- 'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => '',
- 'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => '',
- 'If you want to change any of these parameters then press the "Back" button, edit the file "config/lx_office.conf" and login into the admin module again.' => '',
- 'If you want to delete such a dataset you have to edit the user(s) that are using the dataset in question and have them use another dataset.' => '',
- 'If you want to set up the authentication database yourself then log in to the administration panel. Lx-Office will then create the database and tables for you.' => '',
- 'If you yourself want to upgrade the installation then please read the file "doc/UPGRADE" and follow the steps outlined in this file.' => '',
- 'Image' => '',
- 'Import CSV' => '',
- 'In Lx-Office 2.4.0 the administrator has to enter a list of units in the administrative section.' => '',
- 'In order to do that hit the button "Delete transaction".' => '',
- 'In the latter case the tables needed by Lx-Office will be created in that database.' => '',
- 'In-line' => '',
- 'Inactive' => '',
- 'Include Exchangerate Difference' => '',
- 'Include column headings' => '',
- 'Include empty bins' => '',
- 'Include in Report' => '',
- 'Include in drop-down menus' => '',
- 'Includeable in reports' => '',
- 'Income Statement' => '',
- 'Income accno' => '',
- 'Incoming Payments' => '',
- 'Incoming invoice number' => '',
- 'Incorrect Password!' => '',
- 'Incorrect username or password!' => '',
- 'Increase' => '',
- 'Individual Items' => '',
- 'Information' => '',
- 'Interest' => '',
- 'Interest Rate' => '',
- 'Internal Notes' => '',
- 'International' => '',
- 'Internet' => '',
- 'Introduction of Buchungsgruppen' => '',
- 'Introduction of units' => '',
- 'Inv. Duedate' => '',
- 'Invalid' => '',
- 'Invalid follow-up ID.' => '',
- 'Invalid quantity.' => '',
- 'Invdate' => '',
- 'Invdate from' => '',
- 'Inventory' => '',
- 'Inventory Account' => '',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => '',
- 'Inventory quantity must be zero before you can set this part obsolete!' => '',
- 'Invno.' => '',
- 'Invnumber' => '',
- 'Invnumber missing!' => '',
- 'Invoice' => '',
- 'Invoice (one letter abbreviation)' => '',
- 'Invoice Date' => '',
- 'Invoice Date missing!' => '',
- 'Invoice Duedate' => '',
- 'Invoice Number' => '',
- 'Invoice Number missing!' => '',
- 'Invoice deleted!' => '',
- 'Invoice for fees' => '',
- 'Invoice has already been storno\'d!' => '',
- 'Invoice number' => '',
- 'Invoice with Storno (abbreviation)' => '',
- 'Invoices' => '',
- 'Is this a summary account to record' => '',
- 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => '',
- 'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => '',
- 'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => '',
- 'It may optionally be compressed with "gzip".' => '',
- 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => '',
- 'Item deleted!' => '',
- 'Item not on file!' => '',
- 'Jahresverkehrszahlen neu' => '',
- 'Jan' => '',
- 'January' => '',
- 'Journal' => '',
- 'Jul' => '',
- 'July' => '',
- 'Jump to' => '',
- 'Jun' => '',
- 'June' => '',
- 'KNE-Export erfolgreich!' => '',
- 'KNr. beim Kunden' => '',
- 'Keine Suchergebnisse gefunden!' => '',
- 'Konten' => '',
- 'Kontonummernerweiterung (KNE)' => '',
- 'L' => '',
- 'LIABILITIES' => '',
- 'LP' => '',
- 'LaTeX Templates' => '',
- 'Landscape' => '',
- 'Language' => '',
- 'Language Values' => '',
- 'Language deleted!' => '',
- 'Language missing!' => '',
- 'Language saved!' => '',
- 'Languages' => '',
- 'Last Article Number' => '',
- 'Last Cost' => '',
- 'Last Credit Note Number' => '',
- 'Last Customer Number' => '',
- 'Last Invoice Number' => '',
- 'Last Purchase Delivery Order Number' => '',
- 'Last Purchase Order Number' => '',
- 'Last RFQ Number' => '',
- 'Last Sales Delivery Order Number' => '',
- 'Last Sales Order Number' => '',
- 'Last Sales Quotation Number' => '',
- 'Last Service Number' => '',
- 'Last Transaction' => '',
- 'Last Vendor Number' => '',
- 'Lead' => '',
- 'Leave host and port field empty unless you want to make a remote connection.' => '',
- 'Left' => '',
- 'Liability' => '',
- 'License' => '',
- 'License key' => '',
- 'Licensed to' => '',
- 'Licenses' => '',
- 'Limit part selection' => '',
- 'Line Total' => '',
- 'Line endings' => '',
- 'List' => '',
- 'List Accounting Groups' => '',
- 'List Accounts' => '',
- 'List Businesses' => '',
- 'List Departments' => '',
- 'List Groups' => '',
- 'List Languages' => '',
- 'List Lead' => '',
- 'List Payment Terms' => '',
- 'List Price' => '',
- 'List Price Factors' => '',
- 'List Pricegroups' => '',
- 'List Printer' => '',
- 'List Tax' => '',
- 'List Transactions' => '',
- 'List Warehouses' => '',
- 'List bank accounts' => '',
- 'List export' => '',
- 'List of bank accounts' => '',
- 'List of bank transfers' => '',
- 'List of custom variables' => '',
- 'List open SEPA exports' => '',
- 'Load draft' => '',
- 'Local Tax Office Preferences' => '',
- 'Lock System' => '',
- 'Lockfile created!' => '',
- 'Lockfile removed!' => '',
- 'Login' => '',
- 'Login Name' => '',
- 'Login name missing!' => '',
- 'Logout' => '',
- 'Logout now' => '',
- 'Long Dates' => '',
- 'Long Description' => '',
- 'Lx-Office' => '',
- 'Lx-Office 2.4.0 introduces two new concepts: tax zones and Buchungsgruppen.' => '',
- 'Lx-Office can fix these problems automatically.' => '',
- 'Lx-Office has been switched to group-based access restrictions.' => '',
- 'Lx-Office has found one or more problems in the general ledger.' => '',
- 'Lx-Office is about to update the database <b>#1</b>.' => '',
- 'Lx-Office is now able to manage warehouses instead of just tracking the amount of goods in your system.' => '',
- 'Lx-Office website' => '',
- 'MAILED' => '',
- 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' => '',
- 'Main Preferences' => '',
- 'Make' => '',
- 'Manage license keys' => '',
- 'Mandantennummer' => '',
- 'Mandatory Departments' => '',
- 'Mar' => '',
- 'March' => '',
- 'Margins' => '',
- 'Mark as closed' => '',
- 'Mark as paid?' => '',
- 'Mark closed' => '',
- 'Marked as paid' => '',
- 'Marked entries printed!' => '',
- 'Master Data' => '',
- 'Max. Dunning Level' => '',
- 'May' => '',
- 'May ' => '',
- 'May set the BCC field when sending emails' => '',
- 'Medium Number' => '',
- 'Memo' => '',
- 'Menu' => '',
- 'Message' => '',
- 'Method' => '',
- 'Microfiche' => '',
- 'Minimum Amount' => '',
- 'Miscellaneous' => '',
- 'Missing \'description\' field.' => '',
- 'Missing \'tag\' field.' => '',
- 'Missing Method!' => '',
- 'Missing Tax Authoritys Preferences' => '',
- 'Missing amount' => '',
- 'Missing parameter #1 in call to sub #2.' => '',
- 'Missing parameter (at least one of #1) in call to sub #2.' => '',
- 'Missing taxkeys in invoices with taxes.' => '',
- 'Mitarbeiter' => '',
- 'Mobile1' => '',
- 'Mobile2' => '',
- 'Model' => '',
- 'Module' => '',
- 'Module home page' => '',
- 'Module name' => '',
- 'Monat' => '',
- 'Monthly' => '',
- 'More than one #1 found matching, please be more specific.' => '',
- 'More than one control file with the tag \'%s\' exist.' => '',
- 'Multi mode not supported.' => '',
- 'Multibyte Encoding' => '',
- 'MwSt. inkl.' => '',
- 'Name' => '',
- 'Name missing!' => '',
- 'National' => '',
- 'National Expenses' => '',
- 'National Revenues' => '',
- 'Netto Terms' => '',
- 'New Buchungsgruppe #1' => '',
- 'New Templates' => '',
- 'New Win/Tab' => '',
- 'New assembly' => '',
- 'New bank account' => '',
- 'New contact' => '',
- 'New customer' => '',
- 'New invoice' => '',
- 'New part' => '',
- 'New sales order' => '',
- 'New service' => '',
- 'New unit' => '',
- 'New vendor' => '',
- 'Next Dunning Level' => '',
- 'No' => '',
- 'No %s was found matching the search parameters.' => '',
- 'No Company Address given' => '',
- 'No Company Name given' => '',
- 'No Customer was found matching the search parameters.' => '',
- 'No Database Drivers available!' => '',
- 'No Dataset selected!' => '',
- 'No Vendor was found matching the search parameters.' => '',
- 'No action defined.' => '',
- 'No backup file has been uploaded.' => '',
- 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => '',
- 'No bins have been added to this warehouse yet.' => '',
- 'No customer has been selected yet.' => '',
- 'No data was found.' => '',
- 'No databases have been found on this server.' => '',
- 'No datasets have been selected.' => '',
- 'No dunnings have been selected for printing.' => '',
- 'No entries were found which had no unit assigned to them.' => '',
- 'No group has been selected, or the group does not exist anymore.' => '',
- 'No groups have been added yet.' => '',
- 'No licenses were found that match the search criteria.' => '',
- 'No or an unknown authenticantion module specified in "config/lx_office.conf".' => '',
- 'No part was found matching the search parameters.' => '',
- 'No prices will be updated because no prices have been entered.' => '',
- 'No problems were recognized.' => '',
- 'No transfers were executed in this export.' => '',
- 'No unknown units where found.' => '',
- 'No user has been selected.' => '',
- 'No valid number entered for pricegroup "#1".' => '',
- 'No vendor has been selected yet.' => '',
- 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => '',
- 'No.' => '',
- 'Non-taxable Purchases' => '',
- 'Non-taxable Sales' => '',
- 'None' => '',
- 'Not Discountable' => '',
- 'Not delivered' => '',
- 'Not done yet' => '',
- 'Not obsolete' => '',
- 'Note' => '',
- 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => '',
- 'Notes' => '',
- 'Nothing has been selected for removal.' => '',
- 'Nothing has been selected for transfer.' => '',
- 'Nothing selected!' => '',
- 'Nothing to delete!' => '',
- 'Nov' => '',
- 'November' => '',
- 'Now the user must select a single Buchungsgruppe for each part instead of three distinct accounts.' => '',
- 'Number' => '',
- 'Number Format' => '',
- 'Number missing in Row' => '',
- 'Number of bins' => '',
- 'Number of copies' => '',
- 'Number of entries changed: #1' => '',
- 'Number of new bins' => '',
- 'Number pages' => '',
- 'Number variables: \'PRECISION=n\' forces numbers to be shown with exactly n decimal places.' => '',
- 'OB Transaction' => '',
- 'OBE-Export erfolgreich!' => '',
- 'Obsolete' => '',
- 'Oct' => '',
- 'October' => '',
- 'Off' => '',
- 'Old (on the side)' => '',
- 'On' => '',
- 'On Hand' => '',
- 'On Order' => '',
- 'One or more Perl modules missing' => '',
- 'Only due follow-ups' => '',
- 'Open' => '',
- 'Open Amount' => '',
- 'Open a further Lx-Office Window or Tab' => '',
- 'Open amount' => '',
- 'OpenDocument/OASIS' => '',
- 'Openings' => '',
- 'Optional comment' => '',
- 'Options' => '',
- 'Order' => '',
- 'Order Date' => '',
- 'Order Date missing!' => '',
- 'Order Number' => '',
- 'Order Number missing!' => '',
- 'Order deleted!' => '',
- 'Ordered' => '',
- 'Orientation' => '',
- 'Orphaned' => '',
- 'Other users\' follow-ups' => '',
- 'Other values are ignored.' => '',
- 'Others' => '',
- 'Otherwise all users will only have access to their own settings.' => '',
- 'Otherwise the variable is only available for printing.' => '',
- 'Out of balance transaction!' => '',
- 'Out of balance!' => '',
- 'Output Number Format' => '',
- 'Outputformat' => '',
- 'Overdue sales quotations and requests for quotations' => '',
- 'Own Product' => '',
- 'PAYMENT POSTED' => '',
- 'PDF' => '',
- 'PDF (OpenDocument/OASIS)' => '',
- 'PDF export -- options' => '',
- 'POSTED' => '',
- 'POSTED AS NEW' => '',
- 'PRINTED' => '',
- 'Packing List' => '',
- 'Packing List Date missing!' => '',
- 'Packing List Number missing!' => '',
- 'Packing Lists' => '',
- 'Page #1/#2' => '',
- 'Paid' => '',
- 'Part' => '',
- 'Part Description' => '',
- 'Part Description missing!' => '',
- 'Part Number' => '',
- 'Part Number missing!' => '',
- 'Part description' => '',
- 'Partnumber must not be set to empty!' => '',
- 'Partnumber not unique!' => '',
- 'Parts' => '',
- 'Parts Inventory' => '',
- 'Parts must have an entry type.' => '',
- 'Parts, services and assemblies' => '',
- 'Password' => '',
- 'Payables' => '',
- 'Payment' => '',
- 'Payment Reminder' => '',
- 'Payment Terms' => '',
- 'Payment Terms missing in row ' => '',
- 'Payment Terms saved!' => '',
- 'Payment date missing!' => '',
- 'Payment list as PDF' => '',
- 'Payment posted!' => '',
- 'Payment terms deleted!' => '',
- 'Payments' => '',
- 'Period' => '',
- 'Period:' => '',
- 'Personal settings' => '',
- 'Pg Database Administration' => '',
- 'Phone' => '',
- 'Phone1' => '',
- 'Phone2' => '',
- 'Pick List' => '',
- 'Please Check the bank information for each vendor:' => '',
- 'Please ask your administrator to create warehouses and bins.' => '',
- 'Please enter a license key.' => '',
- 'Please enter a number of licenses.' => '',
- 'Please enter the login for the new user.' => '',
- 'Please enter the name of the database that will be used as the template for the new database:' => '',
- 'Please enter the name of the dataset you want to restore the backup in.' => '',
- 'Please enter the taxnumber in the administration menu user preferences' => '',
- 'Please enter values' => '',
- 'Please insert object dimensions below.' => '',
- 'Please insert your language values below' => '',
- 'Please insert your longdescription below' => '',
- 'Please install the below listed modules or ask your system administrator to.' => '',
- 'Please re-run the analysis for broken general ledger entries by clicking this button:' => '',
- 'Please read the file' => '',
- 'Please select a customer from the list below.' => '',
- 'Please select a part from the list below.' => '',
- 'Please select a vendor from the list below.' => '',
- 'Please select the chart of accounts this installation is using from the list below.' => '',
- 'Please select the database you want to backup' => '',
- 'Please select the source bank account for the transfers:' => '',
- 'Please seletct the dataset you want to delete:' => '',
- 'Please specify a description for the warehouse designated for these goods.' => '',
- 'Plural' => '',
- 'Port' => '',
- 'Portrait' => '',
- 'Post' => '',
- 'Post Payment' => '',
- 'Post payments' => '',
- 'Postscript' => '',
- 'Posustva_coa' => '',
- 'Preferences' => '',
- 'Preferences saved!' => '',
- 'Prefix for the new bins\' names' => '',
- 'Preis' => '',
- 'Preisgruppe' => '',
- 'Preisklasse' => '',
- 'Prepare bank transfer via SEPA XML' => '',
- 'Prepayment' => '',
- 'Preview' => '',
- 'Previous transdate text' => '',
- 'Previous transnumber text' => '',
- 'Price' => '',
- 'Price Factor' => '',
- 'Price Factors' => '',
- 'Price factor deleted!' => '',
- 'Price factor saved!' => '',
- 'Pricegroup' => '',
- 'Pricegroup deleted!' => '',
- 'Pricegroup missing!' => '',
- 'Pricegroup saved!' => '',
- 'Pricegroups' => '',
- 'Print' => '',
- 'Print and Post' => '',
- 'Print dunnings' => '',
- 'Print list' => '',
- 'Print options' => '',
- 'Printer' => '',
- 'Printer Command' => '',
- 'Printer Command missing!' => '',
- 'Printer Description' => '',
- 'Printer deleted!' => '',
- 'Printer saved!' => '',
- 'Printing ... ' => '',
- 'Prior to Lx-Office v2.4.0 the user could enter arbitrary strings as units for parts, services and in invoices, sales quotations etc.' => '',
- 'Prior to Lx-Office v2.4.0 the user had to chose the accounts for each part and service.' => '',
- 'Private E-mail' => '',
- 'Private Phone' => '',
- 'Problem' => '',
- 'Produce Assembly' => '',
- 'Productivity' => '',
- 'Profit Center' => '',
- 'Proforma Invoice' => '',
- 'Program' => '',
- 'Project' => '',
- 'Project Number' => '',
- 'Project Number missing!' => '',
- 'Project Numbers' => '',
- 'Project Transactions' => '',
- 'Project deleted!' => '',
- 'Project not on file!' => '',
- 'Project saved!' => '',
- 'Projects' => '',
- 'Projecttransactions' => '',
- 'Prozentual/Absolut' => '',
- 'Purchase Invoice' => '',
- 'Purchase Order' => '',
- 'Purchase Orders' => '',
- 'Purchase Price' => '',
- 'Purchase Prices' => '',
- 'Purchase delivery order' => '',
- 'Purchase invoices' => '',
- 'Purpose' => '',
- 'Qty' => '',
- 'Qty according to delivery order' => '',
- 'Qty in stock' => '',
- 'Quantity' => '',
- 'Quantity missing.' => '',
- 'Quartal' => '',
- 'Quarter' => '',
- 'Quarterly' => '',
- 'Queue' => '',
- 'Quotation' => '',
- 'Quotation Date' => '',
- 'Quotation Date missing!' => '',
- 'Quotation Number' => '',
- 'Quotation Number missing!' => '',
- 'Quotation deleted!' => '',
- 'Quotations' => '',
- 'Quote chararacter' => '',
- 'Quoted' => '',
- 'RFQ' => '',
- 'RFQ Number' => '',
- 'RFQs' => '',
- 'ROP' => '',
- 'Ranges of numbers' => '',
- 'Ranges of numbers and default accounts' => '',
- 'Re-run analysis' => '',
- 'Receipt' => '',
- 'Receipt posted!' => '',
- 'Receipt, payment, reconciliation' => '',
- 'Receipts' => '',
- 'Receivables' => '',
- 'Rechnungsnummer' => '',
- 'Reconciliation' => '',
- 'Record in' => '',
- 'Recorded Tax' => '',
- 'Recorded taxkey' => '',
- 'Reference' => '',
- 'Reference missing!' => '',
- 'Release From Stock' => '',
- 'Remaining' => '',
- 'Removal' => '',
- 'Removal from Warehouse' => '',
- 'Removal from warehouse' => '',
- 'Removal qty' => '',
- 'Remove' => '',
- 'Remove Draft' => '',
- 'Remove draft when posting' => '',
- 'Remove from group' => '',
- 'Removed spoolfiles!' => '',
- 'Removing marked entries from queue ...' => '',
- 'Rename the group' => '',
- 'Report Positions' => '',
- 'Report about warehouse contents' => '',
- 'Report about warehouse transactions' => '',
- 'Report and misc. Preferences' => '',
- 'Report for' => '',
- 'Reports' => '',
- 'Representative' => '',
- 'Reqdate' => '',
- 'Request for Quotation' => '',
- 'Request for Quotations' => '',
- 'Request quotation' => '',
- 'Requested execution date' => '',
- 'Requested execution date from' => '',
- 'Requested execution date to' => '',
- 'Required by' => '',
- 'Restore Dataset' => '',
- 'Revenue' => '',
- 'Revenue Account' => '',
- 'Revenues EU with UStId' => '',
- 'Revenues EU without UStId' => '',
- 'Right' => '',
- 'SAVED' => '',
- 'SAVED FOR DUNNING' => '',
- 'SCREENED' => '',
- 'SEPA XML download' => '',
- 'SEPA exports:' => '',
- 'Saldo Credit' => '',
- 'Saldo Debit' => '',
- 'Saldo neu' => '',
- 'Saldo per' => '',
- 'Sale Prices' => '',
- 'Sales Invoice' => '',
- 'Sales Invoices' => '',
- 'Sales Order' => '',
- 'Sales Orders' => '',
- 'Sales and purchase invoices with inventory transactions with taxkeys' => '',
- 'Sales delivery order' => '',
- 'Sales invoice number' => '',
- 'Sales invoices' => '',
- 'Sales quotation' => '',
- 'Salesman' => '',
- 'Salesperson' => '',
- 'Same as the quote character' => '',
- 'Sat. Fax' => '',
- 'Sat. Phone' => '',
- 'Satz %' => '',
- 'Save' => '',
- 'Save Draft' => '',
- 'Save account first to insert taxkeys' => '',
- 'Save and AP Transaction' => '',
- 'Save and AR Transaction' => '',
- 'Save and Close' => '',
- 'Save and Invoice' => '',
- 'Save and Order' => '',
- 'Save and Quotation' => '',
- 'Save and RFQ' => '',
- 'Save and close' => '',
- 'Save as new' => '',
- 'Save draft' => '',
- 'Saving the file \'%s\' failed. OS error message: %s' => '',
- 'Screen' => '',
- 'Searchable' => '',
- 'Select' => '',
- 'Select a Customer' => '',
- 'Select a customer' => '',
- 'Select a part' => '',
- 'Select a part or assembly' => '',
- 'Select a period' => '',
- 'Select a vendor' => '',
- 'Select all' => '',
- 'Select federal state...' => '',
- 'Select from one of the items below' => '',
- 'Select from one of the names below' => '',
- 'Select from one of the projects below' => '',
- 'Select postscript or PDF!' => '',
- 'Select tax office...' => '',
- 'Select the chart of accounts in use' => '',
- 'Select the checkboxes that match users to the groups they should belong to.' => '',
- 'Select type of removal' => '',
- 'Select type of transfer' => '',
- 'Selection' => '',
- 'Selection fields: The option field must contain the available options for the selection. Options are separated by \'##\', for example \'Early##Normal##Late\'.' => '',
- 'Sell Price' => '',
- 'Send the backup via Email' => '',
- 'Sep' => '',
- 'Separator chararacter' => '',
- 'September' => '',
- 'Serial No.' => '',
- 'Serial Number' => '',
- 'Service' => '',
- 'Service Items' => '',
- 'Service Number missing!' => '',
- 'Service unit' => '',
- 'Services' => '',
- 'Set Language Values' => '',
- 'Set eMail text' => '',
- 'Setup Menu' => '',
- 'Setup Templates' => '',
- 'Ship to' => '',
- 'Ship via' => '',
- 'Shipping Address' => '',
- 'Shipping Point' => '',
- 'Shipto' => '',
- 'Shopartikel' => '',
- 'Short' => '',
- 'Show' => '',
- 'Show Salesman' => '',
- 'Show TODO list' => '',
- 'Show by default' => '',
- 'Show custom variable search inputs' => '',
- 'Show details' => '',
- 'Show follow ups...' => '',
- 'Show old dunnings' => '',
- 'Show overdue sales quotations and requests for quotations...' => '',
- 'Show your TODO list after loggin in' => '',
- 'Signature' => '',
- 'Since bin is not enforced in the parts data, please specify a bin where goods without a specified bin will be put.' => '',
- 'Skip' => '',
- 'Skonto' => '',
- 'Skonto Terms' => '',
- 'Sold' => '',
- 'Solution' => '',
- 'Source' => '',
- 'Source BIC' => '',
- 'Source IBAN' => '',
- 'Source bank account' => '',
- 'Source bin' => '',
- 'Spoolfile' => '',
- 'Start Dunning Process' => '',
- 'Start analysis' => '',
- 'Start the correction assistant' => '',
- 'Startdate_coa' => '',
- 'Starting Balance' => '',
- 'Statement' => '',
- 'Statement Balance' => '',
- 'Statement sent to' => '',
- 'Statements sent to printer!' => '',
- 'Step 1 of 3: Parts' => '',
- 'Step 2' => '',
- 'Step 2 of 3: Services' => '',
- 'Step 3 of 3: Assemblies' => '',
- 'Step 3 of 3: Default units' => '',
- 'Steuersatz' => '',
- 'Stock' => '',
- 'Stock value' => '',
- 'Storno' => '',
- 'Storno (one letter abbreviation)' => '',
- 'Storno Invoice' => '',
- 'Storno Packing List' => '',
- 'Street' => '',
- 'Stylesheet' => '',
- 'Subject' => '',
- 'Subject:' => '',
- 'Subtotal' => '',
- 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => '',
- 'Sum Credit' => '',
- 'Sum Debit' => '',
- 'Sum for' => '',
- 'Sum per' => '',
- 'Summen- und Saldenliste' => '',
- 'Superuser name' => '',
- 'Supplies' => '',
- 'Switch Menu on / off' => '',
- 'System' => '',
- 'TODO list' => '',
- 'TODO list options' => '',
- 'TOP100' => '',
- 'TOTAL' => '',
- 'Target bank account' => '',
- 'Tax' => '',
- 'Tax Consultant' => '',
- 'Tax Included' => '',
- 'Tax Number' => '',
- 'Tax Number / SSN' => '',
- 'Tax Office' => '',
- 'Tax Office Preferences' => '',
- 'Tax Percent is a number between 0 and 100' => '',
- 'Tax Period' => '',
- 'Tax Position' => '',
- 'Tax collected' => '',
- 'Tax deleted!' => '',
- 'Tax number' => '',
- 'Tax paid' => '',
- 'Tax saved!' => '',
- 'Tax-O-Matic' => '',
- 'Tax-o-matic Account' => '',
- 'Taxaccount_coa' => '',
- 'Taxation' => '',
- 'Taxdescription missing!' => '',
- 'Taxdescription_coa' => '',
- 'Taxes' => '',
- 'Taxkey' => '',
- 'Taxkey missing!' => '',
- 'Taxkey_coa' => '',
- 'Taxkeys and Taxreport Preferences' => '',
- 'Taxlink_coa' => '',
- 'Taxnumber' => '',
- 'Taxrate missing!' => '',
- 'Tel' => '',
- 'Tel.' => '',
- 'Telephone' => '',
- 'Template' => '',
- 'Template Code' => '',
- 'Template Code missing!' => '',
- 'Template database' => '',
- 'Templates' => '',
- 'Terms missing in row ' => '',
- 'Test connection' => '',
- 'Text field' => '',
- 'Text field variables: \'WIDTH=w HEIGHT=h\' sets the width and height of the text field. They default to 30 and 5 respectively.' => '',
- 'Text variables: \'MAXLENGTH=n\' sets the maximum entry length to \'n\'.' => '',
- 'Text, text field and number variables: The default value will be used as-is.' => '',
- 'That export does not exist.' => '',
- 'The \'tag\' field must only consist of alphanumeric characters or the carachters - _ ( )' => '',
- 'The AP transaction #1 has been deleted.' => '',
- 'The AR transaction #1 has been deleted.' => '',
- 'The GL transaction #1 has been deleted.' => '',
- 'The LDAP server "#1:#2" is unreachable. Please check config/lx_office.conf.' => '',
- 'The SEPA export has been created.' => '',
- 'The access rights have been saved.' => '',
- 'The account 3804 already exists, the update will be skipped.' => '',
- 'The account 3804 will not be added automatically.' => '',
- 'The assembly has been created.' => '',
- 'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => '',
- 'The authentication configuration file "config/lx_office.conf" does not exist. This Lx-Office installation has probably not been updated correctly yet. Please contact your administrator.' => '',
- 'The authentication database is not reachable at the moment. Either it hasn\'t been set up yet or the database server might be down. Please contact your administrator.' => '',
- 'The available options depend on the varibale type:' => '',
- 'The backup you upload here has to be a file created with "pg_dump -o -Ft".' => '',
- 'The bank information must not be empty.' => '',
- 'The base unit does not exist or it is about to be deleted in row %d.' => '',
- 'The base unit does not exist.' => '',
- 'The base unit relations must not contain loops (e.g. by saying that unit A\'s base unit is B, B\'s base unit is C and C\'s base unit is A) in row %d.' => '',
- 'The columns "Dunning Duedate", "Total Fees" and "Interest" show data for the previous dunning created for this invoice.' => '',
- 'The config file "config/lx_office.conf" contained invalid Perl code:' => '',
- 'The config file "config/lx_office.conf" was not found.' => '',
- 'The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/lx_office.conf.' => '',
- 'The connection to the authentication database failed:' => '',
- 'The connection to the database could not be established.' => '',
- 'The connection to the template database failed:' => '',
- 'The connection was established successfully.' => '',
- 'The creation of the authentication database failed:' => '',
- 'The custom variable has been deleted.' => '',
- 'The custom variable has been saved.' => '',
- 'The database #1 has been successfully deleted.' => '',
- 'The database for user management and authentication does not exist. You can create let Lx-Office create it with the following parameters:' => '',
- 'The database update/creation did not succeed. The file #1 contained the following error:' => '',
- 'The database upgrade for the introduction of Buchungsgruppen is now complete.' => '',
- 'The database upgrade for the introduction of units is now complete.' => '',
- 'The dataset #1 has been successfully created.' => '',
- 'The dataset backup has been sent via email to #1.' => '',
- 'The dataset has to exist before a restoration can be started.' => '',
- 'The dataset name is missing.' => '',
- 'The default value depends on the variable type:' => '',
- 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => '',
- 'The description is missing.' => '',
- 'The description is shown on the form. Chose something short and descriptive.' => '',
- 'The directory "%s" could not be created:\n%s' => '',
- 'The directory %s does not exist.' => '',
- 'The dunning process started' => '',
- 'The dunnings have been printed.' => '',
- 'The email address is missing.' => '',
- 'The factor is missing in row %d.' => '',
- 'The factor is missing.' => '',
- 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => '',
- 'The follow-up date is missing.' => '',
- 'The following Buchungsgruppen have already been created:' => '',
- 'The following Datasets need to be updated' => '',
- 'The following drafts have been saved and can be loaded.' => '',
- 'The following transaction contains wrong taxes:' => '',
- 'The following transaction contains wrong taxkeys:' => '',
- 'The following units are unknown.' => '',
- 'The following units exist already:' => '',
- 'The following users have been migrated into the authentication database:' => '',
- 'The following warnings occured during an upgrade to the document templates:' => '',
- 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => '',
- 'The greetings have been saved.' => '',
- 'The group has been added.' => '',
- 'The group has been deleted.' => '',
- 'The group has been saved.' => '',
- 'The group memberships have been saved.' => '',
- 'The group name is missing.' => '',
- 'The licensing module has been deactivated in lx_office.conf.' => '',
- 'The list has been printed.' => '',
- 'The login is missing.' => '',
- 'The name in row %d has already been used before.' => '',
- 'The name is missing in row %d.' => '',
- 'The name is missing.' => '',
- 'The name must only consist of letters, numbers and underscores and start with a letter.' => '',
- 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => '',
- 'The option field is empty.' => '',
- 'The parts for this delivery order have already been transferred in.' => '',
- 'The parts for this delivery order have already been transferred out.' => '',
- 'The parts have been removed.' => '',
- 'The parts have been stocked.' => '',
- 'The parts have been transferred.' => '',
- 'The payments have been posted.' => '',
- 'The pg_dump process could not be started.' => '',
- 'The pg_restore process could not be started.' => '',
- 'The preferred one is to install packages provided by your operating system distribution (e.g. Debian or RPM packages).' => '',
- 'The program\'s exit code was #1 ("0" usually means that everything went OK).' => '',
- 'The project has been added.' => '',
- 'The project has been saved.' => '',
- 'The restoration process has started. Here\'s the output of the "pg_restore" command:' => '',
- 'The restoration process is complete. Please review "pg_restore"\'s output to find out if the restoration was successful.' => '',
- 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => '',
- 'The second way is to use Perl\'s CPAN module and let it download and install the module for you.' => '',
- 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => '',
- 'The selected bank account does not exist anymore.' => '',
- 'The selected bin does not exist.' => '',
- 'The selected exports have been closed.' => '',
- 'The selected warehouse does not exist.' => '',
- 'The selected warehouse is empty.' => '',
- 'The session is invalid or has expired.' => '',
- 'The source warehouse does not contain any bins.' => '',
- 'The subject is missing.' => '',
- 'The tables for user management and authentication do not exist. They will be created in the next step in the following database:' => '',
- 'The tabulator character' => '',
- 'The third way is to download the module from the above mentioned URL and to install the module manually following the installations instructions contained in the source archive.' => '',
- 'The transaction is shown below in its current state.' => '',
- 'The unit has been saved.' => '',
- 'The unit in row %d has been deleted in the meantime.' => '',
- 'The unit in row %d has been used in the meantime and cannot be changed anymore.' => '',
- 'The units have been saved.' => '',
- 'The user has been added to this group.' => '',
- 'The user has been removed from this group.' => '',
- 'The user is a member in the following group(s):' => '',
- 'The user migration process is complete.' => '',
- 'The variable name must only consist of letters, numbers and underscores. It must begin with a letter. Example: send_christmas_present' => '',
- 'The warehouse could not be deleted because it has already been used.' => '',
- 'The warehouse does not contain any bins.' => '',
- 'The warehouse or the bin is missing.' => '',
- 'The wrong taxkeys for AP and AR transactions have been fixed.' => '',
- 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => '',
- 'The wrong taxkeys have been fixed.' => '',
- 'There are #1 more open invoices for this customer with other currencies.' => '',
- 'There are #1 more open invoices from this vendor with other currencies.' => '',
- 'There are #1 unfinished follow-ups of which #2 are due.' => '',
- 'There are bookings to the account 3803 after 01.01.2007. If you didn\'t change this account manually to 19% the bookings are probably incorrect.' => '',
- 'There are four tax zones.' => '',
- 'There are no items in stock.' => '',
- 'There are no items on your TODO list at the moment.' => '',
- 'There are still entries in the database for which no unit has been assigned.' => '',
- 'There are usually three ways to install Perl modules.' => '',
- 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => '',
- 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => '',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, #5, for the transfer of #6.' => '',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, for the transfer of #5.' => '',
- 'There is not enough left of \'#1\' in bin \'#2\' for the removal of #3.' => '',
- 'There is nothing to do in this step.' => '',
- 'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => '',
- 'These units can be based on other units so that Lx-Office can convert prices when the user switches from one unit to another.' => '',
- 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => '',
- 'These wrong entries cannot be fixed automatically.' => '',
- 'This corresponds to Lx-Office\'s behavior prior to version 2.4.4.' => '',
- 'This could have happened for two reasons:' => '',
- 'This customer number is already in use.' => '',
- 'This group will be called "Full Access".' => '',
- 'This installation uses an unknown chart of accounts ("#1"). This database upgrade cannot create standard buchungsgruppen automatically.' => '',
- 'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => '',
- 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => '',
- 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => '',
- 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => '',
- 'This transaction has to be split into several transactions manually.' => '',
- 'This update will change the nature the onhand of goods is tracked.' => '',
- 'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => '',
- 'This upgrade script tries to map all existing units in the database to the newly created units.' => '',
- 'This vendor number is already in use.' => '',
- 'Time period for the analysis:' => '',
- 'Timestamp' => '',
- 'Title' => '',
- 'To' => '',
- 'To (email)' => '',
- 'To (time)' => '',
- 'To Date' => '',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => '',
- 'Top' => '',
- 'Top (CSS)' => '',
- 'Top (CSS) new' => '',
- 'Top (Javascript)' => '',
- 'Top 100' => '',
- 'Top 100 hinzufuegen' => '',
- 'Top Level' => '',
- 'Total' => '',
- 'Total Fees' => '',
- 'Total stock value' => '',
- 'Totals' => '',
- 'Trade Discount' => '',
- 'Trans Id' => '',
- 'Trans Type' => '',
- 'Transaction' => '',
- 'Transaction %d cancelled.' => '',
- 'Transaction Date missing!' => '',
- 'Transaction ID missing.' => '',
- 'Transaction deleted!' => '',
- 'Transaction description' => '',
- 'Transaction has already been cancelled!' => '',
- 'Transaction has been split on both the credit and the debit side' => '',
- 'Transaction posted!' => '',
- 'Transactions, AR transactions, AP transactions' => '',
- 'Transdate' => '',
- 'Transfer' => '',
- 'Transfer Quantity' => '',
- 'Transfer To Stock' => '',
- 'Transfer from warehouse' => '',
- 'Transfer in' => '',
- 'Transfer out' => '',
- 'Transfer qty' => '',
- 'Translation (%s)' => '',
- 'Trial Balance' => '',
- 'Trial balance between %s and %s' => '',
- 'Trying to call a sub without a name' => '',
- 'Type' => '',
- 'Type of Business' => '',
- 'Type of Customer' => '',
- 'Type of Vendor' => '',
- 'USTVA' => '',
- 'USTVA 2004' => '',
- 'USTVA 2005' => '',
- 'USTVA 2006' => '',
- 'USTVA 2007' => '',
- 'USTVA-Hint: Method' => '',
- 'USTVA-Hint: Tax Authoritys' => '',
- 'USt-IdNr.' => '',
- 'USt-Konto' => '',
- 'UStVA' => '',
- 'UStVA (PDF-Dokument)' => '',
- 'UStVa' => '',
- 'UStVa Einstellungen' => '',
- 'Unbalanced Ledger' => '',
- 'Unchecked custom variables will not appear in orders and invoices.' => '',
- 'Unfinished follow-ups' => '',
- 'Unit' => '',
- 'Unit missing.' => '',
- 'Unit of measure' => '',
- 'Units marked for deletion will be deleted upon saving.' => '',
- 'Units that have already been used (e.g. for parts and services or in invoices or warehouse transactions) cannot be changed.' => '',
- 'Unknown Category' => '',
- 'Unknown Link' => '',
- 'Unknown chart of accounts' => '',
- 'Unknown dependency \'%s\'.' => '',
- 'Unknown problem type.' => '',
- 'Unlock System' => '',
- 'Until' => '',
- 'Update' => '',
- 'Update Dataset' => '',
- 'Update Prices' => '',
- 'Update SKR04: new tax account 3804 (19%)' => '',
- 'Update complete' => '',
- 'Update prices' => '',
- 'Update?' => '',
- 'Updated' => '',
- 'Use As Template' => '',
- 'Use Templates' => '',
- 'User' => '',
- 'User Config' => '',
- 'User data migration' => '',
- 'User deleted!' => '',
- 'User migration complete' => '',
- 'User name' => '',
- 'User saved!' => '',
- 'Username' => '',
- 'Members of' => '',
- 'Members not of' => '',
- 'Ust-IDNr' => '',
- 'Valid from' => '',
- 'Valid until' => '',
- 'Value' => '',
- 'Variable' => '',
- 'Vendor' => '',
- 'Vendor Invoice' => '',
- 'Vendor Invoices' => '',
- 'Vendor Name' => '',
- 'Vendor Number' => '',
- 'Vendor Order Number' => '',
- 'Vendor deleted!' => '',
- 'Vendor details' => '',
- 'Vendor missing!' => '',
- 'Vendor not on file or locked!' => '',
- 'Vendor not on file!' => '',
- 'Vendor saved!' => '',
- 'Vendor type' => '',
- 'Vendors' => '',
- 'Verrechnungseinheit' => '',
- 'Version' => '',
- 'View License' => '',
- 'View SEPA export' => '',
- 'View warehouse content' => '',
- 'View/edit all employees sales documents' => '',
- 'Von Konto: ' => '',
- 'WHJournal' => '',
- 'Warehouse' => '',
- 'Warehouse From' => '',
- 'Warehouse Migration' => '',
- 'Warehouse To' => '',
- 'Warehouse content' => '',
- 'Warehouse deleted.' => '',
- 'Warehouse management' => '',
- 'Warehouse saved.' => '',
- 'Warehouses' => '',
- 'Warnings during template upgrade' => '',
- 'WebDAV link' => '',
- 'Weight' => '',
- 'Weight unit' => '',
- 'What <b>term</b> you are looking for?' => '',
- 'What type of item is this?' => '',
- 'With Extension Of Time' => '',
- 'Workflow Delivery Order' => '',
- 'Workflow purchase_order' => '',
- 'Workflow request_quotation' => '',
- 'Workflow sales_order' => '',
- 'Workflow sales_quotation' => '',
- 'Wrong Period' => '',
- 'Wrong date format!' => '',
- 'Wrong tax keys recorded' => '',
- 'Wrong taxes recorded' => '',
- 'YYYY' => '',
- 'Year' => '',
- 'Year End' => '',
- 'Yearly' => '',
- 'Yearly taxreport not yet implemented' => '',
- 'Yes' => '',
- 'Yes, included by default' => '',
- 'Yes/No (Checkbox)' => '',
- 'You are logged out!' => '',
- 'You can also create new units now.' => '',
- 'You can also delete this transaction and re-enter it manually.' => '',
- 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => '',
- 'You can create a missing dataset by going back and chosing "Create Dataset".' => '',
- 'You can create warehouses and bins via the menu "System -> Warehouses".' => '',
- 'You can declare different translations for singular and plural for each unit (e.g. "day" and "days).' => '',
- 'You can either create a new database or chose an existing database.' => '',
- 'You can only delete datasets that are not in use.' => '',
- 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => '',
- 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => '',
- 'You cannot continue before all required modules are installed.' => '',
- 'You cannot continue until all unknown units have been mapped to known ones.' => '',
- 'You cannot create an invoice for delivery orders for different customers.' => '',
- 'You cannot create an invoice for delivery orders from different vendors.' => '',
- 'You did not enter a name!' => '',
- 'You do not have the permissions to access this function.' => '',
- 'You have entered or selected the following shipping address for this customer:' => '',
- 'You have not added bank accounts yet.' => '',
- 'You have not selected any delivery order.' => '',
- 'You have not selected any export.' => '',
- 'You have not selected any item.' => '',
- 'You have selected none of the invoices.' => '',
- 'You have to chose a dimension unit and a service unit which will then be assigned to those entries.' => '',
- 'You have to chose which unit to save for each of them.' => '',
- 'You have to create at least one group, grant it access to Lx-Office\'s functions and assign users to it.' => '',
- 'You have to create new Buchungsgruppen for all the combinations of inventory, income and expense accounts that have been used already.' => '',
- 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => '',
- 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => '',
- 'You have to specify a department.' => '',
- 'You have to specify an execution date for each antry.' => '',
- 'You must chose a user.' => '',
- 'You should create a backup of the database before proceeding because the backup might not be reversible.' => '',
- 'You will now be forwarded to the administration panel.' => '',
- 'You\'re not editing a file.' => '',
- 'You\'ve already chosen the following limitations:' => '',
- 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => '',
- 'Your TODO list' => '',
- 'Your browser does not currently support Javascript.' => '',
- 'Your download does not exist anymore. Please re-run the DATEV export assistant.' => '',
- 'Zeitpunkt' => '',
- 'Zeitraum' => '',
- 'Zero amount posting!' => '',
- 'Zip, City' => '',
- 'Zipcode' => '',
- 'Zusatz' => '',
- '[email]' => '',
- 'account_description' => '',
- 'accrual' => '',
- 'all entries' => '',
- 'ap_aging_list' => '',
- 'ar_aging_list' => '',
- 'as at' => '',
- 'assembly_list' => '',
- 'back' => '',
- 'bank_transfer_payment_list_#1' => '',
- 'bankaccounts' => '',
- 'banktransfers' => '',
- 'bestbefore #1' => '',
- 'bin_list' => '',
- 'bis' => '',
- 'button' => '',
- 'cash' => '',
- 'chargenumber #1' => '',
- 'chart_of_accounts' => '',
- 'choice' => '',
- 'choice part' => '',
- 'click here to edit cvars' => '',
- 'close' => '',
- 'closed' => '',
- 'config/lx_office.conf: Key "DB_config" is missing.' => '',
- 'config/lx_office.conf: Key "LDAP_config" is missing.' => '',
- 'config/lx_office.conf: Missing parameters in "DB_config". Required parameters are "host", "db" and "user".' => '',
- 'config/lx_office.conf: Missing parameters in "LDAP_config". Required parameters are "host", "attribute" and "base_dn".' => '',
- 'continue' => '',
- 'correction' => '',
- 'cp_greeting to cp_gender migration' => '',
- 'customer' => '',
- 'customer_list' => '',
- 'debug' => '',
- 'delete' => '',
- 'deliverydate' => '',
- 'direct debit' => '',
- 'disposed' => '',
- 'done' => '',
- 'down' => '',
- 'dunning_list' => '',
- 'eMail Send?' => '',
- 'eMail?' => '',
- 'ea' => '',
- 'emailed to' => '',
- 'executed' => '',
- 'female' => '',
- 'follow_up_list' => '',
- 'for' => '',
- 'for Period' => '',
- 'found' => '',
- 'from (time)' => '',
- 'general_ledger_list' => '',
- 'history' => '',
- 'history search engine' => '',
- 'invoice' => '',
- 'invoice_list' => '',
- 'lead deleted!' => '',
- 'lead saved!' => '',
- 'list' => '',
- 'list_of_payments' => '',
- 'list_of_receipts' => '',
- 'list_of_transactions' => '',
- 'logout' => '',
- 'male' => '',
- 'mark as paid' => '',
- 'missing' => '',
- 'month' => '',
- 'new Window' => '',
- 'no' => '',
- 'no bestbefore' => '',
- 'no chargenumber' => '',
- 'none (pricegroup)' => '',
- 'not executed' => '',
- 'not transferred in yet' => '',
- 'not transferred out yet' => '',
- 'not yet executed' => '',
- 'number' => '',
- 'oe.pl::search called with unknown type' => '',
- 'open' => '',
- 'order' => '',
- 'our vendor number at customer' => '',
- 'packing_list' => '',
- 'part_list' => '',
- 'pick_list' => '',
- 'plural first char' => '',
- 'pos_bilanz' => '',
- 'pos_bwa' => '',
- 'pos_eur' => '',
- 'pos_ustva' => '',
- 'posted!' => '',
- 'print' => '',
- 'proforma' => '',
- 'project_list' => '',
- 'purchase_delivery_order_list' => '',
- 'purchase_order' => '',
- 'purchase_order_list' => '',
- 'quarter' => '',
- 'quotation_list' => '',
- 'release_material' => '',
- 'report_generator_dispatch_to is not defined.' => '',
- 'report_generator_nextsub is not defined.' => '',
- 'request_quotation' => '',
- 'reset' => '',
- 'return_material' => '',
- 'rfq_list' => '',
- 'sales tax identification number' => '',
- 'sales_delivery_order_list' => '',
- 'sales_order' => '',
- 'sales_order_list' => '',
- 'sales_quotation' => '',
- 'saved' => '',
- 'saved!' => '',
- 'sent' => '',
- 'sent to printer' => '',
- 'service_list' => '',
- 'shipped' => '',
- 'singular first char' => '',
- 'soldtotal' => '',
- 'stock' => '',
- 'submit' => '',
- 'tax_chartaccno' => '',
- 'tax_percent' => '',
- 'tax_rate' => '',
- 'tax_taxdescription' => '',
- 'tax_taxkey' => '',
- 'taxnumber' => '',
- 'to (date)' => '',
- 'to (time)' => '',
- 'transfer' => '',
- 'transferred in' => '',
- 'transferred out' => '',
- 'trial_balance' => '',
- 'up' => '',
- 'use program settings' => '',
- 'used' => '',
- 'valid from' => '',
- 'vendor' => '',
- 'vendor_invoice_list' => '',
- 'vendor_list' => '',
- 'warehouse_journal_list' => '',
- 'warehouse_report_list' => '',
- 'wrongformat' => '',
- 'yes' => '',
-};
-
-1;
+++ /dev/null
-# These are all the texts to build the translations files.
-# The file has the form of 'english text' => 'foreign text',
-# you can add the translation in this file or in the 'missing' file
-# run locales.pl from this directory to rebuild the translation files
-
-$self{texts} = {
- 'AP' => 'Dépenses',
- 'AP Aging' => 'Dépenses exigibles',
- 'AP Transaction' => 'Ecriture Dépense',
- 'AP Transactions' => 'Mouvements - Dépenses',
- 'AR' => 'Recettes',
- 'AR Aging' => 'Recettes exigibles',
- 'AR Transaction' => 'Ecriture Recette',
- 'AR Transactions' => 'Mouvements - Recettes',
- 'About' => 'A propos',
- 'Access Control' => 'Contrôle d\'accès',
- 'Account' => 'Compte',
- 'Account Number' => 'Numéro de compte',
- 'Account Number missing!' => 'Numéro de compte manquant!',
- 'Account Type' => 'Type de compte',
- 'Account Type missing!' => 'Type de compte manquant!',
- 'Account deleted!' => 'Compte supprimé',
- 'Account saved!' => 'Compte enregistré',
- 'Accounting' => 'Comptabilité',
- 'Accounting Menu' => 'Menu de comptabilité',
- 'Accounts' => 'Comptes',
- 'Active' => 'Actif',
- 'Add' => 'Ajouter',
- 'Add Account' => 'Ajouter compte',
- 'Add Accounts Payables Transaction' => 'Saisie d\'écriture - Dépenses',
- 'Add Accounts Receivables Transaction' => 'Saisie d\'écriture - Recettes',
- 'Add Assembly' => 'Ajouter produit',
- 'Add Customer' => 'Ajouter client',
- 'Add GIFI' => 'Ajouter Code d\'Identification Comptable ou Fiscale',
- 'Add General Ledger Transaction' => 'Ajouter une écriture au Grand Livre',
- 'Add Group' => 'Ajouter group',
- 'Add Part' => 'Ajouter marchandise',
- 'Add Project' => 'Ajouter projet',
- 'Add Purchase Order' => 'Etablir commande d\'achat',
- 'Add Sales Invoice' => 'Etablir facture de vente',
- 'Add Sales Order' => 'Etablir commande de vente',
- 'Add Service' => 'Ajouter service',
- 'Add Transaction' => 'Saisie d\'écriture',
- 'Add User' => 'Ajouter utilisateur',
- 'Add Vendor' => 'Ajouter fournisseur',
- 'Add Vendor Invoice' => 'Etablir facture de vente',
- 'Address' => 'Adresse',
- 'Administration' => 'Administration',
- 'Administrator' => 'Administrateur',
- 'All' => 'Tous',
- 'All Datasets up to date!' => 'Tous les fichiers de données sont à jour!',
- 'Amount' => 'Total',
- 'Amount Due' => 'Montant dû',
- 'Amount does not equal applied!' => 'Le montant n\'est égal à celui appliqué!',
- 'Amount missing!' => 'Montant manquant',
- 'Applied' => 'Appliquer',
- 'Apr' => 'Avril',
- 'April' => 'Avril',
- 'Are you sure you want to delete Invoice Number' => 'Êtes-vous sûr de vouloir supprimer la Facture N°',
- 'Are you sure you want to delete Order Number' => 'Êtes vous sûr de vouloir supprimer Commande N°',
- 'Are you sure you want to delete Transaction' => 'Êtes vous sûr de vouloir effacer la saisie?',
- 'Assemblies' => 'Produits finis',
- 'Assemblies restocked!' => 'Renvoyer produits vers stock!',
- 'Assembly Number missing!' => 'Numéro de produit manquant',
- 'Asset' => 'Actif',
- 'Attachment' => 'Pièce jointe',
- 'Audit Control' => 'Clôture périodique',
- 'Aug' => 'Août',
- 'August' => 'Août',
- 'BOM' => 'Nomenclature composantes',
- 'Backup' => 'Sauvegarder',
- 'Backup sent to' => 'Sauvegarde envoyée à',
- 'Balance' => 'Solde',
- 'Balance Sheet' => 'Bilan',
- 'Bcc' => 'Bcc',
- 'Bin' => 'Localisation',
- 'Books are open' => 'Début exercice',
- 'Bought' => 'Acheté',
- 'Business Number' => 'Numéro d\'enregistrement société',
- 'C' => 'C',
- 'COGS' => 'CMV',
- 'Cannot delete account!' => 'Impossible de supprimer le compte!',
- 'Cannot delete customer!' => 'Impossible de supprimer le client!',
- 'Cannot delete default account!' => 'Ne peut pas supprimer le compte par defaut!',
- 'Cannot delete invoice!' => 'Impossible de supprimer la facture',
- 'Cannot delete item!' => 'Impossible de supprimer ce poste!',
- 'Cannot delete order!' => 'Impossible de supprimer la commande!',
- 'Cannot delete transaction!' => 'Impossible de supprimer la saisie!',
- 'Cannot delete vendor!' => 'Impossible de supprimer le fournisseur!',
- 'Cannot have a value in both Debit and Credit!' => 'Impossible d\'avoir des valeurs dans Crédit et Débit en même temps!',
- 'Cannot post a transaction without a value!' => 'Impossible d\'effectuer une écriture sans valeur!',
- 'Cannot post invoice for a closed period!' => 'Impossible d\'enregistrer la facture sur un exercice clos!',
- 'Cannot post invoice!' => 'Impossible d\'enregistrer la facture!',
- 'Cannot post payment for a closed period!' => 'Impossible d\'enregistrer le paiement sur un exercice clos!',
- 'Cannot post payment!' => 'Impossible d\'enregistrer le paiement!',
- 'Cannot post transaction for a closed period!' => 'Impossible d\'enregistrer l\'écriture sur un exercice clos!',
- 'Cannot post transaction!' => 'Impossible d\'enregistrer l\'écriture!',
- 'Cannot process payment for a closed period!' => 'Impossible de faire un paiement sur un exercice clos!',
- 'Cannot save account!' => 'Impossible d\'enregistrer le compte!',
- 'Cannot save order!' => 'Impossible d\'enregistrer la commande!',
- 'Cannot save preferences!' => 'Impossible d\'enregistrer les préférences',
- 'Cannot stock assemblies!' => 'Impossible de stocker l\'assemblage!',
- 'Cash' => 'Financier',
- 'Cash based' => 'En liquide',
- 'Cc' => 'Cc',
- 'Change Admin Password' => 'Changement de mot de passe administrateur',
- 'Change Password' => 'Changement de mot de passe',
- 'Character Set' => 'Encodage des caractères',
- 'Chart of Accounts' => 'Plan Comptable',
- 'Check' => 'Chèque',
- 'Check printed!' => 'Chèque imprimé!',
- 'Check printing failed!' => 'Impression du chèque échoué!',
- 'Cleared Balance' => 'Solde rapproché',
- 'Click on login name to edit!' => 'Cliquer sur votre identifiant pour editer',
- 'Close Books up to' => 'Clôturer l\'exercice jusqu\'au',
- 'Closed' => 'Clôturé',
- 'Company' => 'Société',
- 'Compare to' => 'Comparer à',
- 'Confirm!' => 'Confirmez!',
- 'Connect to' => 'Connecter à',
- 'Contact' => 'Contact',
- 'Continue' => 'Continuer',
- 'Copies' => 'Copies',
- 'Copy to COA' => 'Copier dans le Plan Comptable',
- 'Create Chart of Accounts' => 'Créer le Plan Comptable',
- 'Create Dataset' => 'Créer fichier de données',
- 'Credit' => 'Crédit',
- 'Credit Limit' => 'Encours autorisé',
- 'Curr' => 'En cours',
- 'Currency' => 'Devise',
- 'Current' => 'En cours',
- 'Customer' => 'Client',
- 'Customer deleted!' => 'Client supprimé!',
- 'Customer missing!' => 'Client manquant!',
- 'Customer not on file!' => 'Client absent du fichier!',
- 'Customer saved!' => 'Client enregistré!',
- 'Customers' => 'Clients',
- 'DBI not installed!' => 'DBI non installée!',
- 'Database' => 'Base de données',
- 'Database Administration' => 'Gérer base de données',
- 'Database Driver not checked!' => 'Pilotes de base de données pas verifiés!',
- 'Database Host' => 'Hôte de base de données',
- 'Database User missing!' => 'Utilisateur base de données manquante!',
- 'Dataset' => 'Fichier de données',
- 'Dataset missing!' => 'Fichier de données manquant!',
- 'Dataset updated!' => 'Base de données mise à jour!',
- 'Date' => 'Date',
- 'Date Format' => 'Format de Date',
- 'Date Paid' => 'Date de paiement',
- 'Date missing!' => 'Date manquante!',
- 'Debit' => 'Débit',
- 'Debit and credit out of balance!' => 'Le débit et le crédit ne sont pas équilibrés!',
- 'Dec' => 'Déc.',
- 'December' => 'Décembre',
- 'Decimalplaces' => 'Décimales',
- 'Delete' => 'Supprimer',
- 'Delete Account' => 'Supprimer compte',
- 'Delete Dataset' => 'Supprimer fichier de données',
- 'Delivery Date' => 'Date de livraison',
- 'Deposit' => 'Dépôt',
- 'Description' => 'Description',
- 'Difference' => 'Différence',
- 'Directory' => 'Répertoire',
- 'Discount' => 'Remise',
- 'Done' => 'Fait!',
- 'Drawing' => 'Dessin',
- 'Driver' => 'Pilote',
- 'Dropdown Limit' => 'Limit de déroulement',
- 'Due' => 'Echéance',
- 'Due Date' => 'Date d\'échéance',
- 'Due Date missing!' => 'Date d\'échéance manquante!',
- 'E-mail' => 'Email',
- 'E-mail Statement to' => 'Message éléctronique à',
- 'E-mail address missing!' => 'Adresse email manquante!',
- 'Edit' => 'Modifier',
- 'Edit Account' => 'Modifier le compte',
- 'Edit Accounts Payables Transaction' => 'Modifier Mouvements - Dépenses',
- 'Edit Accounts Receivables Transaction' => 'Modifier Mouvements - Recettes',
- 'Edit Assembly' => 'Modifier produit fini / transformé',
- 'Edit Customer' => 'Modifier client',
- 'Edit GIFI' => 'Modifier Code d\'Identification Comptable ou Fiscale',
- 'Edit General Ledger Transaction' => 'Modifier écriture Grand Livre',
- 'Edit Group' => 'Modifier groupe',
- 'Edit Part' => 'Modifier marchandise',
- 'Edit Preferences for' => 'Modifier les préférences pour',
- 'Edit Project' => 'Modifier projet',
- 'Edit Purchase Order' => 'Modifier commande d\'achat',
- 'Edit Sales Invoice' => 'Modifier facture de vente',
- 'Edit Sales Order' => 'Modifier commande de vente',
- 'Edit Service' => 'Modifier service',
- 'Edit Template' => 'Modifier modèle',
- 'Edit User' => 'Modifier utilisateur',
- 'Edit Vendor' => 'Modifier fournisseur',
- 'Edit Vendor Invoice' => 'Modifier facture de fournisseur',
- 'Employee' => 'Employé',
- 'Enforce transaction reversal for all dates' => 'Appliquer l\'inversion des écritures pour toutes les dates',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => 'Entrer le nom de la monnaie nationale et des monnaies étrangères en 3 lettres séparées par (:) (Ex: EUR:USD:CAD)',
- 'Equity' => 'Capital',
- 'Exch' => 'Change',
- 'Exchangerate' => 'Taux de change',
- 'Exchangerate Difference' => 'Différence de taux de change',
- 'Exchangerate for payment missing!' => 'Taux de change manquant pour le paiement!',
- 'Exchangerate missing!' => 'Taux de change manquant!',
- 'Existing Datasets' => 'Fichiers de données existants',
- 'Expense' => 'Dépense',
- 'Expense Account' => 'Compte Dépenses',
- 'Expense/Asset' => 'Dépense/Actif',
- 'Extended' => 'Prix Total',
- 'Fax' => 'Fax',
- 'Feb' => 'Fév.',
- 'February' => 'Février',
- 'Foreign Exchange Gain' => 'Produit conversion devises',
- 'Foreign Exchange Loss' => 'Perte conversion devises',
- 'From' => 'De',
- 'GIFI' => 'Code d\'Identification Comptable ou Fiscale',
- 'GIFI deleted!' => 'Code d\'Identification Comptable ou Fiscale supprimé!',
- 'GIFI missing!' => 'Code d\'Identification Comptable ou Fiscale manquant!',
- 'GIFI saved!' => 'Code d\'Identification Comptable ou Fiscale enregistré!',
- 'GL Transaction' => 'Transaction Grand Livre',
- 'General Ledger' => 'Grand Livre',
- 'Goods & Services' => 'Articles & Services',
- 'Group' => 'Groupe',
- 'Group Items' => 'Grouper objets',
- 'Group deleted!' => 'Groupe effacé!',
- 'Group missing!' => 'Groupe absent!',
- 'Group saved!' => 'Groupe enregistré!',
- 'Groups' => 'Groupes',
- 'HTML Templates' => 'Gabarits HTML',
- 'Heading' => 'En-tête',
- 'Host' => 'Hôte',
- 'Hostname missing!' => 'Nom de l\'hôte manquant',
- 'ID' => 'ID',
- 'Image' => 'Image',
- 'In-line' => 'En ligne',
- 'Include in Report' => 'Inclure dans l\'état',
- 'Include in drop-down menus' => 'Inclure dans les menus deroulants',
- 'Include this account on the customer/vendor forms to flag customer/vendor as taxable?' => 'Afficher ce compte sur les formulaires de client/fournisseur pour le marquer comme imposable?',
- 'Income' => 'Recettes',
- 'Income Account' => 'Compte Recettes',
- 'Income Statement' => 'Compte de Résultat',
- 'Incorrect Dataset version!' => 'Fichier de données incorrect!',
- 'Incorrect Password!' => 'Mot de passe incorrect!',
- 'Individual Items' => 'Composition en marchandises individuelles',
- 'Inventory' => 'Inventaire',
- 'Inventory Account' => 'Compte d\'Inventaire',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => 'La quantité en stock doit être à zéro avant de pouvoir indiquer cet assemblage comme obsolète!',
- 'Inventory quantity must be zero before you can set this part obsolete!' => 'La quantité en stock devrait être zero avant de pouvoir indiquer cette pièce comme obsolète!',
- 'Invoice' => 'Facture',
- 'Invoice Date' => 'Date de facturation',
- 'Invoice Date missing!' => 'Date de facture manquante!',
- 'Invoice Number' => 'Numéro de facture',
- 'Invoice Number missing!' => 'Numéro de facture manquant!',
- 'Invoice deleted!' => 'Facture supprimé!',
- 'Invoice posted!' => 'Facture enregistré!',
- 'Invoices' => 'Factures',
- 'Is this a summary account to record' => 'Est-ce que c\'est un compte sommaire à enregistrer?',
- 'Item deleted!' => 'Objet supprimé!',
- 'Item not on file!' => 'Objet non-listé!',
- 'Jan' => 'Jan.',
- 'January' => 'Janvier',
- 'Jul' => 'Juil.',
- 'July' => 'Juillet',
- 'Jun' => 'Juin',
- 'June' => 'Juin',
- 'LaTeX Templates' => 'Gabarits LaTeX',
- 'Language' => 'Langue',
- 'Last Cost' => 'Dernier prix',
- 'Last Invoice Number' => 'Dernier numéro de facture',
- 'Last Numbers & Default Accounts' => 'Derniers numéros et comptes par défauts',
- 'Last Purchase Order Number' => 'Dernier numéro de commande d\'achat',
- 'Last Sales Order Number' => 'Numéro de la dernière commande de vente',
- 'Leave host and port field empty unless you want to make a remote connection.' => 'Laisser "port" et "hôte" vide, sauf si vous voulez vous connecter à distance (par réseau)',
- 'Liability' => 'Passif',
- 'Licensed to' => 'Licence à',
- 'Line Total' => 'Total ligne',
- 'Link' => 'Liens',
- 'Link Accounts' => 'Lier Comptes',
- 'List Accounts' => 'Liste des comptes',
- 'List GIFI' => 'Afficher la liste des Codes d\'Identification Comptable ou Fiscale',
- 'List Price' => 'Prix de revient',
- 'List Transactions' => 'Afficher écritures',
- 'Login' => 'Login',
- 'Login name missing!' => '',
- 'Logout' => 'Déconnexion',
- 'Make' => 'Marque',
- 'Mar' => 'Mars',
- 'March' => 'Mars',
- 'May' => 'Mai',
- 'May ' => 'Mai ',
- 'Message' => 'Message',
- 'Microfiche' => 'Microfiche',
- 'Model' => 'Modèle',
- 'Multibyte Encoding' => 'Encodage multibyte',
- 'N/A' => 'Non Applicable',
- 'Name' => 'Nom',
- 'Name missing!' => 'Nom manquant!',
- 'New Templates' => 'Nouveaux gabarits',
- 'No' => 'Non',
- 'No Database Drivers available!' => 'Pas de pilotes de base de données disponibles!',
- 'No Dataset selected!' => 'Pas de fichier de données sélectioné!',
- 'No email address for' => 'Pas d\'adresse email pour',
- 'No.' => 'No.',
- 'Notes' => 'Notes',
- 'Nothing applied!' => 'Rien n\'a été appliqué!',
- 'Nothing selected!' => 'Pas de sélection!',
- 'Nothing to delete!' => 'Rien à supprimer',
- 'Nov' => 'Nov.',
- 'November' => 'Novembre',
- 'Number' => 'Numéro',
- 'Number Format' => 'Format des numéros',
- 'Number missing in Row' => 'Numéro manquant dans ligne',
- 'O' => 'O',
- 'Obsolete' => 'Obsolète',
- 'Oct' => 'Oct.',
- 'October' => 'Octobre',
- 'On Hand' => 'En Stock / Disponible',
- 'On Order' => 'Sur Commande',
- 'Open' => 'Ouvert',
- 'Oracle Database Administration' => 'Administration de base de données Oracle',
- 'Order' => 'Commande',
- 'Order Date' => 'Date commande',
- 'Order Date missing!' => 'Date de commande manquante!',
- 'Order Entry' => 'Bons de Commandes',
- 'Order Number' => 'Numéro de commande',
- 'Order Number missing!' => 'Numéro de commande manquant!',
- 'Order deleted!' => 'Commande supprimé!',
- 'Order saved!' => 'Commande enregistré!',
- 'Ordered' => 'Commandé',
- 'Orphaned' => 'Orphelin',
- 'Out of balance!' => 'Solde non équilibré!',
- 'PDF' => 'PDF',
- 'Packing List' => 'Liste d\'envoi',
- 'Packing List Date missing!' => 'La date est manquante sur la liste d\'envoi!',
- 'Packing List Number missing!' => 'Le numéro de liste d\'envoi est manquant!',
- 'Paid' => 'Total Payé',
- 'Paid in full' => 'Complètement payé',
- 'Part' => 'Marchandise',
- 'Part Number missing!' => 'Numéro de marchandise manquant!',
- 'Parts' => 'Marchandises',
- 'Parts Inventory' => 'Inventaire marchandises',
- 'Password' => 'Mot de Passe',
- 'Password changed!' => 'Mot de passe changé!',
- 'Payables' => 'À Payer',
- 'Payment' => 'Paiement',
- 'Payment date missing!' => 'Date de paiement manquant!',
- 'Payment posted!' => 'Paiement enregistré!',
- 'Payments' => 'Paiements',
- 'Pg Database Administration' => 'Administration base de données PostgreSQL',
- 'Phone' => 'Tél.',
- 'Port' => 'Port',
- 'Port missing!' => 'Port manquant!',
- 'Post' => 'Enregistrer',
- 'Post as new' => 'Enregistrer comme nouveau',
- 'Postscript' => 'Postcript',
- 'Preferences' => 'Préférences',
- 'Preferences saved!' => 'Préférences enregistrées!',
- 'Price' => 'Prix',
- 'Print' => 'Imprimer',
- 'Printer' => 'Imprimante',
- 'Project' => 'Projet',
- 'Project Number' => 'Numéro de projet',
- 'Project Number missing!' => 'Numéro du projet manquant!',
- 'Project deleted!' => 'Projet supprimé!',
- 'Project not on file!' => 'Projet absent du fichier!',
- 'Project saved!' => 'Projet enregistré!',
- 'Projects' => 'Projets',
- 'Purchase Order' => 'Commande d\'Achat',
- 'Purchase Orders' => 'Commandes d\'Achats',
- 'Qty' => 'Qté',
- 'ROP' => 'Niveau de commande',
- 'Rate' => 'Cadence',
- 'Recd' => 'Reçu',
- 'Receipt' => 'Reçu',
- 'Receipt printed!' => 'Impression reçu!',
- 'Receipt printing failed!' => 'Erreur lors de l\'impression du reçu!',
- 'Receipts' => 'Reçus',
- 'Receivables' => 'À recevoir',
- 'Reconciliation' => 'Rapprochement',
- 'Record in' => 'Enregistrer dans',
- 'Reference' => 'Référence',
- 'Reference missing!' => 'Référence manquant!',
- 'Remaining' => 'Restant',
- 'Report for' => 'Rapport de',
- 'Reports' => 'Rapports',
- 'Required by' => 'Requis pour',
- 'Retained Earnings' => 'Éxcédents non distribués',
- 'Sales' => 'Ventes',
- 'Sales Invoice' => 'Facture de Vente',
- 'Sales Order' => 'Commande de Vente',
- 'Sales Orders' => 'Commandes de Vente',
- 'Salesperson' => 'Vendeur',
- 'Save' => 'Enregistrer',
- 'Save as new' => 'Enregistrer comme nouveau',
- 'Save to File' => 'Enregistrer comme fichier',
- 'Screen' => 'Écran',
- 'Select a Dataset to delete and press "Continue"' => 'Sélectionner la base de données à supprimer et cliquer sur "Continuer"',
- 'Select all' => 'Sélectionner tout',
- 'Select from one of the items below' => 'Sélectionner un des postes ci-dessous',
- 'Select from one of the names below' => 'Sélectionner un des noms ci-dessous',
- 'Select from one of the projects below' => 'Sélectionner un des projets ci-dessous',
- 'Select postscript or PDF!' => 'Sélectionner Postscript ou PDF',
- 'Sell Price' => 'Prix de vente',
- 'Send by E-Mail' => 'Envoyer par email',
- 'Sep' => 'Sept.',
- 'September' => 'Septembre',
- 'Service' => 'Service',
- 'Service Items' => 'Services',
- 'Service Number missing!' => 'Numéro de service manquant!',
- 'Services' => 'Services',
- 'Setup Templates' => 'Configuration des Gabarits',
- 'Ship' => 'Expédier',
- 'Ship to' => 'Expédier à',
- 'Ship via' => 'Expédier via',
- 'Short' => 'Court',
- 'Signature' => 'Signature',
- 'Sold' => 'Vendu',
- 'Source' => 'Source',
- 'Standard' => 'Standard',
- 'Statement' => 'Relevé',
- 'Statement Balance' => 'Relevé de compte',
- 'Statement sent to' => 'Relevé envoyé à',
- 'Statements sent to printer!' => 'Relevés envoyés à l\'imprimante!',
- 'Stock' => 'Stock',
- 'Stock Assembly' => 'Stock de produits',
- 'Stylesheet' => 'Feuille de style',
- 'Subject' => 'Objet',
- 'Subtotal' => 'Sous Total',
- 'System' => 'Système',
- 'Tax' => 'Taxe',
- 'Tax Accounts' => 'Comptes de taxe',
- 'Tax Included' => 'Taxe incluse',
- 'Tax collected' => 'Taxe collectée',
- 'Tax paid' => 'Taxe payée',
- 'Taxable' => 'Imposable',
- 'Template saved!' => 'Gabarit enregistré!',
- 'Templates' => 'Gabarits',
- 'Terms: Net' => 'Crédit limité à',
- 'The following Datasets are not in use and can be deleted' => 'Les fichiers de données suivants ne sont pas utilisés et peuvent être supprimés.',
- 'The following Datasets need to be updated' => 'Les fichiers de données suivants doivent être mis a jour',
- 'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => 'Ceci est un test préliminaire des sources existante. Aucune modification à ce stade!!',
- 'To' => 'à ',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => 'Pour ajouter un utilisateur à un groupe, editer un "nom", changer le "login" et enregistrer. Un nouveau utilisateur avec les mêmes données sera enregistré avec le nouveau "login".',
- 'Top Level' => 'Description principale',
- 'Total' => 'Total',
- 'Transaction Date missing!' => 'Date d\'écriture manquante!',
- 'Transaction deleted!' => 'Ecriture supprimée!',
- 'Transaction posted!' => 'Ecriture enregistrée!',
- 'Transaction reversal enforced for all dates' => 'Inversion des écritures exécuté pour toutes les dates',
- 'Transaction reversal enforced up to' => 'Inversion des écritures exécuté jusqu\'au',
- 'Transactions' => 'Mouvements',
- 'Transactions exist, cannot delete customer!' => 'Des écritures existent, impossible d\'effacer le client!',
- 'Transactions exist, cannot delete vendor!' => 'Des écritures existent, impossible d\'effacer le fournisseur!',
- 'Transactions exist; cannot delete account!' => 'Des écritures existent, impossible d\'effacer le compte!',
- 'Trial Balance' => 'Balance Globale',
- 'Unit' => 'Unité',
- 'Unit of measure' => 'Unité de mesure',
- 'Update' => 'Mettre à jour',
- 'Update Dataset' => 'Mis à jour de la base de données',
- 'Updated' => 'Mis à jour',
- 'Use Templates' => 'Utiliser les modèles',
- 'User' => 'Utilisateur',
- 'User deleted!' => 'Utilisateur supprimé!',
- 'User saved!' => 'Utilisateur enregistré!',
- 'Vendor' => 'Fournisseur',
- 'Vendor Invoice' => 'Facture d\'Achat',
- 'Vendor deleted!' => 'Fournisseur supprimé!',
- 'Vendor missing!' => 'Fournisseur manquant!',
- 'Vendor not on file!' => 'Fournisseur absent du fichier!',
- 'Vendor saved!' => 'Fournisseur enregistré!',
- 'Vendors' => 'Fournisseurs',
- 'Version' => 'Version',
- 'Weight' => 'Poids',
- 'Weight Unit' => 'Unité de poids',
- 'What type of item is this?' => 'De quel type est ce poste?',
- 'Year End' => 'Fin d\'année',
- 'Yes' => 'Oui',
- 'You are logged out!' => 'Vous êtes déconnecté!',
- 'You did not enter a name!' => 'Vous n\'avez pas saisi de nom!',
- 'You must enter a host and port for local and remote connections!' => 'Vous devez saisir un "hôte" et un "port" pour les connexions distantes!',
- 'as at' => 'au',
- 'collected on sales' => 'collectées sur les ventes',
- 'days' => 'jours',
- 'does not exist' => 'n\'existe pas!',
- 'ea' => 'ch',
- 'emailed to' => 'envoyé par email à',
- 'for Period' => 'pour la période',
- 'hr' => 'h',
- 'is already a member!' => 'est déjà un membre!',
- 'is not a member!' => 'n\'est pas un membre',
- 'localhost' => 'hôte local',
- 'locked!' => 'verrouillé!',
- 'paid on purchases' => 'payées sur les achats',
- 'sent to printer' => 'envoyé à l\'imprimante',
- 'successfully created!' => 'créé avec succès',
- 'successfully deleted!' => 'supprimé avec succès',
- 'to' => 'jusqu\'au',
- 'website' => 'site web',
-};
-
-1;
+++ /dev/null
-#!/usr/bin/perl
-# -*- coding: utf-8; -*-
-# vim: fenc=utf-8
-
-# add the missing texts and run locales.pl to rebuild
-
-$missing = {
- ' Date missing!' => '',
- ' Part Number missing!' => '',
- ' missing!' => '',
- '#1 prices were updated.' => '',
- '<%account_number%> -- Your account number' => '',
- '<%bank%> -- Your bank' => '',
- '<%bank_code%> -- Your bank code' => '',
- '<%currency%> -- The selected currency' => '',
- '<%invtotal%> -- Invoice total' => '',
- '<%invtotal_wo_skonto%> -- Invoice total less discount' => '',
- '<%netto_date%> -- Date the payment is due in full' => '',
- '<%skonto_amount%> -- The deductible amount' => '',
- '<%skonto_date%> -- Date the payment is due with discount' => '',
- '<%skonto_in_percent%> -- The discount in percent' => '',
- '<%terms_netto%> -- The number of days for full payment' => '',
- '<%total%> -- Amount payable' => '',
- '<%total_wo_skonto%> -- Amount payable less discount' => '',
- '*/' => '',
- '---please select---' => '',
- '...after loggin in' => '',
- '...done' => '',
- '...on the TODO list' => '',
- '1. Quarter' => '',
- '2. Quarter' => '',
- '3. Quarter' => '',
- '4. Quarter' => '',
- '<b>What</b> do you want to look for?' => '',
- 'A Buchungsgruppe consists of a descriptive name and the account numbers for the income and expense accounts for those four tax zones as well as the inventory account number.' => '',
- 'A group named "Full Access" has been created.' => '',
- 'A group with that name does already exist.' => '',
- 'A lot of the usability of Lx-Office has been enhanced with javascript. Although it is currently possible to use every aspect of Lx-Office without javascript, we strongly recommend it. In a future version this may change and javascript may be necessary to access advanced features.' => '',
- 'A temporary directory could not be created:' => '',
- 'A temporary file could not be created. Please verify that the directory "#1" is writeable by the webserver.' => '',
- 'A temporary file could not be created:' => '',
- 'A unit with this name does already exist.' => '',
- 'A variable marked as \'editable\' can be changed in each quotation, order, invoice etc.' => '',
- 'ADDED' => '',
- 'AP' => '',
- 'AP Aging' => '',
- 'AP Transaction' => '',
- 'AP Transaction (abbreviation)' => '',
- 'AP Transaction Storno (one letter abbreviation)' => '',
- 'AP Transaction with Storno (abbreviation)' => '',
- 'AP Transactions' => '',
- 'AP transactions with sales taxkeys and/or AR transactions with input taxkeys' => '',
- 'AR' => '',
- 'AR Aging' => '',
- 'AR Transaction' => '',
- 'AR Transaction (abbreviation)' => '',
- 'AR Transactions' => '',
- 'ASSETS' => '',
- 'Abrechnungsnummer' => '',
- 'Abteilung' => '',
- 'Account' => '',
- 'Account Category A' => '',
- 'Account Category C' => '',
- 'Account Category E' => '',
- 'Account Category G' => '',
- 'Account Category I' => '',
- 'Account Category L' => '',
- 'Account Category Q' => '',
- 'Account Description missing!' => '',
- 'Account Link AP' => '',
- 'Account Link AP_amount' => '',
- 'Account Link AP_paid' => '',
- 'Account Link AP_tax' => '',
- 'Account Link AR' => '',
- 'Account Link AR_amount' => '',
- 'Account Link AR_paid' => '',
- 'Account Link AR_tax' => '',
- 'Account Link IC' => '',
- 'Account Link IC_cogs' => '',
- 'Account Link IC_expense' => '',
- 'Account Link IC_income' => '',
- 'Account Link IC_sale' => '',
- 'Account Link IC_taxpart' => '',
- 'Account Link IC_taxservice' => '',
- 'Account Number' => '',
- 'Account Number already used!' => '',
- 'Account Number missing!' => '',
- 'Account Nummer' => '',
- 'Account Type' => '',
- 'Account Type missing!' => '',
- 'Account deleted!' => '',
- 'Account for fees' => '',
- 'Account for interest' => '',
- 'Account number' => '',
- 'Account number #1, bank code #2, #3' => '',
- 'Account saved!' => '',
- 'Accounting Group deleted!' => '',
- 'Accounting Group saved!' => '',
- 'Accrual' => '',
- 'Active' => '',
- 'Active?' => '',
- 'Add' => '',
- 'Add AP Transaction' => '',
- 'Add AR Transaction' => '',
- 'Add Account' => '',
- 'Add Accounting Group' => '',
- 'Add Accounts Payables Transaction' => '',
- 'Add Accounts Receivables Transaction' => '',
- 'Add Assembly' => '',
- 'Add Buchungsgruppe' => '',
- 'Add Business' => '',
- 'Add Credit Note' => '',
- 'Add Customer' => '',
- 'Add Delivery Order' => '',
- 'Add Department' => '',
- 'Add Dunning' => '',
- 'Add Exchangerate' => '',
- 'Add Follow-Up' => '',
- 'Add Follow-Up for #1' => '',
- 'Add General Ledger Transaction' => '',
- 'Add Group' => '',
- 'Add Language' => '',
- 'Add Lead' => '',
- 'Add License' => '',
- 'Add Part' => '',
- 'Add Payment Terms' => '',
- 'Add Price Factor' => '',
- 'Add Pricegroup' => '',
- 'Add Printer' => '',
- 'Add Project' => '',
- 'Add Purchase Delivery Order' => '',
- 'Add Purchase Order' => '',
- 'Add Quotation' => '',
- 'Add RFQ' => '',
- 'Add Request for Quotation' => '',
- 'Add Sales Delivery Order' => '',
- 'Add Sales Invoice' => '',
- 'Add Sales Order' => '',
- 'Add Service' => '',
- 'Add Storno Credit Note' => '',
- 'Add Transaction' => '',
- 'Add User' => '',
- 'Add Vendor' => '',
- 'Add Vendor Invoice' => '',
- 'Add Warehouse' => '',
- 'Add a new group' => '',
- 'Add and edit units' => '',
- 'Add bank account' => '',
- 'Add custom variable' => '',
- 'Add note' => '',
- 'Add to group' => '',
- 'Add unit' => '',
- 'Address' => '',
- 'Administration' => '',
- 'Administration area' => '',
- 'Advance turnover tax return' => '',
- 'Aktion' => '',
- 'All' => '',
- 'All Accounts' => '',
- 'All Datasets up to date!' => '',
- 'All changes in that file have been reverted.' => '',
- 'All database upgrades have been applied.' => '',
- 'All general ledger entries' => '',
- 'All of the exports you have selected were already closed.' => '',
- 'All reports' => '',
- 'All the selected exports have already been closed, or all of their items have already been executed.' => '',
- 'Allow access' => '',
- 'Allow the following users access to my follow-ups:' => '',
- 'Alternatively you can create a new part which will then be selected.' => '',
- 'Alternatively you can skip this step and create groups yourself.' => '',
- 'Amended Advance Turnover Tax Return' => '',
- 'Amended Advance Turnover Tax Return (Nr. 10)' => '',
- 'Amount' => '',
- 'Amount Due' => '',
- 'Annotations' => '',
- 'Another user with the login #1 does already exist.' => '',
- 'Ap aging on %s' => '',
- 'Application Error. No Format given' => '',
- 'Application Error. Wrong Format' => '',
- 'Applying #1:' => '',
- 'Approximately #1 prices will be updated.' => '',
- 'Apr' => '',
- 'April' => '',
- 'Ar aging on %s' => '',
- 'Are you sure you want to delete Delivery Order Number #1?' => '',
- 'Are you sure you want to delete Invoice Number' => '',
- 'Are you sure you want to delete Order Number' => '',
- 'Are you sure you want to delete Quotation Number' => '',
- 'Are you sure you want to delete Transaction' => '',
- 'Are you sure you want to remove the marked entries from the queue?' => '',
- 'Are you sure you want to update the prices' => '',
- 'Article Code' => '',
- 'Article Code missing!' => '',
- 'As a result, the saved onhand values of the present goods can be stored into a warehouse designated by you, or will be reset for a proper warehouse tracking' => '',
- 'Assemblies' => '',
- 'Assembly Description' => '',
- 'Assembly Number' => '',
- 'Assembly Number missing!' => '',
- 'Asset' => '',
- 'Assets' => '',
- 'Assign new units' => '',
- 'Assign units' => '',
- 'Assistant for general ledger corrections' => '',
- 'Assume Tax Consultant Data in Tax Computation?' => '',
- 'At least' => '',
- 'At least one Perl module that Lx-Office ERP requires for running is not installed on your system.' => '',
- 'At most' => '',
- 'At the moment the transaction looks like this:' => '',
- 'Attach PDF:' => '',
- 'Attachment' => '',
- 'Attachment name' => '',
- 'Attempt to call an undefined sub named \'%s\'' => '',
- 'Audit Control' => '',
- 'Aug' => '',
- 'August' => '',
- 'Authentification database creation' => '',
- 'Authentification tables creation' => '',
- 'Auto Send?' => '',
- 'Automatically created invoice for fee and interest for dunning %s' => '',
- 'Available qty' => '',
- 'BALANCE SHEET' => '',
- 'BIC' => '',
- 'BOM' => '',
- 'BWA' => '',
- 'Back' => '',
- 'Backup Dataset' => '',
- 'Backup file' => '',
- 'Backup of dataset' => '',
- 'Balance' => '',
- 'Balance Sheet' => '',
- 'Bank' => '',
- 'Bank Code' => '',
- 'Bank Code (long)' => '',
- 'Bank Code Number' => '',
- 'Bank Connection Tax Office' => '',
- 'Bank Connections' => '',
- 'Bank accounts' => '',
- 'Bank code' => '',
- 'Bank transfer amount' => '',
- 'Bank transfer payment list for export #1' => '',
- 'Bank transfer via SEPA' => '',
- 'Bank transfers via SEPA' => '',
- 'Base unit' => '',
- 'Basic data' => '',
- 'Batch Printing' => '',
- 'Bcc' => '',
- 'Belegnummer' => '',
- 'Beratername' => '',
- 'Beraternummer' => '',
- 'Best Before' => '',
- 'Bestandskonto' => '',
- 'Bilanz' => '',
- 'Billing Address' => '',
- 'Billing/shipping address (city)' => '',
- 'Billing/shipping address (street)' => '',
- 'Billing/shipping address (zipcode)' => '',
- 'Bin' => '',
- 'Bin From' => '',
- 'Bin List' => '',
- 'Bin To' => '',
- 'Binding to the LDAP server as "#1" failed. Please check config/lx_office.conf.' => '',
- 'Bins saved.' => '',
- 'Bins that have been used in the past cannot be deleted anymore. For these bins there\'s no checkbox in the "Delete" column.' => '',
- 'Birthday' => '',
- 'Bis' => '',
- 'Bis Konto: ' => '',
- 'Body' => '',
- 'Body:' => '',
- 'Books are open' => '',
- 'Books closed up to' => '',
- 'Boolean variables: If the default value is non-empty then the checkbox will be checked by default and unchecked otherwise.' => '',
- 'Both' => '',
- 'Bottom' => '',
- 'Bought' => '',
- 'Buchungsdatum' => '',
- 'Buchungsgruppe' => '',
- 'Buchungsgruppen' => '',
- 'Buchungskonto' => '',
- 'Buchungsnummer' => '',
- 'Business Number' => '',
- 'Business Volume' => '',
- 'Business deleted!' => '',
- 'Business saved!' => '',
- 'CANCELED' => '',
- 'CB Transaction' => '',
- 'CR' => '',
- 'CRM admin' => '',
- 'CRM create customers, vendors and contacts' => '',
- 'CRM follow up' => '',
- 'CRM know how' => '',
- 'CRM notices' => '',
- 'CRM opportunity' => '',
- 'CRM optional software' => '',
- 'CRM other' => '',
- 'CRM search' => '',
- 'CRM send email' => '',
- 'CRM services' => '',
- 'CRM status' => '',
- 'CRM termin' => '',
- 'CRM user' => '',
- 'CSV export -- options' => '',
- 'Calculate' => '',
- 'Can not create that quantity with current stock' => '',
- 'Cancel' => '',
- 'Cancel Accounts Payables Transaction' => '',
- 'Cancel Accounts Receivables Transaction' => '',
- 'Cannot create Lock!' => '',
- 'Cannot delete account!' => '',
- 'Cannot delete customer!' => '',
- 'Cannot delete default account!' => '',
- 'Cannot delete delivery order!' => '',
- 'Cannot delete invoice!' => '',
- 'Cannot delete item!' => '',
- 'Cannot delete order!' => '',
- 'Cannot delete quotation!' => '',
- 'Cannot delete transaction!' => '',
- 'Cannot delete vendor!' => '',
- 'Cannot have a value in both Debit and Credit!' => '',
- 'Cannot post Payment!' => '',
- 'Cannot post Receipt!' => '',
- 'Cannot post a transaction without a value!' => '',
- 'Cannot post invoice for a closed period!' => '',
- 'Cannot post invoice!' => '',
- 'Cannot post payment for a closed period!' => '',
- 'Cannot post payment!' => '',
- 'Cannot post transaction for a closed period!' => '',
- 'Cannot post transaction with a debit and credit entry for the same account!' => '',
- 'Cannot post transaction!' => '',
- 'Cannot process payment for a closed period!' => '',
- 'Cannot remove files!' => '',
- 'Cannot save account!' => '',
- 'Cannot save order!' => '',
- 'Cannot save preferences!' => '',
- 'Cannot save quotation!' => '',
- 'Cannot storno storno invoice!' => '',
- 'Carry over shipping address' => '',
- 'Cash' => '',
- 'Cc' => '',
- 'Change Lx-Office installation settings (all menu entries beneath \'System\')' => '',
- 'Change representative to' => '',
- 'Charge Number' => '',
- 'Charge number' => '',
- 'Chart' => '',
- 'Chart Type' => '',
- 'Chart balance' => '',
- 'Chart of Accounts' => '',
- 'Chart of accounts' => '',
- 'Chartaccounts connected to this Tax:' => '',
- 'Check' => '',
- 'Check Details' => '',
- 'Checks' => '',
- 'Choose Customer' => '',
- 'Choose Outputformat' => '',
- 'Choose Vendor' => '',
- 'Choose a Tax Number' => '',
- 'City' => '',
- 'Cleared Balance' => '',
- 'Clearing Tax Received (No 71)' => '',
- 'Click on login name to edit!' => '',
- 'Close' => '',
- 'Close Books up to' => '',
- 'Close SEPA exports' => '',
- 'Close Window' => '',
- 'Closed' => '',
- 'Collective Orders only work for orders from one customer!' => '',
- 'Comment' => '',
- 'Company' => '',
- 'Company Name' => '',
- 'Compare to' => '',
- 'Configuration of individual TODO items' => '',
- 'Confirm' => '',
- 'Confirm!' => '',
- 'Confirmation' => '',
- 'Contact' => '',
- 'Contact Person' => '',
- 'Contact person (surname)' => '',
- 'Contacts' => '',
- 'Continue' => '',
- 'Contra' => '',
- 'Copies' => '',
- 'Correct taxkey' => '',
- 'Corrections' => '',
- 'Cost Center' => '',
- 'Costs' => '',
- 'Could not copy %s to %s. Reason: %s' => '',
- 'Could not open the file users/members.' => '',
- 'Could not open the old memberfile.' => '',
- 'Could not print dunning.' => '',
- 'Could not rename %s to %s. Reason: %s' => '',
- 'Could not spawn ghostscript.' => '',
- 'Could not spawn the printer command.' => '',
- 'Could not update prices!' => '',
- 'Country' => '',
- 'Create Assembly' => '',
- 'Create Buchungsgruppen' => '',
- 'Create Chart of Accounts' => '',
- 'Create Dataset' => '',
- 'Create Date' => '',
- 'Create a standard group' => '',
- 'Create and edit RFQs' => '',
- 'Create and edit customers and vendors' => '',
- 'Create and edit dunnings' => '',
- 'Create and edit invoices and credit notes' => '',
- 'Create and edit parts, services, assemblies' => '',
- 'Create and edit projects' => '',
- 'Create and edit purchase delivery orders' => '',
- 'Create and edit purchase orders' => '',
- 'Create and edit sales delivery orders' => '',
- 'Create and edit sales orders' => '',
- 'Create and edit sales quotations' => '',
- 'Create and edit vendor invoices' => '',
- 'Create bank transfer' => '',
- 'Create bank transfer via SEPA XML' => '',
- 'Create invoice?' => '',
- 'Create new' => '',
- 'Create tables' => '',
- 'Created by' => '',
- 'Created for' => '',
- 'Created on' => '',
- 'Credit' => '',
- 'Credit (one letter abbreviation)' => '',
- 'Credit Account' => '',
- 'Credit Limit' => '',
- 'Credit Limit exceeded!!!' => '',
- 'Credit Note' => '',
- 'Credit Note Date' => '',
- 'Credit Note Number' => '',
- 'Credit Starting Balance' => '',
- 'Credit Tax' => '',
- 'Credit Tax Account' => '',
- 'Credit note (one letter abbreviation)' => '',
- 'Curr' => '',
- 'Currencies' => '',
- 'Currency' => '',
- 'Current / Next Level' => '',
- 'Current Earnings' => '',
- 'Current unit' => '',
- 'Current value:' => '',
- 'Custom Variables' => '',
- 'Custom variables for module' => '',
- 'Customer' => '',
- 'Customer Name' => '',
- 'Customer Number' => '',
- 'Customer Order Number' => '',
- 'Customer deleted!' => '',
- 'Customer details' => '',
- 'Customer missing!' => '',
- 'Customer not on file or locked!' => '',
- 'Customer not on file!' => '',
- 'Customer saved!' => '',
- 'Customer type' => '',
- 'Customername' => '',
- 'Customernumberinit' => '',
- 'Customers' => '',
- 'Customers and vendors' => '',
- 'Customized Report' => '',
- 'DATEV - Export Assistent' => '',
- 'DATEV Angaben' => '',
- 'DATEV Export' => '',
- 'DATEX - Export Assistent' => '',
- 'DELETED' => '',
- 'DFV-Kennzeichen' => '',
- 'DR' => '',
- 'DUNNING STARTED' => '',
- 'DUNS-Nr' => '',
- 'Database' => '',
- 'Database Administration' => '',
- 'Database Connection Test' => '',
- 'Database Host' => '',
- 'Database User missing!' => '',
- 'Database backups and restorations are disabled in lx_office.conf.' => '',
- 'Database name' => '',
- 'Database template' => '',
- 'Database update error:' => '',
- 'Dataset' => '',
- 'Dataset missing!' => '',
- 'Dataset name' => '',
- 'Dataset upgrade' => '',
- 'Date' => '',
- 'Date Format' => '',
- 'Date Paid' => '',
- 'Date and timestamp variables: If the default value equals \'NOW\' then the current date/current timestamp will be used. Otherwise the default value is copied as-is.' => '',
- 'Date missing!' => '',
- 'Datevautomatik' => '',
- 'Datum von' => '',
- 'Debit' => '',
- 'Debit (one letter abbreviation)' => '',
- 'Debit Account' => '',
- 'Debit Starting Balance' => '',
- 'Debit Tax' => '',
- 'Debit Tax Account' => '',
- 'Debit and credit out of balance!' => '',
- 'Dec' => '',
- 'December' => '',
- 'Decimalplaces' => '',
- 'Decrease' => '',
- 'Default (no language selected)' => '',
- 'Default Accounts' => '',
- 'Default output medium' => '',
- 'Default printer' => '',
- 'Default template format' => '',
- 'Default value' => '',
- 'Defaults saved.' => '',
- 'Delete' => '',
- 'Delete Account' => '',
- 'Delete Contact' => '',
- 'Delete Dataset' => '',
- 'Delete Shipto' => '',
- 'Delete delivery order' => '',
- 'Delete drafts' => '',
- 'Delete group' => '',
- 'Delete transaction' => '',
- 'Delivered' => '',
- 'Delivery Date' => '',
- 'Delivery Order' => '',
- 'Delivery Order Date' => '',
- 'Delivery Order Date missing!' => '',
- 'Delivery Order Number' => '',
- 'Delivery Order deleted!' => '',
- 'Delivery Orders' => '',
- 'Department' => '',
- 'Department deleted!' => '',
- 'Department saved!' => '',
- 'Departments' => '',
- 'Dependency loop detected:' => '',
- 'Deposit' => '',
- 'Description' => '',
- 'Description (Click on Description for details)' => '',
- 'Description missing!' => '',
- 'Description must not be empty!' => '',
- 'Destination BIC' => '',
- 'Destination IBAN' => '',
- 'Destination bin' => '',
- 'Destination warehouse' => '',
- 'Destination warehouse and bin' => '',
- 'Details (one letter abbreviation)' => '',
- 'Difference' => '',
- 'Dimension unit' => '',
- 'Directory' => '',
- 'Discount' => '',
- 'Display' => '',
- 'Display file' => '',
- 'Display options' => '',
- 'Do you really want to close the following SEPA exports? No payment will be recorded for bank transfers that haven\'t been marked as executed yet.' => '',
- 'Do you really want to delete AP transaction #1?' => '',
- 'Do you really want to delete AR transaction #1?' => '',
- 'Do you really want to delete GL transaction #1?' => '',
- 'Do you really want to delete this group:' => '',
- 'Do you really want to delete this warehouse?' => '',
- 'Do you want Lx-Office to create a group for access to all functions?' => '',
- 'Do you want to <b>limit</b> your search?' => '',
- 'Do you want to carry this shipping address over to the new purchase order so that the vendor can deliver the goods directly to your customer?' => '',
- 'Do you want to store the existing onhand values into a new warehouse?' => '',
- 'Document' => '',
- 'Documents in the WebDAV repository' => '',
- 'Done' => '',
- 'Download SEPA XML export file' => '',
- 'Download the backup' => '',
- 'Draft saved.' => '',
- 'Drawing' => '',
- 'Driver' => '',
- 'Dropdown Limit' => '',
- 'Due' => '',
- 'Due Date' => '',
- 'Due Date missing!' => '',
- 'Duedate +Days' => '',
- 'Dunning' => '',
- 'Dunning Amount' => '',
- 'Dunning Date' => '',
- 'Dunning Date from' => '',
- 'Dunning Description' => '',
- 'Dunning Description missing in row ' => '',
- 'Dunning Duedate' => '',
- 'Dunning Level' => '',
- 'Dunning Level missing in row ' => '',
- 'Dunning Process Config saved!' => '',
- 'Dunning Process started for selected invoices!' => '',
- 'Dunning number' => '',
- 'Dunning overview' => '',
- 'Dunnings' => '',
- 'During this user migration Lx-Office can create such a group for you and grant all users access to all of Lx-Office\'s functions.' => '',
- 'E-mail' => '',
- 'E-mail Statement to' => '',
- 'E-mail address missing!' => '',
- 'EAN' => '',
- 'EAN-Code' => '',
- 'EB-Wert' => '',
- 'EK' => '',
- 'ELSE' => '',
- 'ELSTER Export (Taxbird)' => '',
- 'ELSTER Export (Winston)' => '',
- 'ELSTER Export nach Winston' => '',
- 'ELSTER Tax Number' => '',
- 'EQUITY' => '',
- 'EU with VAT ID' => '',
- 'EU without VAT ID' => '',
- 'EUER' => '',
- 'EUR' => '',
- 'Earlier versions of Lx-Office contained bugs which might have led to wrong entries in the general ledger.' => '',
- 'Edit' => '',
- 'Edit Access Rights' => '',
- 'Edit Access Rights for Follow-Ups' => '',
- 'Edit Account' => '',
- 'Edit Accounting Group' => '',
- 'Edit Accounts Payables Transaction' => '',
- 'Edit Accounts Receivables Transaction' => '',
- 'Edit Assembly' => '',
- 'Edit Bins' => '',
- 'Edit Buchungsgruppe' => '',
- 'Edit Business' => '',
- 'Edit Credit Note' => '',
- 'Edit Customer' => '',
- 'Edit Department' => '',
- 'Edit Dunning' => '',
- 'Edit Dunning Process Config' => '',
- 'Edit Follow-Up' => '',
- 'Edit Follow-Up for #1' => '',
- 'Edit General Ledger Transaction' => '',
- 'Edit Group' => '',
- 'Edit Language' => '',
- 'Edit Lead' => '',
- 'Edit Part' => '',
- 'Edit Payment Terms' => '',
- 'Edit Preferences for #1' => '',
- 'Edit Price Factor' => '',
- 'Edit Pricegroup' => '',
- 'Edit Printer' => '',
- 'Edit Project' => '',
- 'Edit Purchase Delivery Order' => '',
- 'Edit Purchase Order' => '',
- 'Edit Quotation' => '',
- 'Edit Request for Quotation' => '',
- 'Edit Sales Delivery Order' => '',
- 'Edit Sales Invoice' => '',
- 'Edit Sales Order' => '',
- 'Edit Service' => '',
- 'Edit Storno Credit Note' => '',
- 'Edit Storno Invoice' => '',
- 'Edit User' => '',
- 'Edit Vendor' => '',
- 'Edit Vendor Invoice' => '',
- 'Edit Warehouse' => '',
- 'Edit and delete a group' => '',
- 'Edit bank account' => '',
- 'Edit custom variable' => '',
- 'Edit file' => '',
- 'Edit greetings' => '',
- 'Edit group ' => '',
- 'Edit group membership' => '',
- 'Edit groups' => '',
- 'Edit note' => '',
- 'Edit rights' => '',
- 'Edit templates' => '',
- 'Edit the Delivery Order' => '',
- 'Edit the membership of all users in all groups:' => '',
- 'Edit the purchase_order' => '',
- 'Edit the request_quotation' => '',
- 'Edit the sales_order' => '',
- 'Edit the sales_quotation' => '',
- 'Edit the stylesheet' => '',
- 'Edit units' => '',
- 'Editable' => '',
- 'Either there are no open invoices, or you have already initiated bank transfers with the open amounts for those that are still open.' => '',
- 'Element disabled' => '',
- 'Employee' => '',
- 'Empty transaction!' => '',
- 'Enter a description for this new draft.' => '',
- 'Enter longdescription' => '',
- 'Enter the requested execution date or leave empty for the quickest possible execution:' => '',
- 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' => '',
- 'Equity' => '',
- 'Error' => '',
- 'Error in database control file \'%s\': %s' => '',
- 'Error in position #1: You must either assign no stock at all or the full quantity of #2 #3.' => '',
- 'Error in position #1: You must either assign no transfer at all or the full quantity of #2 #3.' => '',
- 'Error in row #1: The quantity you entered is bigger than the stocked quantity.' => '',
- 'Error message from the database driver:' => '',
- 'Error!' => '',
- 'Ertrag' => '',
- 'Ertrag prozentual' => '',
- 'Escape character' => '',
- 'Exact' => '',
- 'Excel' => '',
- 'Exch' => '',
- 'Exchangerate' => '',
- 'Exchangerate Difference' => '',
- 'Exchangerate for payment missing!' => '',
- 'Exchangerate missing!' => '',
- 'Executed' => '',
- 'Execution date' => '',
- 'Execution date from' => '',
- 'Execution date to' => '',
- 'Existing Buchungsgruppen' => '',
- 'Existing Datasets' => '',
- 'Existing pending follow-ups for this item' => '',
- 'Expected Tax' => '',
- 'Expense' => '',
- 'Expense Account' => '',
- 'Expense accno' => '',
- 'Expense/Asset' => '',
- 'Expenses EU with UStId' => '',
- 'Expenses EU without UStId' => '',
- 'Expired licenses' => '',
- 'Expiring in x month(s)' => '',
- 'Export Buchungsdaten' => '',
- 'Export Stammdaten' => '',
- 'Export as CSV' => '',
- 'Export as PDF' => '',
- 'Export date' => '',
- 'Export date from' => '',
- 'Export date to' => '',
- 'Extended' => '',
- 'Extension Of Time' => '',
- 'Factor' => '',
- 'Factor missing!' => '',
- 'Falsches Datumsformat!' => '',
- 'Favorites' => '',
- 'Fax' => '',
- 'Feb' => '',
- 'February' => '',
- 'Fee' => '',
- 'File' => '',
- 'File name' => '',
- 'Files created by Lx-Office\'s "Backup Dataset" function are such files.' => '',
- 'Filter' => '',
- 'Finish' => '',
- 'Fix transaction' => '',
- 'Fix transactions' => '',
- 'Folgekonto' => '',
- 'Follow-Up' => '',
- 'Follow-Up Date' => '',
- 'Follow-Up On' => '',
- 'Follow-Up done' => '',
- 'Follow-Up for' => '',
- 'Follow-Up for user' => '',
- 'Follow-Up saved.' => '',
- 'Follow-Ups' => '',
- 'Follow-up for' => '',
- 'Font' => '',
- 'Font size' => '',
- 'For AP transactions it will replace the sales taxkeys with input taxkeys with the same tax rate.' => '',
- 'For AR transactions it will replace the input taxkeys with sales taxkeys with the same tax rate.' => '',
- 'For each unit there\'s either no or exactly one base unit. If you chose a base unit then you also have to chose a factor. That way the new unit will be defined as a multiple of the base unit. The base unit must be the "smaller" one. A factor may not be less than 1. Therefore you may define "kg" with the base unit "g" and a factor of "1", but not the other way round.' => '',
- 'Foreign Exchange Gain' => '',
- 'Foreign Exchange Loss' => '',
- 'Foreign Expenses' => '',
- 'Foreign Revenues' => '',
- 'Form details (second row)' => '',
- 'Formula' => '',
- 'Free report period' => '',
- 'Free-form text' => '',
- 'Fristsetzung' => '',
- 'From' => '',
- 'From Date' => '',
- 'Full Access' => '',
- 'Full access to all functions' => '',
- 'Fwd' => '',
- 'GL Transaction' => '',
- 'Gegenkonto' => '',
- 'Gender' => '',
- 'General Ledger' => '',
- 'General Ledger Corrections' => '',
- 'General Ledger Transaction' => '',
- 'General ledger and cash' => '',
- 'General ledger corrections' => '',
- 'Generic Tax Report' => '',
- 'Given Name' => '',
- 'Go one step back' => '',
- 'Go one step forward' => '',
- 'Greeting' => '',
- 'Greetings' => '',
- 'Group' => '',
- 'Group Invoices' => '',
- 'Group Items' => '',
- 'Group deleted!' => '',
- 'Group membership' => '',
- 'Group missing!' => '',
- 'Group saved!' => '',
- 'Groups' => '',
- 'HTML' => '',
- 'HTML Templates' => '',
- 'Hardcopy' => '',
- 'Has serial number' => '',
- 'Header' => '',
- 'Heading' => '',
- 'Help' => '',
- 'Here\'s an example command line:' => '',
- 'Hide by default' => '',
- 'History' => '',
- 'History Search' => '',
- 'History Search Engine' => '',
- 'Homepage' => '',
- 'Host' => '',
- 'However, you can create a new part which will then be selected.' => '',
- 'I' => '',
- 'IBAN' => '',
- 'ID' => '',
- 'ID-Nummer' => '',
- 'II' => '',
- 'III' => '',
- 'IV' => '',
- 'If the automatic creation of invoices for fees and interest is switched on for a dunning level then the following accounts will be used for the invoice.' => '',
- 'If the database user listed above does not have the right to create a database then enter the name and password of the superuser below:' => '',
- 'If you chose to let Lx-Office do the migration then Lx-Office will also remove the old member file after creating a backup copy of it in the directory "#1".' => '',
- 'If you enter values for the part number and / or part description then only those bins containing parts whose part number or part description match your input will be shown.' => '',
- 'If you see this message, you most likely just setup your LX-Office and haven\'t added any entry types. If this is the case, the option is accessible for administrators in the System menu.' => '',
- 'If you want to change any of these parameters then press the "Back" button, edit the file "config/lx_office.conf" and login into the admin module again.' => '',
- 'If you want to delete such a dataset you have to edit the user(s) that are using the dataset in question and have them use another dataset.' => '',
- 'If you want to set up the authentication database yourself then log in to the administration panel. Lx-Office will then create the database and tables for you.' => '',
- 'If you yourself want to upgrade the installation then please read the file "doc/UPGRADE" and follow the steps outlined in this file.' => '',
- 'Image' => '',
- 'Import CSV' => '',
- 'In Lx-Office 2.4.0 the administrator has to enter a list of units in the administrative section.' => '',
- 'In order to do that hit the button "Delete transaction".' => '',
- 'In the latter case the tables needed by Lx-Office will be created in that database.' => '',
- 'In-line' => '',
- 'Inactive' => '',
- 'Include Exchangerate Difference' => '',
- 'Include column headings' => '',
- 'Include empty bins' => '',
- 'Include in Report' => '',
- 'Include in drop-down menus' => '',
- 'Includeable in reports' => '',
- 'Income Statement' => '',
- 'Income accno' => '',
- 'Incoming Payments' => '',
- 'Incoming invoice number' => '',
- 'Incorrect Password!' => '',
- 'Incorrect username or password!' => '',
- 'Increase' => '',
- 'Individual Items' => '',
- 'Information' => '',
- 'Interest' => '',
- 'Interest Rate' => '',
- 'Internal Notes' => '',
- 'International' => '',
- 'Internet' => '',
- 'Introduction of Buchungsgruppen' => '',
- 'Introduction of units' => '',
- 'Inv. Duedate' => '',
- 'Invalid' => '',
- 'Invalid follow-up ID.' => '',
- 'Invalid quantity.' => '',
- 'Invdate' => '',
- 'Invdate from' => '',
- 'Inventory' => '',
- 'Inventory Account' => '',
- 'Inventory quantity must be zero before you can set this assembly obsolete!' => '',
- 'Inventory quantity must be zero before you can set this part obsolete!' => '',
- 'Invno.' => '',
- 'Invnumber' => '',
- 'Invnumber missing!' => '',
- 'Invoice' => '',
- 'Invoice (one letter abbreviation)' => '',
- 'Invoice Date' => '',
- 'Invoice Date missing!' => '',
- 'Invoice Duedate' => '',
- 'Invoice Number' => '',
- 'Invoice Number missing!' => '',
- 'Invoice deleted!' => '',
- 'Invoice for fees' => '',
- 'Invoice has already been storno\'d!' => '',
- 'Invoice number' => '',
- 'Invoice with Storno (abbreviation)' => '',
- 'Invoices' => '',
- 'Is this a summary account to record' => '',
- 'It is possible that even after such a correction there is something wrong with this transaction (e.g. taxes that don\'t match the selected taxkey). Therefore you should re-run the general ledger analysis.' => '',
- 'It is possible to do this automatically for some Buchungsgruppen, but not for all.' => '',
- 'It is possible to do this automatically for some units, but for others the user has to chose the new unit.' => '',
- 'It may optionally be compressed with "gzip".' => '',
- 'It will simply set the taxkey to 0 (meaning "no taxes") which is the correct value for such inventory transactions.' => '',
- 'Item deleted!' => '',
- 'Item not on file!' => '',
- 'Jahresverkehrszahlen neu' => '',
- 'Jan' => '',
- 'January' => '',
- 'Journal' => '',
- 'Jul' => '',
- 'July' => '',
- 'Jump to' => '',
- 'Jun' => '',
- 'June' => '',
- 'KNE-Export erfolgreich!' => '',
- 'KNr. beim Kunden' => '',
- 'Keine Suchergebnisse gefunden!' => '',
- 'Konten' => '',
- 'Kontonummernerweiterung (KNE)' => '',
- 'L' => '',
- 'LIABILITIES' => '',
- 'LP' => '',
- 'LaTeX Templates' => '',
- 'Landscape' => '',
- 'Language' => '',
- 'Language Values' => '',
- 'Language deleted!' => '',
- 'Language missing!' => '',
- 'Language saved!' => '',
- 'Languages' => '',
- 'Last Article Number' => '',
- 'Last Cost' => '',
- 'Last Credit Note Number' => '',
- 'Last Customer Number' => '',
- 'Last Invoice Number' => '',
- 'Last Purchase Delivery Order Number' => '',
- 'Last Purchase Order Number' => '',
- 'Last RFQ Number' => '',
- 'Last Sales Delivery Order Number' => '',
- 'Last Sales Order Number' => '',
- 'Last Sales Quotation Number' => '',
- 'Last Service Number' => '',
- 'Last Transaction' => '',
- 'Last Vendor Number' => '',
- 'Lead' => '',
- 'Leave host and port field empty unless you want to make a remote connection.' => '',
- 'Left' => '',
- 'Liability' => '',
- 'License' => '',
- 'License key' => '',
- 'Licensed to' => '',
- 'Licenses' => '',
- 'Limit part selection' => '',
- 'Line Total' => '',
- 'Line endings' => '',
- 'List' => '',
- 'List Accounting Groups' => '',
- 'List Accounts' => '',
- 'List Businesses' => '',
- 'List Departments' => '',
- 'List Groups' => '',
- 'List Languages' => '',
- 'List Lead' => '',
- 'List Payment Terms' => '',
- 'List Price' => '',
- 'List Price Factors' => '',
- 'List Pricegroups' => '',
- 'List Printer' => '',
- 'List Tax' => '',
- 'List Transactions' => '',
- 'List Warehouses' => '',
- 'List bank accounts' => '',
- 'List export' => '',
- 'List of bank accounts' => '',
- 'List of bank transfers' => '',
- 'List of custom variables' => '',
- 'List open SEPA exports' => '',
- 'Load draft' => '',
- 'Local Tax Office Preferences' => '',
- 'Lock System' => '',
- 'Lockfile created!' => '',
- 'Lockfile removed!' => '',
- 'Login' => '',
- 'Login Name' => '',
- 'Login name missing!' => '',
- 'Logout' => '',
- 'Logout now' => '',
- 'Long Dates' => '',
- 'Long Description' => '',
- 'Lx-Office' => '',
- 'Lx-Office 2.4.0 introduces two new concepts: tax zones and Buchungsgruppen.' => '',
- 'Lx-Office can fix these problems automatically.' => '',
- 'Lx-Office has been switched to group-based access restrictions.' => '',
- 'Lx-Office has found one or more problems in the general ledger.' => '',
- 'Lx-Office is about to update the database <b>#1</b>.' => '',
- 'Lx-Office is now able to manage warehouses instead of just tracking the amount of goods in your system.' => '',
- 'Lx-Office website' => '',
- 'MAILED' => '',
- 'MSG_BROWSER_DOES_NOT_SUPPORT_IFRAMES' => '',
- 'Main Preferences' => '',
- 'Make' => '',
- 'Manage license keys' => '',
- 'Mandantennummer' => '',
- 'Mandatory Departments' => '',
- 'Mar' => '',
- 'March' => '',
- 'Margins' => '',
- 'Mark as closed' => '',
- 'Mark as paid?' => '',
- 'Mark closed' => '',
- 'Marked as paid' => '',
- 'Marked entries printed!' => '',
- 'Master Data' => '',
- 'Max. Dunning Level' => '',
- 'May' => '',
- 'May ' => '',
- 'May set the BCC field when sending emails' => '',
- 'Medium Number' => '',
- 'Memo' => '',
- 'Menu' => '',
- 'Message' => '',
- 'Method' => '',
- 'Microfiche' => '',
- 'Minimum Amount' => '',
- 'Miscellaneous' => '',
- 'Missing \'description\' field.' => '',
- 'Missing \'tag\' field.' => '',
- 'Missing Method!' => '',
- 'Missing Tax Authoritys Preferences' => '',
- 'Missing amount' => '',
- 'Missing parameter #1 in call to sub #2.' => '',
- 'Missing parameter (at least one of #1) in call to sub #2.' => '',
- 'Missing taxkeys in invoices with taxes.' => '',
- 'Mitarbeiter' => '',
- 'Mobile1' => '',
- 'Mobile2' => '',
- 'Model' => '',
- 'Module' => '',
- 'Module home page' => '',
- 'Module name' => '',
- 'Monat' => '',
- 'Monthly' => '',
- 'More than one #1 found matching, please be more specific.' => '',
- 'More than one control file with the tag \'%s\' exist.' => '',
- 'Multi mode not supported.' => '',
- 'Multibyte Encoding' => '',
- 'MwSt. inkl.' => '',
- 'Name' => '',
- 'Name missing!' => '',
- 'National' => '',
- 'National Expenses' => '',
- 'National Revenues' => '',
- 'Netto Terms' => '',
- 'New Buchungsgruppe #1' => '',
- 'New Templates' => '',
- 'New Win/Tab' => '',
- 'New assembly' => '',
- 'New bank account' => '',
- 'New contact' => '',
- 'New customer' => '',
- 'New invoice' => '',
- 'New part' => '',
- 'New sales order' => '',
- 'New service' => '',
- 'New unit' => '',
- 'New vendor' => '',
- 'Next Dunning Level' => '',
- 'No' => '',
- 'No %s was found matching the search parameters.' => '',
- 'No Company Address given' => '',
- 'No Company Name given' => '',
- 'No Customer was found matching the search parameters.' => '',
- 'No Database Drivers available!' => '',
- 'No Dataset selected!' => '',
- 'No Vendor was found matching the search parameters.' => '',
- 'No action defined.' => '',
- 'No backup file has been uploaded.' => '',
- 'No bank information has been entered in this vendor\'s master data entry. You cannot create bank transfers unless you enter bank information.' => '',
- 'No bins have been added to this warehouse yet.' => '',
- 'No customer has been selected yet.' => '',
- 'No data was found.' => '',
- 'No databases have been found on this server.' => '',
- 'No datasets have been selected.' => '',
- 'No dunnings have been selected for printing.' => '',
- 'No entries were found which had no unit assigned to them.' => '',
- 'No group has been selected, or the group does not exist anymore.' => '',
- 'No groups have been added yet.' => '',
- 'No licenses were found that match the search criteria.' => '',
- 'No or an unknown authenticantion module specified in "config/lx_office.conf".' => '',
- 'No part was found matching the search parameters.' => '',
- 'No prices will be updated because no prices have been entered.' => '',
- 'No problems were recognized.' => '',
- 'No transfers were executed in this export.' => '',
- 'No unknown units where found.' => '',
- 'No user has been selected.' => '',
- 'No valid number entered for pricegroup "#1".' => '',
- 'No vendor has been selected yet.' => '',
- 'No warehouse has been created yet or the quantity of the bins is not configured yet.' => '',
- 'No.' => '',
- 'Non-taxable Purchases' => '',
- 'Non-taxable Sales' => '',
- 'None' => '',
- 'Not Discountable' => '',
- 'Not delivered' => '',
- 'Not done yet' => '',
- 'Not obsolete' => '',
- 'Note' => '',
- 'Note: Taxkeys must have a "valid from" date, and will not be in effect otherwise.' => '',
- 'Notes' => '',
- 'Nothing has been selected for removal.' => '',
- 'Nothing has been selected for transfer.' => '',
- 'Nothing selected!' => '',
- 'Nothing to delete!' => '',
- 'Nov' => '',
- 'November' => '',
- 'Now the user must select a single Buchungsgruppe for each part instead of three distinct accounts.' => '',
- 'Number' => '',
- 'Number Format' => '',
- 'Number missing in Row' => '',
- 'Number of bins' => '',
- 'Number of copies' => '',
- 'Number of entries changed: #1' => '',
- 'Number of new bins' => '',
- 'Number pages' => '',
- 'Number variables: \'PRECISION=n\' forces numbers to be shown with exactly n decimal places.' => '',
- 'OB Transaction' => '',
- 'OBE-Export erfolgreich!' => '',
- 'Obsolete' => '',
- 'Oct' => '',
- 'October' => '',
- 'Off' => '',
- 'Old (on the side)' => '',
- 'On' => '',
- 'On Hand' => '',
- 'On Order' => '',
- 'One or more Perl modules missing' => '',
- 'Only due follow-ups' => '',
- 'Open' => '',
- 'Open Amount' => '',
- 'Open a further Lx-Office Window or Tab' => '',
- 'Open amount' => '',
- 'OpenDocument/OASIS' => '',
- 'Openings' => '',
- 'Optional comment' => '',
- 'Options' => '',
- 'Order' => '',
- 'Order Date' => '',
- 'Order Date missing!' => '',
- 'Order Number' => '',
- 'Order Number missing!' => '',
- 'Order deleted!' => '',
- 'Ordered' => '',
- 'Orientation' => '',
- 'Orphaned' => '',
- 'Other users\' follow-ups' => '',
- 'Other values are ignored.' => '',
- 'Others' => '',
- 'Otherwise all users will only have access to their own settings.' => '',
- 'Otherwise the variable is only available for printing.' => '',
- 'Out of balance transaction!' => '',
- 'Out of balance!' => '',
- 'Output Number Format' => '',
- 'Outputformat' => '',
- 'Overdue sales quotations and requests for quotations' => '',
- 'Own Product' => '',
- 'PAYMENT POSTED' => '',
- 'PDF' => '',
- 'PDF (OpenDocument/OASIS)' => '',
- 'PDF export -- options' => '',
- 'POSTED' => '',
- 'POSTED AS NEW' => '',
- 'PRINTED' => '',
- 'Packing List' => '',
- 'Packing List Date missing!' => '',
- 'Packing List Number missing!' => '',
- 'Packing Lists' => '',
- 'Page #1/#2' => '',
- 'Paid' => '',
- 'Part' => '',
- 'Part Description' => '',
- 'Part Description missing!' => '',
- 'Part Number' => '',
- 'Part Number missing!' => '',
- 'Part description' => '',
- 'Partnumber must not be set to empty!' => '',
- 'Partnumber not unique!' => '',
- 'Parts' => '',
- 'Parts Inventory' => '',
- 'Parts must have an entry type.' => '',
- 'Parts, services and assemblies' => '',
- 'Password' => '',
- 'Payables' => '',
- 'Payment' => '',
- 'Payment Reminder' => '',
- 'Payment Terms' => '',
- 'Payment Terms missing in row ' => '',
- 'Payment Terms saved!' => '',
- 'Payment date missing!' => '',
- 'Payment list as PDF' => '',
- 'Payment posted!' => '',
- 'Payment terms deleted!' => '',
- 'Payments' => '',
- 'Period' => '',
- 'Period:' => '',
- 'Personal settings' => '',
- 'Pg Database Administration' => '',
- 'Phone' => '',
- 'Phone1' => '',
- 'Phone2' => '',
- 'Pick List' => '',
- 'Please Check the bank information for each vendor:' => '',
- 'Please ask your administrator to create warehouses and bins.' => '',
- 'Please enter a license key.' => '',
- 'Please enter a number of licenses.' => '',
- 'Please enter the login for the new user.' => '',
- 'Please enter the name of the database that will be used as the template for the new database:' => '',
- 'Please enter the name of the dataset you want to restore the backup in.' => '',
- 'Please enter the taxnumber in the administration menu user preferences' => '',
- 'Please enter values' => '',
- 'Please insert object dimensions below.' => '',
- 'Please insert your language values below' => '',
- 'Please insert your longdescription below' => '',
- 'Please install the below listed modules or ask your system administrator to.' => '',
- 'Please re-run the analysis for broken general ledger entries by clicking this button:' => '',
- 'Please read the file' => '',
- 'Please select a customer from the list below.' => '',
- 'Please select a part from the list below.' => '',
- 'Please select a vendor from the list below.' => '',
- 'Please select the chart of accounts this installation is using from the list below.' => '',
- 'Please select the database you want to backup' => '',
- 'Please select the source bank account for the transfers:' => '',
- 'Please seletct the dataset you want to delete:' => '',
- 'Please specify a description for the warehouse designated for these goods.' => '',
- 'Plural' => '',
- 'Port' => '',
- 'Portrait' => '',
- 'Post' => '',
- 'Post Payment' => '',
- 'Post payments' => '',
- 'Postscript' => '',
- 'Posustva_coa' => '',
- 'Preferences' => '',
- 'Preferences saved!' => '',
- 'Prefix for the new bins\' names' => '',
- 'Preis' => '',
- 'Preisgruppe' => '',
- 'Preisklasse' => '',
- 'Prepare bank transfer via SEPA XML' => '',
- 'Prepayment' => '',
- 'Preview' => '',
- 'Previous transdate text' => '',
- 'Previous transnumber text' => '',
- 'Price' => '',
- 'Price Factor' => '',
- 'Price Factors' => '',
- 'Price factor deleted!' => '',
- 'Price factor saved!' => '',
- 'Pricegroup' => '',
- 'Pricegroup deleted!' => '',
- 'Pricegroup missing!' => '',
- 'Pricegroup saved!' => '',
- 'Pricegroups' => '',
- 'Print' => '',
- 'Print and Post' => '',
- 'Print dunnings' => '',
- 'Print list' => '',
- 'Print options' => '',
- 'Printer' => '',
- 'Printer Command' => '',
- 'Printer Command missing!' => '',
- 'Printer Description' => '',
- 'Printer deleted!' => '',
- 'Printer saved!' => '',
- 'Printing ... ' => '',
- 'Prior to Lx-Office v2.4.0 the user could enter arbitrary strings as units for parts, services and in invoices, sales quotations etc.' => '',
- 'Prior to Lx-Office v2.4.0 the user had to chose the accounts for each part and service.' => '',
- 'Private E-mail' => '',
- 'Private Phone' => '',
- 'Problem' => '',
- 'Produce Assembly' => '',
- 'Productivity' => '',
- 'Profit Center' => '',
- 'Proforma Invoice' => '',
- 'Program' => '',
- 'Project' => '',
- 'Project Number' => '',
- 'Project Number missing!' => '',
- 'Project Numbers' => '',
- 'Project Transactions' => '',
- 'Project deleted!' => '',
- 'Project not on file!' => '',
- 'Project saved!' => '',
- 'Projects' => '',
- 'Projecttransactions' => '',
- 'Prozentual/Absolut' => '',
- 'Purchase Invoice' => '',
- 'Purchase Order' => '',
- 'Purchase Orders' => '',
- 'Purchase Price' => '',
- 'Purchase Prices' => '',
- 'Purchase delivery order' => '',
- 'Purchase invoices' => '',
- 'Purpose' => '',
- 'Qty' => '',
- 'Qty according to delivery order' => '',
- 'Qty in stock' => '',
- 'Quantity' => '',
- 'Quantity missing.' => '',
- 'Quartal' => '',
- 'Quarter' => '',
- 'Quarterly' => '',
- 'Queue' => '',
- 'Quotation' => '',
- 'Quotation Date' => '',
- 'Quotation Date missing!' => '',
- 'Quotation Number' => '',
- 'Quotation Number missing!' => '',
- 'Quotation deleted!' => '',
- 'Quotations' => '',
- 'Quote chararacter' => '',
- 'Quoted' => '',
- 'RFQ' => '',
- 'RFQ Number' => '',
- 'RFQs' => '',
- 'ROP' => '',
- 'Ranges of numbers' => '',
- 'Ranges of numbers and default accounts' => '',
- 'Re-run analysis' => '',
- 'Receipt' => '',
- 'Receipt posted!' => '',
- 'Receipt, payment, reconciliation' => '',
- 'Receipts' => '',
- 'Receivables' => '',
- 'Rechnungsnummer' => '',
- 'Reconciliation' => '',
- 'Record in' => '',
- 'Recorded Tax' => '',
- 'Recorded taxkey' => '',
- 'Reference' => '',
- 'Reference missing!' => '',
- 'Release From Stock' => '',
- 'Remaining' => '',
- 'Removal' => '',
- 'Removal from Warehouse' => '',
- 'Removal from warehouse' => '',
- 'Removal qty' => '',
- 'Remove' => '',
- 'Remove Draft' => '',
- 'Remove draft when posting' => '',
- 'Remove from group' => '',
- 'Removed spoolfiles!' => '',
- 'Removing marked entries from queue ...' => '',
- 'Rename the group' => '',
- 'Report Positions' => '',
- 'Report about warehouse contents' => '',
- 'Report about warehouse transactions' => '',
- 'Report and misc. Preferences' => '',
- 'Report for' => '',
- 'Reports' => '',
- 'Representative' => '',
- 'Reqdate' => '',
- 'Request for Quotation' => '',
- 'Request for Quotations' => '',
- 'Request quotation' => '',
- 'Requested execution date' => '',
- 'Requested execution date from' => '',
- 'Requested execution date to' => '',
- 'Required by' => '',
- 'Restore Dataset' => '',
- 'Revenue' => '',
- 'Revenue Account' => '',
- 'Revenues EU with UStId' => '',
- 'Revenues EU without UStId' => '',
- 'Right' => '',
- 'SAVED' => '',
- 'SAVED FOR DUNNING' => '',
- 'SCREENED' => '',
- 'SEPA XML download' => '',
- 'SEPA exports:' => '',
- 'Saldo Credit' => '',
- 'Saldo Debit' => '',
- 'Saldo neu' => '',
- 'Saldo per' => '',
- 'Sale Prices' => '',
- 'Sales Invoice' => '',
- 'Sales Invoices' => '',
- 'Sales Order' => '',
- 'Sales Orders' => '',
- 'Sales and purchase invoices with inventory transactions with taxkeys' => '',
- 'Sales delivery order' => '',
- 'Sales invoice number' => '',
- 'Sales invoices' => '',
- 'Sales quotation' => '',
- 'Salesman' => '',
- 'Salesperson' => '',
- 'Same as the quote character' => '',
- 'Sat. Fax' => '',
- 'Sat. Phone' => '',
- 'Satz %' => '',
- 'Save' => '',
- 'Save Draft' => '',
- 'Save account first to insert taxkeys' => '',
- 'Save and AP Transaction' => '',
- 'Save and AR Transaction' => '',
- 'Save and Close' => '',
- 'Save and Invoice' => '',
- 'Save and Order' => '',
- 'Save and Quotation' => '',
- 'Save and RFQ' => '',
- 'Save and close' => '',
- 'Save as new' => '',
- 'Save draft' => '',
- 'Saving the file \'%s\' failed. OS error message: %s' => '',
- 'Screen' => '',
- 'Searchable' => '',
- 'Select' => '',
- 'Select a Customer' => '',
- 'Select a customer' => '',
- 'Select a part' => '',
- 'Select a part or assembly' => '',
- 'Select a period' => '',
- 'Select a vendor' => '',
- 'Select all' => '',
- 'Select federal state...' => '',
- 'Select from one of the items below' => '',
- 'Select from one of the names below' => '',
- 'Select from one of the projects below' => '',
- 'Select postscript or PDF!' => '',
- 'Select tax office...' => '',
- 'Select the chart of accounts in use' => '',
- 'Select the checkboxes that match users to the groups they should belong to.' => '',
- 'Select type of removal' => '',
- 'Select type of transfer' => '',
- 'Selection' => '',
- 'Selection fields: The option field must contain the available options for the selection. Options are separated by \'##\', for example \'Early##Normal##Late\'.' => '',
- 'Sell Price' => '',
- 'Send the backup via Email' => '',
- 'Sep' => '',
- 'Separator chararacter' => '',
- 'September' => '',
- 'Serial No.' => '',
- 'Serial Number' => '',
- 'Service' => '',
- 'Service Items' => '',
- 'Service Number missing!' => '',
- 'Service unit' => '',
- 'Services' => '',
- 'Set Language Values' => '',
- 'Set eMail text' => '',
- 'Setup Menu' => '',
- 'Setup Templates' => '',
- 'Ship to' => '',
- 'Ship via' => '',
- 'Shipping Address' => '',
- 'Shipping Point' => '',
- 'Shipto' => '',
- 'Shopartikel' => '',
- 'Short' => '',
- 'Show' => '',
- 'Show Salesman' => '',
- 'Show TODO list' => '',
- 'Show by default' => '',
- 'Show custom variable search inputs' => '',
- 'Show details' => '',
- 'Show follow ups...' => '',
- 'Show old dunnings' => '',
- 'Show overdue sales quotations and requests for quotations...' => '',
- 'Show your TODO list after loggin in' => '',
- 'Signature' => '',
- 'Since bin is not enforced in the parts data, please specify a bin where goods without a specified bin will be put.' => '',
- 'Skip' => '',
- 'Skonto' => '',
- 'Skonto Terms' => '',
- 'Sold' => '',
- 'Solution' => '',
- 'Source' => '',
- 'Source BIC' => '',
- 'Source IBAN' => '',
- 'Source bank account' => '',
- 'Source bin' => '',
- 'Spoolfile' => '',
- 'Start Dunning Process' => '',
- 'Start analysis' => '',
- 'Start the correction assistant' => '',
- 'Startdate_coa' => '',
- 'Starting Balance' => '',
- 'Statement' => '',
- 'Statement Balance' => '',
- 'Statement sent to' => '',
- 'Statements sent to printer!' => '',
- 'Step 1 of 3: Parts' => '',
- 'Step 2' => '',
- 'Step 2 of 3: Services' => '',
- 'Step 3 of 3: Assemblies' => '',
- 'Step 3 of 3: Default units' => '',
- 'Steuersatz' => '',
- 'Stock' => '',
- 'Stock value' => '',
- 'Storno' => '',
- 'Storno (one letter abbreviation)' => '',
- 'Storno Invoice' => '',
- 'Storno Packing List' => '',
- 'Street' => '',
- 'Stylesheet' => '',
- 'Subject' => '',
- 'Subject:' => '',
- 'Subtotal' => '',
- 'Such entries cannot be exported into the DATEV format and have to be fixed as well.' => '',
- 'Sum Credit' => '',
- 'Sum Debit' => '',
- 'Sum for' => '',
- 'Sum per' => '',
- 'Summen- und Saldenliste' => '',
- 'Superuser name' => '',
- 'Supplies' => '',
- 'Switch Menu on / off' => '',
- 'System' => '',
- 'TODO list' => '',
- 'TODO list options' => '',
- 'TOP100' => '',
- 'TOTAL' => '',
- 'Target bank account' => '',
- 'Tax' => '',
- 'Tax Consultant' => '',
- 'Tax Included' => '',
- 'Tax Number' => '',
- 'Tax Number / SSN' => '',
- 'Tax Office' => '',
- 'Tax Office Preferences' => '',
- 'Tax Percent is a number between 0 and 100' => '',
- 'Tax Period' => '',
- 'Tax Position' => '',
- 'Tax collected' => '',
- 'Tax deleted!' => '',
- 'Tax number' => '',
- 'Tax paid' => '',
- 'Tax saved!' => '',
- 'Tax-O-Matic' => '',
- 'Tax-o-matic Account' => '',
- 'Taxaccount_coa' => '',
- 'Taxation' => '',
- 'Taxdescription missing!' => '',
- 'Taxdescription_coa' => '',
- 'Taxes' => '',
- 'Taxkey' => '',
- 'Taxkey missing!' => '',
- 'Taxkey_coa' => '',
- 'Taxkeys and Taxreport Preferences' => '',
- 'Taxlink_coa' => '',
- 'Taxnumber' => '',
- 'Taxrate missing!' => '',
- 'Tel' => '',
- 'Tel.' => '',
- 'Telephone' => '',
- 'Template' => '',
- 'Template Code' => '',
- 'Template Code missing!' => '',
- 'Template database' => '',
- 'Templates' => '',
- 'Terms missing in row ' => '',
- 'Test connection' => '',
- 'Text field' => '',
- 'Text field variables: \'WIDTH=w HEIGHT=h\' sets the width and height of the text field. They default to 30 and 5 respectively.' => '',
- 'Text variables: \'MAXLENGTH=n\' sets the maximum entry length to \'n\'.' => '',
- 'Text, text field and number variables: The default value will be used as-is.' => '',
- 'That export does not exist.' => '',
- 'The \'tag\' field must only consist of alphanumeric characters or the carachters - _ ( )' => '',
- 'The AP transaction #1 has been deleted.' => '',
- 'The AR transaction #1 has been deleted.' => '',
- 'The GL transaction #1 has been deleted.' => '',
- 'The LDAP server "#1:#2" is unreachable. Please check config/lx_office.conf.' => '',
- 'The SEPA export has been created.' => '',
- 'The access rights have been saved.' => '',
- 'The account 3804 already exists, the update will be skipped.' => '',
- 'The account 3804 will not be added automatically.' => '',
- 'The assembly has been created.' => '',
- 'The assistant could not find anything wrong with #1. Maybe the problem has been solved in the meantime.' => '',
- 'The authentication configuration file "config/lx_office.conf" does not exist. This Lx-Office installation has probably not been updated correctly yet. Please contact your administrator.' => '',
- 'The authentication database is not reachable at the moment. Either it hasn\'t been set up yet or the database server might be down. Please contact your administrator.' => '',
- 'The available options depend on the varibale type:' => '',
- 'The backup you upload here has to be a file created with "pg_dump -o -Ft".' => '',
- 'The bank information must not be empty.' => '',
- 'The base unit does not exist or it is about to be deleted in row %d.' => '',
- 'The base unit does not exist.' => '',
- 'The base unit relations must not contain loops (e.g. by saying that unit A\'s base unit is B, B\'s base unit is C and C\'s base unit is A) in row %d.' => '',
- 'The columns "Dunning Duedate", "Total Fees" and "Interest" show data for the previous dunning created for this invoice.' => '',
- 'The config file "config/lx_office.conf" contained invalid Perl code:' => '',
- 'The config file "config/lx_office.conf" was not found.' => '',
- 'The connection to the LDAP server cannot be encrypted (SSL/TLS startup failure). Please check config/lx_office.conf.' => '',
- 'The connection to the authentication database failed:' => '',
- 'The connection to the database could not be established.' => '',
- 'The connection to the template database failed:' => '',
- 'The connection was established successfully.' => '',
- 'The creation of the authentication database failed:' => '',
- 'The custom variable has been deleted.' => '',
- 'The custom variable has been saved.' => '',
- 'The database #1 has been successfully deleted.' => '',
- 'The database for user management and authentication does not exist. You can create let Lx-Office create it with the following parameters:' => '',
- 'The database update/creation did not succeed. The file #1 contained the following error:' => '',
- 'The database upgrade for the introduction of Buchungsgruppen is now complete.' => '',
- 'The database upgrade for the introduction of units is now complete.' => '',
- 'The dataset #1 has been successfully created.' => '',
- 'The dataset backup has been sent via email to #1.' => '',
- 'The dataset has to exist before a restoration can be started.' => '',
- 'The dataset name is missing.' => '',
- 'The default value depends on the variable type:' => '',
- 'The delivery order has not been marked as delivered. The warehouse contents have not changed.' => '',
- 'The description is missing.' => '',
- 'The description is shown on the form. Chose something short and descriptive.' => '',
- 'The directory "%s" could not be created:\n%s' => '',
- 'The directory %s does not exist.' => '',
- 'The dunning process started' => '',
- 'The dunnings have been printed.' => '',
- 'The email address is missing.' => '',
- 'The factor is missing in row %d.' => '',
- 'The factor is missing.' => '',
- 'The first reason is that Lx-Office contained a bug which resulted in the wrong taxkeys being recorded for transactions in which two entries are posted for the same chart with different taxkeys.' => '',
- 'The follow-up date is missing.' => '',
- 'The following Buchungsgruppen have already been created:' => '',
- 'The following Datasets need to be updated' => '',
- 'The following drafts have been saved and can be loaded.' => '',
- 'The following transaction contains wrong taxes:' => '',
- 'The following transaction contains wrong taxkeys:' => '',
- 'The following units are unknown.' => '',
- 'The following units exist already:' => '',
- 'The following users have been migrated into the authentication database:' => '',
- 'The following warnings occured during an upgrade to the document templates:' => '',
- 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' => '',
- 'The greetings have been saved.' => '',
- 'The group has been added.' => '',
- 'The group has been deleted.' => '',
- 'The group has been saved.' => '',
- 'The group memberships have been saved.' => '',
- 'The group name is missing.' => '',
- 'The licensing module has been deactivated in lx_office.conf.' => '',
- 'The list has been printed.' => '',
- 'The login is missing.' => '',
- 'The name in row %d has already been used before.' => '',
- 'The name is missing in row %d.' => '',
- 'The name is missing.' => '',
- 'The name must only consist of letters, numbers and underscores and start with a letter.' => '',
- 'The old file containing the user information is still present ("#1"). Do you want to migrate these users into the database? If not then you will not be able to log in with any of the users present in the old file.' => '',
- 'The option field is empty.' => '',
- 'The parts for this delivery order have already been transferred in.' => '',
- 'The parts for this delivery order have already been transferred out.' => '',
- 'The parts have been removed.' => '',
- 'The parts have been stocked.' => '',
- 'The parts have been transferred.' => '',
- 'The payments have been posted.' => '',
- 'The pg_dump process could not be started.' => '',
- 'The pg_restore process could not be started.' => '',
- 'The preferred one is to install packages provided by your operating system distribution (e.g. Debian or RPM packages).' => '',
- 'The program\'s exit code was #1 ("0" usually means that everything went OK).' => '',
- 'The project has been added.' => '',
- 'The project has been saved.' => '',
- 'The restoration process has started. Here\'s the output of the "pg_restore" command:' => '',
- 'The restoration process is complete. Please review "pg_restore"\'s output to find out if the restoration was successful.' => '',
- 'The second reason is that Lx-Office allowed the user to enter the tax amount manually regardless of the taxkey used.' => '',
- 'The second way is to use Perl\'s CPAN module and let it download and install the module for you.' => '',
- 'The selected PostgreSQL installation uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => '',
- 'The selected bank account does not exist anymore.' => '',
- 'The selected bin does not exist.' => '',
- 'The selected exports have been closed.' => '',
- 'The selected warehouse does not exist.' => '',
- 'The selected warehouse is empty.' => '',
- 'The session is invalid or has expired.' => '',
- 'The source warehouse does not contain any bins.' => '',
- 'The subject is missing.' => '',
- 'The tables for user management and authentication do not exist. They will be created in the next step in the following database:' => '',
- 'The tabulator character' => '',
- 'The third way is to download the module from the above mentioned URL and to install the module manually following the installations instructions contained in the source archive.' => '',
- 'The transaction is shown below in its current state.' => '',
- 'The unit has been saved.' => '',
- 'The unit in row %d has been deleted in the meantime.' => '',
- 'The unit in row %d has been used in the meantime and cannot be changed anymore.' => '',
- 'The units have been saved.' => '',
- 'The user has been added to this group.' => '',
- 'The user has been removed from this group.' => '',
- 'The user is a member in the following group(s):' => '',
- 'The user migration process is complete.' => '',
- 'The variable name must only consist of letters, numbers and underscores. It must begin with a letter. Example: send_christmas_present' => '',
- 'The warehouse could not be deleted because it has already been used.' => '',
- 'The warehouse does not contain any bins.' => '',
- 'The warehouse or the bin is missing.' => '',
- 'The wrong taxkeys for AP and AR transactions have been fixed.' => '',
- 'The wrong taxkeys for inventory transactions for sales and purchase invoices have been fixed.' => '',
- 'The wrong taxkeys have been fixed.' => '',
- 'There are #1 more open invoices for this customer with other currencies.' => '',
- 'There are #1 more open invoices from this vendor with other currencies.' => '',
- 'There are #1 unfinished follow-ups of which #2 are due.' => '',
- 'There are bookings to the account 3803 after 01.01.2007. If you didn\'t change this account manually to 19% the bookings are probably incorrect.' => '',
- 'There are four tax zones.' => '',
- 'There are no items in stock.' => '',
- 'There are no items on your TODO list at the moment.' => '',
- 'There are still entries in the database for which no unit has been assigned.' => '',
- 'There are usually three ways to install Perl modules.' => '',
- 'There is at least one sales or purchase invoice for which Lx-Office recorded an inventory transaction with taxkeys even though no tax was recorded.' => '',
- 'There is at least one transaction for which the user has chosen a logically wrong taxkey.' => '',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, #5, for the transfer of #6.' => '',
- 'There is not enough available of \'#1\' at warehouse \'#2\', bin \'#3\', #4, for the transfer of #5.' => '',
- 'There is not enough left of \'#1\' in bin \'#2\' for the removal of #3.' => '',
- 'There is nothing to do in this step.' => '',
- 'Therefore there\'s no need to create the same article more than once if it is sold or bought in/from another tax zone.' => '',
- 'These units can be based on other units so that Lx-Office can convert prices when the user switches from one unit to another.' => '',
- 'These will only be effective if the account is NOT a summary account AND there exists at least one taxkey. Setting the account as a summary account will erase these settings.' => '',
- 'These wrong entries cannot be fixed automatically.' => '',
- 'This corresponds to Lx-Office\'s behavior prior to version 2.4.4.' => '',
- 'This could have happened for two reasons:' => '',
- 'This customer number is already in use.' => '',
- 'This group will be called "Full Access".' => '',
- 'This installation uses an unknown chart of accounts ("#1"). This database upgrade cannot create standard buchungsgruppen automatically.' => '',
- 'This is a preliminary check for existing sources. Nothing will be created or deleted at this stage!' => '',
- 'This list is capped at 15 items to keep it fast. If you need a full list, please use reports.' => '',
- 'This means that the user has created an AP transaction and chosen a taxkey for sales taxes, or that he has created an AR transaction and chosen a taxkey for input taxes.' => '',
- 'This module can help you identify and correct such entries by analyzing the general ledger and presenting you likely solutions but also allowing you to fix problems yourself.' => '',
- 'This transaction has to be split into several transactions manually.' => '',
- 'This update will change the nature the onhand of goods is tracked.' => '',
- 'This upgrade script tries to map all existing parts in the database to the newly created Buchungsgruppen.' => '',
- 'This upgrade script tries to map all existing units in the database to the newly created units.' => '',
- 'This vendor number is already in use.' => '',
- 'Time period for the analysis:' => '',
- 'Timestamp' => '',
- 'Title' => '',
- 'To' => '',
- 'To (email)' => '',
- 'To (time)' => '',
- 'To Date' => '',
- 'To add a user to a group edit a name, change the login name and save. A new user with the same variables will then be saved under the new login name.' => '',
- 'Top' => '',
- 'Top (CSS)' => '',
- 'Top (CSS) new' => '',
- 'Top (Javascript)' => '',
- 'Top (XUL; only for Mozilla Firefox)' => '',
- 'Top 100' => '',
- 'Top 100 hinzufuegen' => '',
- 'Top Level' => '',
- 'Total' => '',
- 'Total Fees' => '',
- 'Total stock value' => '',
- 'Totals' => '',
- 'Trade Discount' => '',
- 'Trans Id' => '',
- 'Trans Type' => '',
- 'Transaction' => '',
- 'Transaction %d cancelled.' => '',
- 'Transaction Date missing!' => '',
- 'Transaction ID missing.' => '',
- 'Transaction deleted!' => '',
- 'Transaction description' => '',
- 'Transaction has already been cancelled!' => '',
- 'Transaction has been split on both the credit and the debit side' => '',
- 'Transaction posted!' => '',
- 'Transactions, AR transactions, AP transactions' => '',
- 'Transdate' => '',
- 'Transfer' => '',
- 'Transfer Quantity' => '',
- 'Transfer To Stock' => '',
- 'Transfer from warehouse' => '',
- 'Transfer in' => '',
- 'Transfer out' => '',
- 'Transfer qty' => '',
- 'Translation (%s)' => '',
- 'Trial Balance' => '',
- 'Trial balance between %s and %s' => '',
- 'Trying to call a sub without a name' => '',
- 'Type' => '',
- 'Type of Business' => '',
- 'Type of Customer' => '',
- 'Type of Vendor' => '',
- 'USTVA' => '',
- 'USTVA 2004' => '',
- 'USTVA 2005' => '',
- 'USTVA 2006' => '',
- 'USTVA 2007' => '',
- 'USTVA-Hint: Method' => '',
- 'USTVA-Hint: Tax Authoritys' => '',
- 'USt-IdNr.' => '',
- 'USt-Konto' => '',
- 'UStVA' => '',
- 'UStVA (PDF-Dokument)' => '',
- 'UStVa' => '',
- 'UStVa Einstellungen' => '',
- 'Unbalanced Ledger' => '',
- 'Unchecked custom variables will not appear in orders and invoices.' => '',
- 'Unfinished follow-ups' => '',
- 'Unit' => '',
- 'Unit missing.' => '',
- 'Unit of measure' => '',
- 'Units marked for deletion will be deleted upon saving.' => '',
- 'Units that have already been used (e.g. for parts and services or in invoices or warehouse transactions) cannot be changed.' => '',
- 'Unknown Category' => '',
- 'Unknown Link' => '',
- 'Unknown chart of accounts' => '',
- 'Unknown dependency \'%s\'.' => '',
- 'Unknown problem type.' => '',
- 'Unlock System' => '',
- 'Until' => '',
- 'Update' => '',
- 'Update Dataset' => '',
- 'Update Prices' => '',
- 'Update SKR04: new tax account 3804 (19%)' => '',
- 'Update complete' => '',
- 'Update prices' => '',
- 'Update?' => '',
- 'Updated' => '',
- 'Use As Template' => '',
- 'Use Templates' => '',
- 'User' => '',
- 'User Config' => '',
- 'User data migration' => '',
- 'User deleted!' => '',
- 'User migration complete' => '',
- 'User name' => '',
- 'User saved!' => '',
- 'Username' => '',
- 'Users in<br>this group' => '',
- 'Users not in this group' => '',
- 'Ust-IDNr' => '',
- 'Valid from' => '',
- 'Valid until' => '',
- 'Value' => '',
- 'Variable' => '',
- 'Vendor' => '',
- 'Vendor Invoice' => '',
- 'Vendor Invoices' => '',
- 'Vendor Name' => '',
- 'Vendor Number' => '',
- 'Vendor Order Number' => '',
- 'Vendor deleted!' => '',
- 'Vendor details' => '',
- 'Vendor missing!' => '',
- 'Vendor not on file or locked!' => '',
- 'Vendor not on file!' => '',
- 'Vendor saved!' => '',
- 'Vendor type' => '',
- 'Vendors' => '',
- 'Verrechnungseinheit' => '',
- 'Version' => '',
- 'View License' => '',
- 'View SEPA export' => '',
- 'View warehouse content' => '',
- 'View/edit all employees sales documents' => '',
- 'Von Konto: ' => '',
- 'WHJournal' => '',
- 'Warehouse' => '',
- 'Warehouse From' => '',
- 'Warehouse Migration' => '',
- 'Warehouse To' => '',
- 'Warehouse content' => '',
- 'Warehouse deleted.' => '',
- 'Warehouse management' => '',
- 'Warehouse saved.' => '',
- 'Warehouses' => '',
- 'Warnings during template upgrade' => '',
- 'WebDAV link' => '',
- 'Weight' => '',
- 'Weight unit' => '',
- 'What <b>term</b> you are looking for?' => '',
- 'What type of item is this?' => '',
- 'With Extension Of Time' => '',
- 'Workflow Delivery Order' => '',
- 'Workflow purchase_order' => '',
- 'Workflow request_quotation' => '',
- 'Workflow sales_order' => '',
- 'Workflow sales_quotation' => '',
- 'Wrong Period' => '',
- 'Wrong date format!' => '',
- 'Wrong tax keys recorded' => '',
- 'Wrong taxes recorded' => '',
- 'YYYY' => '',
- 'Year' => '',
- 'Year End' => '',
- 'Yearly' => '',
- 'Yearly taxreport not yet implemented' => '',
- 'Yes' => '',
- 'Yes, included by default' => '',
- 'Yes/No (Checkbox)' => '',
- 'You are logged out!' => '',
- 'You can also create new units now.' => '',
- 'You can also delete this transaction and re-enter it manually.' => '',
- 'You can correct this transaction by chosing the correct taxkeys from the drop down boxes and hitting the button "Fix transaction" afterwards.' => '',
- 'You can create a missing dataset by going back and chosing "Create Dataset".' => '',
- 'You can create warehouses and bins via the menu "System -> Warehouses".' => '',
- 'You can declare different translations for singular and plural for each unit (e.g. "day" and "days).' => '',
- 'You can either create a new database or chose an existing database.' => '',
- 'You can only delete datasets that are not in use.' => '',
- 'You can use the following strings in the long description and all translations. They will be replaced by their actual values by Lx-Office before they\'re output.' => '',
- 'You cannot adjust the price for pricegroup "#1" by a negative percentage.' => '',
- 'You cannot continue before all required modules are installed.' => '',
- 'You cannot continue until all unknown units have been mapped to known ones.' => '',
- 'You cannot create an invoice for delivery orders for different customers.' => '',
- 'You cannot create an invoice for delivery orders from different vendors.' => '',
- 'You did not enter a name!' => '',
- 'You do not have the permissions to access this function.' => '',
- 'You have entered or selected the following shipping address for this customer:' => '',
- 'You have not added bank accounts yet.' => '',
- 'You have not selected any delivery order.' => '',
- 'You have not selected any export.' => '',
- 'You have not selected any item.' => '',
- 'You have selected none of the invoices.' => '',
- 'You have to chose a dimension unit and a service unit which will then be assigned to those entries.' => '',
- 'You have to chose which unit to save for each of them.' => '',
- 'You have to create at least one group, grant it access to Lx-Office\'s functions and assign users to it.' => '',
- 'You have to create new Buchungsgruppen for all the combinations of inventory, income and expense accounts that have been used already.' => '',
- 'You have to enter a company name in your user preferences (see the "Program" menu, "Preferences").' => '',
- 'You have to fill in at least an account number, the bank code, the IBAN and the BIC.' => '',
- 'You have to specify a department.' => '',
- 'You have to specify an execution date for each antry.' => '',
- 'You must chose a user.' => '',
- 'You should create a backup of the database before proceeding because the backup might not be reversible.' => '',
- 'You will now be forwarded to the administration panel.' => '',
- 'You\'re not editing a file.' => '',
- 'You\'ve already chosen the following limitations:' => '',
- 'Your PostgreSQL installationen uses UTF-8 as its encoding. Therefore you have to configure Lx-Office to use UTF-8 as well.' => '',
- 'Your TODO list' => '',
- 'Your browser does not currently support Javascript.' => '',
- 'Your download does not exist anymore. Please re-run the DATEV export assistant.' => '',
- 'Zeitpunkt' => '',
- 'Zeitraum' => '',
- 'Zero amount posting!' => '',
- 'Zip, City' => '',
- 'Zipcode' => '',
- 'Zusatz' => '',
- '[email]' => '',
- 'account_description' => '',
- 'accrual' => '',
- 'all entries' => '',
- 'ap_aging_list' => '',
- 'ar_aging_list' => '',
- 'as at' => '',
- 'assembly_list' => '',
- 'back' => '',
- 'bank_transfer_payment_list_#1' => '',
- 'bankaccounts' => '',
- 'banktransfers' => '',
- 'bestbefore #1' => '',
- 'bin_list' => '',
- 'bis' => '',
- 'button' => '',
- 'cash' => '',
- 'chargenumber #1' => '',
- 'chart_of_accounts' => '',
- 'choice' => '',
- 'choice part' => '',
- 'click here to edit cvars' => '',
- 'close' => '',
- 'closed' => '',
- 'config/lx_office.conf: Key "DB_config" is missing.' => '',
- 'config/lx_office.conf: Key "LDAP_config" is missing.' => '',
- 'config/lx_office.conf: Missing parameters in "DB_config". Required parameters are "host", "db" and "user".' => '',
- 'config/lx_office.conf: Missing parameters in "LDAP_config". Required parameters are "host", "attribute" and "base_dn".' => '',
- 'continue' => '',
- 'correction' => '',
- 'cp_greeting to cp_gender migration' => '',
- 'customer' => '',
- 'customer_list' => '',
- 'debug' => '',
- 'delete' => '',
- 'deliverydate' => '',
- 'direct debit' => '',
- 'disposed' => '',
- 'done' => '',
- 'down' => '',
- 'dunning_list' => '',
- 'eMail Send?' => '',
- 'eMail?' => '',
- 'ea' => '',
- 'emailed to' => '',
- 'executed' => '',
- 'female' => '',
- 'follow_up_list' => '',
- 'for' => '',
- 'for Period' => '',
- 'found' => '',
- 'from (time)' => '',
- 'general_ledger_list' => '',
- 'history' => '',
- 'history search engine' => '',
- 'invoice' => '',
- 'invoice_list' => '',
- 'lead deleted!' => '',
- 'lead saved!' => '',
- 'list' => '',
- 'list_of_payments' => '',
- 'list_of_receipts' => '',
- 'list_of_transactions' => '',
- 'logout' => '',
- 'male' => '',
- 'mark as paid' => '',
- 'missing' => '',
- 'month' => '',
- 'new Window' => '',
- 'no' => '',
- 'no bestbefore' => '',
- 'no chargenumber' => '',
- 'none (pricegroup)' => '',
- 'not executed' => '',
- 'not transferred in yet' => '',
- 'not transferred out yet' => '',
- 'not yet executed' => '',
- 'number' => '',
- 'oe.pl::search called with unknown type' => '',
- 'open' => '',
- 'order' => '',
- 'our vendor number at customer' => '',
- 'packing_list' => '',
- 'part_list' => '',
- 'pick_list' => '',
- 'plural first char' => '',
- 'pos_bilanz' => '',
- 'pos_bwa' => '',
- 'pos_eur' => '',
- 'pos_ustva' => '',
- 'posted!' => '',
- 'print' => '',
- 'proforma' => '',
- 'project_list' => '',
- 'purchase_delivery_order_list' => '',
- 'purchase_order' => '',
- 'purchase_order_list' => '',
- 'quarter' => '',
- 'quotation_list' => '',
- 'release_material' => '',
- 'report_generator_dispatch_to is not defined.' => '',
- 'report_generator_nextsub is not defined.' => '',
- 'request_quotation' => '',
- 'reset' => '',
- 'return_material' => '',
- 'rfq_list' => '',
- 'sales tax identification number' => '',
- 'sales_delivery_order_list' => '',
- 'sales_order' => '',
- 'sales_order_list' => '',
- 'sales_quotation' => '',
- 'saved' => '',
- 'saved!' => '',
- 'sent' => '',
- 'sent to printer' => '',
- 'service_list' => '',
- 'shipped' => '',
- 'singular first char' => '',
- 'soldtotal' => '',
- 'stock' => '',
- 'submit' => '',
- 'tax_chartaccno' => '',
- 'tax_percent' => '',
- 'tax_rate' => '',
- 'tax_taxdescription' => '',
- 'tax_taxkey' => '',
- 'taxnumber' => '',
- 'to (date)' => '',
- 'to (time)' => '',
- 'transfer' => '',
- 'transferred in' => '',
- 'transferred out' => '',
- 'trial_balance' => '',
- 'up' => '',
- 'use program settings' => '',
- 'used' => '',
- 'valid from' => '',
- 'vendor' => '',
- 'vendor_invoice_list' => '',
- 'vendor_list' => '',
- 'warehouse_journal_list' => '',
- 'warehouse_report_list' => '',
- 'wrongformat' => '',
- 'yes' => '',
-};
-
-1;
action=search
type=sales_delivery_order
-[AR--Reports--Invoices]
+[AR--Reports--Invoices, Credit Notes & AR Transactions]
ACCESS=invoice_edit
module=ar.pl
action=search
action=search
type=purchase_delivery_order
-[AP--Reports--Vendor Invoices]
+[AP--Reports--Vendor Invoices & AP Transactions]
ACCESS=vendor_invoice_edit
module=ap.pl
action=search
module=am.pl
action=show_history_search
+[System--Client Configuration]
+ACCESS=admin
+module=controller.pl
+action=ClientConfig/edit
+
[System--Employees]
ACCESS=admin
module=controller.pl
# Default-Start: 2 3 4 5
# Default-Stop: 0 1 6
# X-Interactive: true
-# Short-Description: Start/stop the Kivitendo task server
+# Short-Description: Start/stop the kivitendo task server
### END INIT INFO
set -e
-# Change this to point to the Kivitendo "task_server.pl" location.
+# Change this to point to the kivitendo "task_server.pl" location.
DAEMON="/opt/kivitendo/scripts/task_server.pl"
-TOPIC="Kivitendo task server"
+TOPIC="kivitendo task server"
if [ ! -x $DAEMON ] ; then
echo "$TOPIC executable not found"
-# kivitendo-task-server - Task server for Kivitendo
+# kivitendo-task-server - Task server for kivitendo
-description "Kivitendo task server"
+description "kivitendo task server"
start on runlevel [2345]
stop on runlevel [!2345]
Configuration of this script is located in:
- config/lx_office.conf
- config/lx_office.conf.default
+ config/kivitendo.conf
+ config/kivitendo.conf.default
See there for interesting options.
my ($opt_list, $opt_tree, $opt_rtree, $opt_nodeps, $opt_graphviz, $opt_help);
my ($opt_user, $opt_apply, $opt_applied, $opt_unapplied, $opt_format, $opt_test_utf8);
-my ($opt_dbhost, $opt_dbport, $opt_dbname, $opt_dbuser, $opt_dbpassword);
+my ($opt_dbhost, $opt_dbport, $opt_dbname, $opt_dbuser, $opt_dbpassword, $opt_create, $opt_type);
+my ($opt_description, $opt_encoding, @opt_depends);
our (%myconfig, $form, $user, $auth, $locale, $controls, $dbupgrader);
"\n\n";
}
+sub create_upgrade {
+ my (%params) = @_;
+
+ my $filename = $params{filename};
+ my $dbupgrader = $params{dbupgrader};
+ my $type = $params{type} || '';
+ my $description = $params{description} || '';
+ my $encoding = $params{encoding} || 'utf-8';
+ my @depends = @{ $params{depends} };
+
+ if (!@depends) {
+ my @releases = grep { /^release_/ } keys %$controls;
+ @depends = ((sort @releases)[-1]);
+ }
+
+ my $comment;
+ if ($type eq 'sql') {
+ $comment = '--';
+ } elsif ($type eq 'pl') {
+ $comment = '#';
+ } elsif (!$type) {
+ die 'Error: No --type was given but is required for --create.';
+ } else {
+ die 'Error: Unknown --type. Try "sql" or "pl".';
+ }
+
+ my $full_filename = $dbupgrader->path . '/' . $filename . '.' . $type;
+
+ die "file '$full_filename' already exists, aborting" if -f $full_filename;
+
+
+ open my $fh, ">:encoding($encoding)", $full_filename or die "can't open $full_filename";
+ print $fh "$comment \@tag: $filename\n";
+ print $fh "$comment \@description: $description\n";
+ print $fh "$comment \@depends: @depends\n";
+ print $fh "$comment \@encoding: $encoding\n";
+ close $fh;
+
+ system("\$EDITOR $full_filename");
+ exit 0;
+}
+
sub apply_upgrade {
my $name = shift;
"user=s" => \$opt_user,
"apply=s" => \$opt_apply,
"applied" => \$opt_applied,
+ "create=s" => \$opt_create,
+ "type=s" => \$opt_type,
+ "encoding=s" => \$opt_encoding,
+ "description=s" => \$opt_description,
+ "depends=s" => \@opt_depends,
"unapplied" => \$opt_unapplied,
"test-utf8" => \$opt_test_utf8,
"dbhost:s" => \$opt_dbhost,
dump_graphviz('file_name' => $opt_graphviz,
'format' => $opt_format) if (defined $opt_graphviz);
dump_nodeps() if ($opt_nodeps);
+create_upgrade(filename => $opt_create,
+ dbupgrader => $dbupgrader,
+ type => $opt_type,
+ description => $opt_description,
+ encoding => $opt_encoding,
+ depends => \@opt_depends) if ($opt_create);
if ($opt_user) {
$auth = SL::Auth->new();
dump_unapplied();
}
+
if ($opt_test_utf8) {
$form->error("--test-utf8 used but no database name given with --dbname.") if (!$opt_dbname);
},
'Devel::REPL' => {
'namespace::clean' => 1,
- }
+ },
+ 'Email::MIME' => {
+ 'Email::MIME::Creator' => 1,
+ },
+ 'Test::Harness' => {
+ 'TAP::Parser' => 1,
+ 'TAP::Parser::Aggregator' => 1,
+ },
);
GetOptions(
}
}
+# have all documented modules mentioned here
+$modules{$_->{name}} ||= { status => 'required' } for @SL::InstallationCheck::required_modules;
+$modules{$_->{name}} ||= { status => 'optional' } for @SL::InstallationCheck::optional_modules;
+$modules{$_->{name}} ||= { status => 'developer' } for @SL::InstallationCheck::developer_modules;
+
# build transitive closure for documented dependancies
my $changed = 1;
while ($changed) {
use utf8;
use strict;
+use Carp;
use Data::Dumper;
use English;
+use File::Slurp qw(slurp);
use FileHandle;
use Getopt::Long;
+use IO::Dir;
use List::Util qw(first);
use POSIX;
use Pod::Usage;
-use Carp;
-use File::Slurp qw(slurp);
$OUTPUT_AUTOFLUSH = 1;
my $dbupdir2 = "$basedir/sql/Pg-upgrade2";
my $menufile = "menu.ini";
my $submitsearch = qr/type\s*=\s*[\"\']?submit/i;
+our $self = {};
+our $missing = {};
+our @lost = ();
my (%referenced_html_files, %locale, %htmllocale, %alllocales, %cached, %submit);
my ($ALL_HEADER, $MISSING_HEADER, $LOST_HEADER);
init();
sub find_files {
- my ($dir_name, $files) = @_;
+ my ($top_dir_name) = @_;
- $files ||= [];
+ my (@files, $finder);
- my @dirs_to_check;
+ $finder = sub {
+ my ($dir_name) = @_;
- opendir my $dir, $dir_name or die "$! $dir_name";
+ tie my %dir_h, 'IO::Dir', $dir_name;
- foreach my $name (readdir $dir) {
- next if $name eq '.' || $name eq '..';
+ push @files, grep { -f } map { "${dir_name}/${_}" } keys %dir_h;
+ my @sub_dirs = grep { -d } map { "${dir_name}/${_}" } grep { ! m/^\.\.?$/ } keys %dir_h;
- my $full_name = "${dir_name}/${name}";
- if (-d $full_name) {
- push @dirs_to_check, $full_name;
- } else {
- push @{ $files }, $full_name;
- }
- }
+ $finder->($_) for @sub_dirs;
+ };
- closedir $dir;
+ $finder->($top_dir_name);
- map { find_files($_, $files) } @dirs_to_check;
+ return @files;
+}
- return @{ $files };
+sub merge_texts {
+# overwrite existing entries with the ones from 'missing'
+ $self->{texts}->{$_} = $missing->{$_} for grep { $missing->{$_} } keys %alllocales;
+
+ # try to set missing entries from lost ones
+ my %lost_by_text = map { ($_->{text} => $_->{translation}) } @lost;
+ $self->{texts}->{$_} = $lost_by_text{$_} for grep { !$self->{texts}{$_} } keys %alllocales;
}
my @bindir_files = find_files($bindir);
push @progfiles, map { m:^(.+)/([^/]+)$:; [ $2, $1 ] } grep { /\.pm$/ } map { find_files($_) } @progdirs;
# put customized files into @customfiles
-my @menufiles;
+my (@menufiles, %dir_h);
if ($opt_n) {
@customfiles = ();
@menufiles = ($menufile);
} else {
- opendir DIR, "$basedir" or die "$!";
- @menufiles = grep { /.*?_$menufile$/ } readdir DIR;
- closedir DIR;
- unshift @menufiles, $menufile;
+ tie %dir_h, 'IO::Dir', $basedir;
+ @menufiles = map { "$basedir/$_" } grep { /.*?_$menufile$/ } keys %dir_h;
+ unshift @menufiles, "$basedir/$menufile";
}
-opendir DIR, $dbupdir or die "$!";
-my @dbplfiles = grep { /\.pl$/ } readdir DIR;
-closedir DIR;
+tie %dir_h, 'IO::Dir', $dbupdir;
+my @dbplfiles = grep { /\.pl$/ } keys %dir_h;
-opendir DIR, $dbupdir2 or die "$!";
-my @dbplfiles2 = grep { /\.pl$/ } readdir DIR;
-closedir DIR;
+tie %dir_h, 'IO::Dir', $dbupdir2;
+my @dbplfiles2 = grep { /\.pl$/ } keys %dir_h;
# slurp the translations in
-our $self = {};
-our $missing = {};
-our @missing = ();
-our @lost = ();
-
if (-f "$locales_dir/all") {
require "$locales_dir/all";
}
my %old_texts = %{ $self->{texts} || {} };
-map({ handle_file(@{ $_ }); } @progfiles);
-map({ handle_file($_, $dbupdir); } @dbplfiles);
-map({ handle_file($_, $dbupdir2); } @dbplfiles2);
+handle_file(@{ $_ }) for @progfiles;
+handle_file($_, $dbupdir) for @dbplfiles;
+handle_file($_, $dbupdir2) for @dbplfiles2;
+scanmenu($_) for @menufiles;
+
+# merge entries to translate with entries from files 'missing' and 'lost'
+merge_texts();
# generate all
generate_file(
data_sub => sub { _print_line($_, $self->{texts}{$_}, @_) for sort keys %alllocales },
);
+ foreach my $text (keys %$missing) {
+ if ($locale{$text} || $htmllocale{$text}) {
+ unless ($self->{texts}{$text}) {
+ $self->{texts}{$text} = $missing->{$text};
+ }
+ }
+ }
+
+
# calc and generate missing
-push @missing, grep { !$self->{texts}{$_} } sort keys %alllocales;
+my @new_missing = grep { !$self->{texts}{$_} } sort keys %alllocales;
-if (@missing) {
+if (@new_missing) {
generate_file(
file => "$locales_dir/missing",
header => $MISSING_HEADER,
data_name => '$missing',
- data_sub => sub { _print_line($_, '', @_) for @missing },
+ data_sub => sub { _print_line($_, '', @_) for @new_missing },
);
}
search_unused_htmlfiles() if $opt_c;
my $count = scalar keys %alllocales;
-my $notext = scalar @missing;
+my $notext = scalar @new_missing;
my $per = sprintf("%.1f", ($count - $notext) / $count * 100);
print "\n$trlanguage - ${per}%";
print " - $notext/$count missing" if $notext;
}
$file =~ s/\.pl//;
-
- foreach my $text (keys %$missing) {
- if ($locale{$text} || $htmllocale{$text}) {
- unless ($self->{texts}{$text}) {
- $self->{texts}{$text} = $missing->{$text};
- }
- }
- }
}
sub extract_text_between_parenthesis {
}
- map { $alllocales{$_} = 1 } keys %{$cached{$file}{all}};
- map { $locale{$_} = 1 } keys %{$cached{$file}{locale}};
- map { $submit{$_} = 1 } keys %{$cached{$file}{submit}};
- map { &scanfile($_, 0, $scanned_files) } keys %{$cached{$file}{scan}};
- map { &scanfile($_, 1, $scanned_files) } keys %{$cached{$file}{scannosubs}};
- map { &scanhtmlfile($_) } keys %{$cached{$file}{scanh}};
+ $alllocales{$_} = 1 for keys %{$cached{$file}{all}};
+ $locale{$_} = 1 for keys %{$cached{$file}{locale}};
+ $submit{$_} = 1 for keys %{$cached{$file}{submit}};
+
+ scanfile($_, 0, $scanned_files) for keys %{$cached{$file}{scan}};
+ scanfile($_, 1, $scanned_files) for keys %{$cached{$file}{scannosubs}};
+ scanhtmlfile($_) for keys %{$cached{$file}{scanh}};
- @referenced_html_files{keys %{$cached{$file}{scanh}}} = (1) x scalar keys %{$cached{$file}{scanh}};
+ $referenced_html_files{$_} = 1 for keys %{$cached{$file}{scanh}};
}
sub scanmenu {
}
# copy back into global arrays
- map { $alllocales{$_} = 1 } keys %{$cached{$file}{all}};
- map { $locale{$_} = 1 } keys %{$cached{$file}{html}};
- map { $submit{$_} = 1 } keys %{$cached{$file}{submit}};
+ $alllocales{$_} = 1 for keys %{$cached{$file}{all}};
+ $locale{$_} = 1 for keys %{$cached{$file}{html}};
+ $submit{$_} = 1 for keys %{$cached{$file}{submit}};
- map { scanhtmlfile($_) } keys %{$cached{$file}{scanh}};
+ scanhtmlfile($_) for keys %{$cached{$file}{scanh}};
- @referenced_html_files{keys %{$cached{$file}{scanh}}} = (1) x scalar keys %{$cached{$file}{scanh}};
+ $referenced_html_files{$_} = 1 for keys %{$cached{$file}{scanh}};
}
sub search_unused_htmlfiles {
GetOptions(
'login|user=s' => \ my $login,
all => \ my $all,
- sugar => \ my $sugar,
'no-commit|dry-run' => \ my $nocommit,
help => sub { pod2usage(verbose => 99, sections => 'NAME|SYNOPSIS|OPTIONS') },
verbose => \ my $verbose,
);
$options->{login} = $login if $login;
- $options->{sugar} = $sugar;
$options->{all} = $all;
$options->{nocommit} = $nocommit;
$options->{verbose} = $verbose;
sub make_tables {
my @tables;
- if ($config{all} || $config{sugar}) {
- my ($type, $prefix) = $config{sugar} ? ('SUGAR', 'sugar_') : ('LXOFFICE', '');
- my $db = SL::DB::create(undef, $type);
- @tables =
- map { $package_names{$type}->{$_} ? "$_=" . $package_names{$type}->{$_} : $prefix ? "$_=$prefix$_" : $_ }
- grep { my $table = $_; !any { $_ eq $table } @{ $blacklist{$type} } }
+ if ($config{all}) {
+ my $db = SL::DB::create(undef, 'LXOFFICE');
+ @tables =
+ map { $package_names{LXOFFICE}->{$_} ? "$_=" . $package_names{LXOFFICE}->{$_} : $_ }
+ grep { my $table = $_; !any { $_ eq $table } @{ $blacklist{LXOFFICE} } }
$db->list_tables;
} elsif (@ARGV) {
@tables = @ARGV;
} else {
- error("You specified neither --sugar nor --all nor any specific tables.");
+ error("You specified neither --all nor any specific tables.");
usage();
}
=head1 SYNOPSIS
scripts/rose_create_model.pl --login login table1[=package1] [table2[=package2] ...]
- scripts/rose_create_model.pl --login login [--all|-a] [--sugar|-s]
+ scripts/rose_create_model.pl --login login [--all|-a]
# updates all models
scripts/rose_create_model.pl --login login --all
Process all tables from the database. Only those that are blacklistes in
L<SL::DB::Helper::Mappings> are excluded.
-=item C<--sugar, -s>
-
-Process tables in sugar schema instead of standard schema. Rarely useful unless
-you debug schema awareness of the RDBO layer.
-
=item C<--no-commit, -n>
+
=item C<--dry-run>
Do not write back generated files. This will do everything as usual but not
--- /dev/null
+-- @tag: chart_type_skonto
+-- @description: SKR: Gewährte Skonti sind Erlöskonten, erhaltene Skonti sind Aufwandskonten
+-- @depends: release_2_7_0
+-- @encoding: utf-8
+
+UPDATE chart SET category = 'I' WHERE accno = '8731' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR03EU');
+UPDATE chart SET category = 'I' WHERE accno = '8735' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR03EU');
+UPDATE chart SET category = 'E' WHERE accno = '3731' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR03EU');
+UPDATE chart SET category = 'E' WHERE accno = '3735' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR03EU');
+
+UPDATE chart SET category = 'I' WHERE accno = '4731' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR04EU');
+UPDATE chart SET category = 'I' WHERE accno = '4735' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR04EU');
+UPDATE chart SET category = 'I' WHERE accno = '4736' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR04EU');
+UPDATE chart SET category = 'E' WHERE accno = '5731' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR04EU');
+UPDATE chart SET category = 'E' WHERE accno = '5735' AND EXISTS (SELECT * FROM defaults WHERE coa = 'Germany-DATEV-SKR04EU');
--- /dev/null
+# @tag: contacts_convert_cp_birthday_to_date
+# @description: Umstellung cp_birthday von Freitext auf Datumsfeld
+# @depends: release_2_7_0
+package contacts_convert_cp_birthday_to_date;
+use strict;
+
+die 'This script cannot be run from the command line.' if !$::form;
+
+sub convert_to_date {
+ my ($str) = @_;
+
+ return '' if !$str;
+
+ my $sth = $dbh->prepare('SELECT ?::date AS date') or return undef;
+ $sth->execute($str) or return undef;
+
+ return $sth->fetchrow_hashref->{date};
+}
+
+sub update {
+ my @data = ();
+ my @auto_data = ();
+ my $sql = <<SQL;
+ SELECT
+ cp_id,
+ cp_givenname,
+ cp_name,
+ cp_birthday AS cp_birthday_old
+ FROM contacts
+ ORDER BY cp_id;
+SQL
+
+ my $sth = $dbh->prepare($sql) or die $dbh->errstr;
+ $sth->execute or die $dbh->errstr;
+
+ my $i = -1;
+ while (my $row = $sth->fetchrow_hashref) {
+ $i++;
+ $row->{cp_birthday} = convert_to_date($::form->{form_submitted} ? $::form->{'cp_birthday_'. $i} : $row->{cp_birthday_old});
+ $row->{row_index} = $i;
+
+ if ( defined($row->{cp_birthday}) ) {
+ push(@auto_data, $row);
+ } else {
+ push(@data, $row);
+ }
+ }
+
+ $::form->{data} = \@data;
+ $::form->{auto_data} = \@auto_data;
+ $::form->{row_length} = $i;
+
+ if (@data) {
+ print $::form->parse_html_template('dbupgrade/contacts_convert_cp_birthday_to_date_form');
+ return 2;
+ } else {
+ $sql = <<SQL;
+ ALTER TABLE contacts DROP COLUMN cp_birthday;
+ ALTER TABLE contacts ADD COLUMN cp_birthday date;
+SQL
+
+ $dbh->do($sql);
+
+ $sql = <<SQL;
+ UPDATE contacts
+ SET cp_birthday = ?
+ WHERE cp_id = ?
+SQL
+
+ $sth = $dbh->prepare($sql) or die $dbh->errstr;
+
+ foreach (grep { $_->{cp_birthday} ne '' } @auto_data) {
+ $sth->execute($_->{cp_birthday}, $_->{cp_id}) or die $dbh->errstr;
+ }
+
+ return 1;
+ }
+}
+
+return update();
--- /dev/null
+-- @tag: convert_curr_to_text
+-- @description: Spalte 'curr' von 'char(3)' nach 'text' konvertieren
+-- @depends: release_2_7_0
+-- @charset: utf-8
+
+-- Zuerst alle Spaltentypen konvertieren.
+ALTER TABLE ap ALTER COLUMN curr TYPE text;
+ALTER TABLE ar ALTER COLUMN curr TYPE text;
+ALTER TABLE customer ALTER COLUMN curr TYPE text;
+ALTER TABLE delivery_orders ALTER COLUMN curr TYPE text;
+ALTER TABLE exchangerate ALTER COLUMN curr TYPE text;
+ALTER TABLE rma ALTER COLUMN curr TYPE text;
+ALTER TABLE vendor ALTER COLUMN curr TYPE text;
+
+-- Eventuell falsche Inhalte (Leerzeichenpadding) auf leere Strings setzen.
+UPDATE ap SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE ar SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE customer SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE delivery_orders SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE exchangerate SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE oe SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE rma SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+UPDATE vendor SET curr = '' WHERE (curr SIMILAR TO '^ +$') OR (curr IS NULL);
+
+-- Nun noch die stored procedures anpassen.
+CREATE OR REPLACE FUNCTION del_exchangerate() RETURNS trigger
+ LANGUAGE plpgsql
+ AS $$
+ DECLARE
+ t_transdate date;
+ t_curr text;
+ t_id int;
+ d_curr text;
+ BEGIN
+ SELECT INTO d_curr substring(curr FROM '[^:]*') FROM DEFAULTS;
+
+ IF TG_RELNAME = 'ar' THEN
+ SELECT INTO t_curr, t_transdate curr, transdate FROM ar WHERE id = old.id;
+ END IF;
+
+ IF TG_RELNAME = 'ap' THEN
+ SELECT INTO t_curr, t_transdate curr, transdate FROM ap WHERE id = old.id;
+ END IF;
+
+ IF TG_RELNAME = 'oe' THEN
+ SELECT INTO t_curr, t_transdate curr, transdate FROM oe WHERE id = old.id;
+ END IF;
+
+ IF TG_RELNAME = 'delivery_orders' THEN
+ SELECT INTO t_curr, t_transdate curr, transdate FROM delivery_orders WHERE id = old.id;
+ END IF;
+
+ IF d_curr != t_curr THEN
+ SELECT INTO t_id a.id FROM acc_trans ac
+ JOIN ar a ON (a.id = ac.trans_id)
+ WHERE (a.curr = t_curr)
+ AND (ac.transdate = t_transdate)
+ EXCEPT SELECT a.id
+ FROM ar a
+ WHERE (a.id = old.id)
+
+ UNION
+
+ SELECT a.id
+ FROM acc_trans ac
+ JOIN ap a ON (a.id = ac.trans_id)
+ WHERE (a.curr = t_curr)
+ AND (ac.transdate = t_transdate)
+ EXCEPT SELECT a.id
+ FROM ap a
+ WHERE (a.id = old.id)
+
+ UNION
+
+ SELECT o.id
+ FROM oe o
+ WHERE (o.curr = t_curr)
+ AND (o.transdate = t_transdate)
+ EXCEPT SELECT o.id
+ FROM oe o
+ WHERE (o.id = old.id)
+
+ UNION
+
+ SELECT dord.id
+ FROM delivery_orders dord
+ WHERE (dord.curr = t_curr)
+ AND (dord.transdate = t_transdate)
+ EXCEPT SELECT dord.id
+ FROM delivery_orders dord
+ WHERE (dord.id = old.id);
+
+ IF NOT FOUND THEN
+ DELETE FROM exchangerate
+ WHERE (curr = t_curr)
+ AND (transdate = t_transdate);
+ END IF;
+ END IF;
+
+ RETURN old;
+ END;
+$$;
+
+-- Und die stored procedure auch auf delivery_orders anwenden
+CREATE TRIGGER del_exchangerate
+ BEFORE DELETE ON delivery_orders
+ FOR EACH ROW
+ EXECUTE PROCEDURE del_exchangerate();
--- /dev/null
+# @tag: defaults_datev_check
+# @description: Einstellung für DATEV-Überprüfungen (datev_check) vom Config-File in die DB verlagern.
+# @depends: release_2_7_0
+# @charset: utf-8
+
+use utf8;
+use strict;
+
+die("This script cannot be run from the command line.") unless ($main::form);
+
+sub mydberror {
+ my ($msg) = @_;
+ die($dbup_locale->text("Database update error:") .
+ "<br>$msg<br>" . $DBI::errstr);
+}
+
+sub do_query {
+ my ($query, $may_fail) = @_;
+
+ if (!$dbh->do($query)) {
+ mydberror($query) unless ($may_fail);
+ $dbh->rollback();
+ $dbh->begin_work();
+ }
+}
+
+sub do_update {
+
+ # this query will fail if column already exist (new database)
+ do_query(qq|ALTER TABLE defaults ADD COLUMN datev_check_on_sales_invoice boolean DEFAULT true|, 1);
+ do_query(qq|ALTER TABLE defaults ADD COLUMN datev_check_on_purchase_invoice boolean DEFAULT true|, 1);
+ do_query(qq|ALTER TABLE defaults ADD COLUMN datev_check_on_ar_transaction boolean DEFAULT true|, 1);
+ do_query(qq|ALTER TABLE defaults ADD COLUMN datev_check_on_ap_transaction boolean DEFAULT true|, 1);
+ do_query(qq|ALTER TABLE defaults ADD COLUMN datev_check_on_gl_transaction boolean DEFAULT true|, 1);
+
+ # check current configuration and set default variables accordingly, so that
+ # kivitendo's behaviour isn't changed by this update
+ # if checks are not set in config set it to true
+ foreach my $check (qw(check_on_sales_invoice check_on_purchase_invoice check_on_ar_transaction check_on_ap_transaction check_on_gl_transaction)) {
+ my $check_set = 1;
+ if (!$::lx_office_conf{datev_check}->{$check}) {
+ $check_set = 0;
+ }
+
+ my $update_column = "UPDATE defaults SET datev_$check = '$check_set';";
+ do_query($update_column);
+ }
+
+
+ return 1;
+}
+
+return do_update();
+
--- /dev/null
+# @tag: defaults_posting_config
+# @description: Einstellung, ob und wann Zahlungen änderbar sind, vom Config-File in die DB verlagern.
+# @depends: release_2_7_0
+# @charset: utf-8
+
+use utf8;
+use strict;
+
+die("This script cannot be run from the command line.") unless ($main::form);
+
+sub mydberror {
+ my ($msg) = @_;
+ die($dbup_locale->text("Database update error:") .
+ "<br>$msg<br>" . $DBI::errstr);
+}
+
+sub do_query {
+ my ($query, $may_fail) = @_;
+
+ if (!$dbh->do($query)) {
+ mydberror($query) unless ($may_fail);
+ $dbh->rollback();
+ $dbh->begin_work();
+ }
+}
+
+sub do_update {
+
+ # this query will fail if column already exist (new database)
+ do_query(qq|ALTER TABLE defaults ADD COLUMN payments_changeable integer NOT NULL DEFAULT 0|, 1);
+
+ # check current configuration and set default variables accordingly, so that
+ # Lx-Office behaviour isn't changed by this update
+ # if payments_changeable is not set in config set it to 0
+ my $payments_changeable = 0;
+ if ($::lx_office_conf{features}->{payments_changeable} == 1 ) {
+ $payments_changeable = 1;
+ } elsif ($::lx_office_conf{features}->{payments_changeable} == 2 ) {
+ $payments_changeable = 2;
+ }
+
+ my $update_column = "UPDATE defaults SET payments_changeable = '$payments_changeable';";
+ do_query($update_column);
+
+ return 1;
+}
+
+return do_update();
+
--- /dev/null
+-- @tag: defaults_posting_records_config
+-- @description: Einstellung, ob und wann Belegbuchungen änderbar/löschbar sind.
+-- @depends: release_2_7_0
+-- @charset: utf-8
+
+ALTER TABLE defaults ADD COLUMN is_changeable integer NOT NULL DEFAULT 2;
+ALTER TABLE defaults ADD COLUMN ir_changeable integer NOT NULL DEFAULT 2;
+ALTER TABLE defaults ADD COLUMN ar_changeable integer NOT NULL DEFAULT 2;
+ALTER TABLE defaults ADD COLUMN ap_changeable integer NOT NULL DEFAULT 2;
+ALTER TABLE defaults ADD COLUMN gl_changeable integer NOT NULL DEFAULT 2;
--- /dev/null
+# @tag: defaults_show_bestbefore
+# @description: Einstellung, ob Mindesthaltbarkeitsdatum angezeigt wird, vom Config-File in die DB verlagern.
+# @depends: release_2_7_0
+# @charset: utf-8
+
+use utf8;
+use strict;
+
+die("This script cannot be run from the command line.") unless ($main::form);
+
+sub mydberror {
+ my ($msg) = @_;
+ die($dbup_locale->text("Database update error:") .
+ "<br>$msg<br>" . $DBI::errstr);
+}
+
+sub do_query {
+ my ($query, $may_fail) = @_;
+
+ if (!$dbh->do($query)) {
+ mydberror($query) unless ($may_fail);
+ $dbh->rollback();
+ $dbh->begin_work();
+ }
+}
+
+sub do_update {
+
+ # this query will fail if column already exist (new database)
+ do_query(qq|ALTER TABLE defaults ADD COLUMN show_bestbefore boolean DEFAULT false|, 1);
+
+ # check current configuration and set default variables accordingly, so that
+ # Lx-Office behaviour isn't changed by this update
+ # if show_best_before is not set in config set it to 0
+ my $show_bestbefore = 0;
+ if ($::lx_office_conf{features}->{show_best_before}) {
+ $show_bestbefore = 1;
+ }
+
+ my $update_column = "UPDATE defaults SET show_bestbefore = '$show_bestbefore';";
+ do_query($update_column);
+
+ return 1;
+}
+
+return do_update();
+
--- /dev/null
+-- @tag: defaults_show_delete_on_orders
+-- @description: Einstellung, ob der "Löschen"-Knopf bei Aufträgen und Lieferscheinen angezeigt wird.
+-- @depends: release_2_7_0
+-- @charset: utf-8
+
+ALTER TABLE defaults ADD COLUMN sales_order_show_delete boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN purchase_order_show_delete boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN sales_delivery_order_show_delete boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN purchase_delivery_order_show_delete boolean DEFAULT TRUE;
--- /dev/null
+-- @tag: defaults_show_mark_as_paid_config
+-- @description: Einstellung, ob der "als bezahlt markieren"-Knopf angezeigt wird.
+-- @depends: release_2_7_0
+-- @charset: utf-8
+
+ALTER TABLE defaults ADD COLUMN is_show_mark_as_paid boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN ir_show_mark_as_paid boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN ar_show_mark_as_paid boolean DEFAULT TRUE;
+ALTER TABLE defaults ADD COLUMN ap_show_mark_as_paid boolean DEFAULT TRUE;
--- /dev/null
+# @tag: finanzamt_update_fa_bufa_nr_hamburg
+# @description: Aktualisiert die fa_bufa_nr für Hamburg
+# @depends: release_2_7_0
+# @charset: utf-8
+package finanzamt_update_fa_bufa_nr_hamburg;
+use utf8;
+use strict;
+
+if ( !$::form ) {
+ die('This script cannot be run from the command line.');
+}
+
+sub query {
+ my ($query) = @_;
+
+ if ( !$dbh->do($query) ) {
+ die($dbup_locale->text('Database update error:') .'<br>'. $query .'<br>'. $DBI::errstr);
+ }
+}
+
+my @data = (
+ ['02', '41'],
+ ['57', '42'],
+ ['71', '43'],
+ ['15', '43'],
+ ['03', '44'],
+ ['54', '45'],
+ ['22', '46'],
+ ['06', '47'],
+ ['74', '48'],
+ ['26', '49'],
+ ['09', '50'],
+ ['08', '51'],
+ );
+
+foreach my $entry (@data) {
+ query('
+ UPDATE finanzamt
+ SET
+ fa_bufa_nr = \'22'. $entry->[1] .'\'
+ WHERE
+ fa_land_nr = \'2\'
+ AND fa_bufa_nr = \'22'. $entry->[0] .'\';');
+}
+
+return 1;
# @depends: release_2_6_3
# @charset: utf-8
-# this script relies on $eur still being set in lx_office.conf, and the
+# this script relies on $eur still being set in kivitendo.conf, and the
# variable available in $::lx_office_conf{system}->{eur}
use utf8;
+++ /dev/null
-Testsuite for Lx-Office.
-
-These tests are a means to ensure basic sanity among the lx-office source
-files. The test framework was originally written by the guys of Bugzilla, and
-has been modified to cope with the Lx-Office structure.
-
-To run a full test use the shell script t/test.sh.
-You can also run every test with the perl interpreter like this:
-
-$ perl t/001compile.t
-
-A makefile for an automated make test would be highly appreciated.
-
-
-
-The Tests:
-
-001compile.t: Tries to compile every source file. Bails out if any errors occur.
-002goodperl.t: Checks every perl source file for taint, warnings and strict.
- While taint is not seen mandatory, warnings and strict are.
-003safesys: Checks is system() and exec() calls are fully qualified.
-004template.t defunct!
-005no_tabs.t checks every file for the \t Tab char. don't use tabs please.
-006spelling.t checks for common spelling errors.
-011pod.t checks if POD syntax is correct.
-
-
-Wanted Tests:
-
-- module check
-- check if symlinks are missing.
-- check for anything outside lower ascii in pl/pm files (only place for complex
- coding is locale)
-- check for msdos line endings
-- check for trailing whitespace
-- Devise a test to check if there are modifications to locales without a
- locales.pl run.
-- Test if parse_template can compile all html templates.
-
-and later:
-- spec tests for pure backend modules like Form.pm and Common.pm
--- /dev/null
+use Test::More tests => 4;
+
+use lib 't';
+
+use Support::TestSetup;
+
+use_ok 'SL::BackgroundJob::Base';
+
+my @expected_known_job_classes = qw(CleanBackgroundJobHistory CreatePeriodicInvoices SelfTest Test);
+is_deeply [ SL::BackgroundJob::Base->get_known_job_classes ], \@expected_known_job_classes, 'get_known_job_classes called as class method';
+
+my $job = new_ok 'SL::BackgroundJob::Base';
+is_deeply [ $job->get_known_job_classes ], \@expected_known_job_classes, 'get_known_job_classes called as instance method';
-use Test::More tests => 41;
+use Test::More tests => 47;
use lib 't';
+use utf8;
use Data::Dumper;
-use utf8;
+use Support::TestSetup;
-use_ok 'Support::TestSetup';
use_ok 'SL::Helper::Csv';
Support::TestSetup::login();
$csv = SL::Helper::Csv->new(
file => \"Description\nKaffee",
class => 'SL::DB::Part',
+ case_insensitive_header => 1,
+ profile => { description => 'description' },
);
$csv->parse;
is_deeply $csv->get_data, [ { description => 'Kaffee' } ], 'case insensitive header from csv works';
#####
$csv = SL::Helper::Csv->new(
-file => \"Kaffee",
-header => [ 'Description' ],
-class => 'SL::DB::Part',
+ file => \"Kaffee",
+ header => [ 'Description' ],
+ class => 'SL::DB::Part',
+ case_insensitive_header => 1,
+ profile => { description => 'description' },
);
$csv->parse;
is_deeply $csv->get_data, [ { description => 'Kaffee' } ], 'case insensitive header as param works';
$csv->parse;
is_deeply $csv->get_data, [ { description => 'Kaffee' } ], 'utf8 BOM works (bug 1872)';
+#####
+
+$csv = SL::Helper::Csv->new(
+ file => \"Kaffee",
+ header => [ 'Description' ],
+ class => 'SL::DB::Part',
+);
+$csv->parse;
+is_deeply $csv->get_data, undef, 'case insensitive header without flag ignores';
+
+#####
+
+$csv = SL::Helper::Csv->new(
+ file => \"Kaffee",
+ header => [ 'foo' ],
+ class => 'SL::DB::Part',
+ profile => { foo => '' },
+);
+$csv->parse;
+
+is_deeply $csv->get_data, [ { foo => 'Kaffee' } ], 'empty path still gets parsed into data';
+ok $csv->get_objects->[0], 'empty path gets ignored in object creation';
+
+#####
+
+$csv = SL::Helper::Csv->new(
+ file => \"Kaffee",
+ header => [ 'foo' ],
+ class => 'SL::DB::Part',
+ strict_profile => 1,
+ profile => { foo => '' },
+);
+$csv->parse;
+
+is_deeply $csv->get_data, [ { foo => 'Kaffee' } ], 'empty path still gets parsed into data (strict profile)';
+ok $csv->get_objects->[0], 'empty path gets ignored in object creation (strict profile)';
+
+$csv = SL::Helper::Csv->new(
+ file => \"Phil",
+ header => [ 'CVAR_grOUnDHog' ],
+ class => 'SL::DB::Part',
+ strict_profile => 1,
+ case_insensitive_header => 1,
+ profile => { cvar_Groundhog => '' },
+);
+$csv->parse;
+
+is_deeply $csv->get_data, [ { cvar_Groundhog => 'Phil' } ], 'using empty path to get cvars working';
+ok $csv->get_objects->[0], '...and not destorying the objects';
+
# vim: ft=perl
-find t | grep "\.t$" | grep -v '^t/old' | HARNESS_OPTIONS=j:c xargs perl -Imodules/override -MTest::Harness -e 'BEGIN { push @INC, "modules/fallback" } runtests(@ARGV)'
+#!/bin/bash
+
+{
+ if [[ -z $1 ]]; then
+ find t -type f -name '*.t'
+ else
+ echo -- "$@"
+ fi
+} | HARNESS_OPTIONS=j:c xargs perl -Imodules/override -MTest::Harness -e 'BEGIN { push @INC, "modules/fallback" } runtests(@ARGV)'
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<h2 align=center>
-<%company%>
-<br><%address%>
-
-<p>BALANCE SHEET
-<br><%period%>
-</h2>
-
-<table border=0>
-<tr>
- <th align=left width=400 colspan=2>ASSETS<br><hr align=left width=250 size=5 noshade></th>
- <th><%this_period%></th>
- <th><%last_period%></th>
-</tr>
-
-<%foreach asset_account%>
-<tr>
- <td> </td>
- <td><%asset_account%></td>
- <td align=right><%asset_this_period%></td>
- <td align=right><%asset_last_period%></td>
-</tr>
-<%end asset_account%>
-
-<tr>
- <td colspan=2> </td>
- <td><hr noshade size=1></td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <th align=left colspan=2>TOTAL ASSETS</th>
- <td align=right><%total_assets_this_period%><hr noshade size=2></td>
- <td align=right><%total_assets_last_period%><hr noshade size=2></td>
-</tr>
-
-<tr>
- <th align=left colspan=4>LIABILITIES<b><hr align=left width=250 size=5 noshade></th>
-</tr>
-
-<%foreach liability_account%>
-<tr>
- <td></td>
- <td><%liability_account%></td>
- <td align=right><%liability_this_period%></td>
- <td align=right><%liability_last_period%></td>
-</tr>
-<%end liability_account%>
-
-<tr>
- <td colspan=2> </td>
- <td><hr noshade size=1></td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <td></td>
- <th align=left>Total Liabilities</th>
- <td align=right><%total_liabilities_this_period%><br><hr noshade size=2</td>
- <td align=right><%total_liabilities_last_period%><br><hr noshade size=2</td>
-</tr>
-
-<tr>
- <th align=left colspan=4>SHAREHOLDER'S EQUITY<br><hr align=left width=250 size=5 noshade></th>
-</tr>
-
-<%foreach equity_account%>
-<tr>
- <td></td>
- <td><%equity_account%></td>
- <td align=right><%equity_this_period%></td>
- <td align=right><%equity_last_period%></td>
-</tr>
-<%end equity_account%>
-
-<tr>
- <td colspan=2> </td>
- <td><hr noshade size=1></td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <td></td>
- <th align=left>Total Equity</th>
- <td align=right><%total_equity_this_period%><br><hr noshade size=2</td>
- <td align=right><%total_equity_last_period%><br><hr noshade size=2</td>
-</tr>
-
-<tr valign=top>
- <th align=left colspan=2>TOTAL LIABILITIES & EQUITY</th>
- <td align=right><%total_this_period%><br><hr noshade size=2></td>
- <td align=right><%total_last_period%><br><hr noshade size=2></td>
-</tr>
-</table>
-
-
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
-
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <th align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>B I N L I S T</h4>
- </th>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% cellspacing=0 cellpadding=0>
- <tr bgcolor=000000>
- <th align=left width=50%><font color=ffffff>From</th>
- <th align=left width=50%><font color=ffffff>Ship To</th>
- </tr>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- <br>
-
- <%if contact%>
- <br>Attn: <%contact%>
- <%end contact%>
-
- <%if vendorphone%>
- <br>Tel: <%vendorphone%>
- <%end vendorphone%>
-
- <%if vendorfax%>
- <br>Fax: <%vendorfax%>
- <%end vendorfax%>
-
- <%if email%>
- <br><%email%>
- <%end email%>
-
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
-
- <br>
- <%if shiptocontact%>
- <br>Attn: <%shiptocontact%>
- <%end shiptocontact%>
-
- <%if shiptophone%>
- <br>Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- <br>Fax: <%shiptofax%>
- <%end shiptofax%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height=5></tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left nowrap>Order #</th>
- <th width=17% align=left nowrap>Date</th>
- <th width=17% align=left nowrap>Contact</th>
- <%if warehouse%>
- <th width=17% align=left nowrap>Warehouse</th>
- <%end warehouse%>
- <th width=17% align=left>Shipping Point</th>
- <th width=15% align=left>Ship via</th>
- </tr>
-
- <tr>
- <td><%ordnumber%> </td>
-
- <%if shippingdate%>
- <td><%shippingdate%></td>
- <%end shippingdate%>
-
- <%if not shippingdate%>
- <td><%orddate%></td>
- <%end shippingdate%>
-
- <td><%employee%> </td>
-
- <%if warehouse%>
- <td><%warehouse%></td>
- <%end warehouse%>
-
- <td><%shippingpoint%> </td>
- <td><%shipvia%> </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>Pos</th>
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Serialnumber</th>
- <th> </th>
- <th><font color=ffffff>Qty</th>
- <th><font color=ffffff>Recd</th>
- <th> </th>
- <th><font color=ffffff>Bin</th>
- </tr>
-
- <%foreach number%>
- <tr valign=top>
- <td><%runningnumber%></td>
- <td><%number%></td>
- <td><%description%></td>
- <td><%serialnumber%></td>
- <td><%deliverydate%></td>
- <td align=right><%qty%></td>
- <td align=right><%ship%></td>
- <td><%unit%></td>
- <td><%bin%></td>
- </tr>
- <%end number%>
-
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td><hr noshade></td>
- </tr>
-
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{%
- <%company%>
-
- <%address%>
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
-\textbf{From}
-\vspace{0.7cm}
-
-<%name%> \\
-<%street%> \\
-<%zipcode%> \\
-<%city%> \\
-<%country%>
-}
-\parbox[t]{.4\textwidth}{
-\textbf{Ship To}
-\vspace{0.7cm}
-
-<%shiptoname%> \\
-<%shiptostreet%> \\
-<%shiptozipcode%> \\
-<%shiptocity%> \\
-<%shiptocountry%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{B I N} \parbox{0.3cm}{\hfill} \textbf{L I S T}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{Order \#} & \textbf{Date} & \textbf{Contact}
- <%if warehouse%>
- & \textbf{Warehouse}
- <%end warehouse%>
- & \textbf{Shipping Point} & \textbf{Ship via} \\ [0.5em]
- \hline
-
- <%ordnumber%>
- <%if shippingdate%>
- & <%shippingdate%>
- <%end shippingdate%>
- <%if not shippingdate%>
- & <%orddate%>
- <%end shippingdate%>
- & <%employee%>
- <%if warehouse%>
- & <%warehouse%>
- <%end warehouse%>
- & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{@{}rlXllrrll@{}}
- \textbf{Pos} & \textbf{Number} & \textbf{Description} & \textbf{Serial Number} & & \textbf{Qty} & \textbf{Recd} & & \textbf{Bin} \\
-
-<%foreach number%>
- <%runningnumber%> & <%number%> & <%description%> & <%serialnumber%> &
- <%deliverydate%> & <%qty%> & <%ship%> & <%unit%> & <%bin%> \\
-<%end number%>
-\end{tabularx}
-
-
-\rule{\textwidth}{2pt}
-
-\end{document}
-
+++ /dev/null
-<body>
-<style type="text/css">
-<!--
-/* Allgemeine Schriftdefinition */
-th,td {
- font-family: Arial, Verdana, Helvetica, Sans-serif;
- font-size:small;
-}
-
-@page {
- size: landscape;
- margin: 0.5cm;
-}
-
-/* Definition Tabellenueberschrift */
-
-.left { text-align:left; }
-.center { text-align:center; }
-.right { text-align:right; }
-
-tr.headline { border:0; }
-tr.headline td { border:0; }
-h1 { font-size:120%; }
-h2 { font-size:100%; }
-
-/* Tabellenkopf */
-th {
- font-weight: bold;
- border-bottom: solid thin black;
- padding:0 10px;
- text-align:right;
-}
-
-th.left { border-left: solid thin black; }
-th.right { border-right: solid thin black; }
-
-.querkopf th.right { text-align:center; }
-.querkopf th {
- border-top: solid thin black;
- border-bottom:0;
-}
-
-/* Tabelleninhalt */
-td {
- text-align:right;
- padding:0 0.5em;
-}
-td.left { border-left: solid thin black; }
-td.right { border-right: solid thin black; }
-
-
-/* jede zweite Zeile grau hinterlegen */
-tr.grey {
- background:#f0f0f0;
-}
-
-/* letzte Zeile in der Tabelle */
-#last td{ border-bottom: solid thin black; }
-
-/* Zwischensumme/-ueberschriften */
-tr.subtotal td { font-weight: bold; }
-
-/* Fusszeile unter der Tabelle */
-td.footer {
- text-align:right;
- font-size:smaller;
-}
-//-->
-</style>
-
-<table border=0 cellpadding=0 cellspacing=0>
-<tr class="headline">
- <td class="left"><%company%></td>
- <td class=center colspan="9">
- <h1>Kurzfristige Erfolgsrechnung <%period%></h1>
- <h2>SKR3 BWA</h2>
- </td>
- <td class="right">Blatt 1</td>
-</tr>
-
-
-</tr>
-<tr class="querkopf">
- <th class="left"> </th>
- <th class="center" colspan="5">Im Betrachtungszeitraum</th>
- <th class="right" colspan="5">Kumuliert seit Jahresanfang</th>
-</tr>
-
-<tr>
- <th class="left">Bezeichnung</th>
- <th>Wert</th>
- <th>% Ges.- Leistg.</th>
- <th>% Ges.- Kosten</th>
- <th>% Pers.- Kosten</th>
- <th>Aufschlag</th>
- <th>Wert</th>
- <th>% Ges.- Leistg.</th>
- <th>% Ges.- Kosten</th>
- <th>% Pers.- Kosten</th>
- <th class="right">Aufschlag</th>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Umsatzerlöse</nobr></td>
- <td><nobr><%jetzt1%></nobr></td>
- <td><nobr><%jetztgl1%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm1%></nobr></td>
- <td><nobr><%kummgl1%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Best.Verdg. FE/UE</nobr></td>
- <td><nobr><%jetzt2%></nobr></td>
- <td><nobr><%jetztgl2%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm2%></nobr></td>
- <td><nobr><%kummgl2%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Akt.Eigenleistungen</nobr></td>
- <td><nobr><%jetzt3%></nobr></td>
- <td><nobr><%jetztgl3%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm3%></nobr></td>
- <td><nobr><%kummgl3%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Gesamtleistung</nobr></td>
- <td><nobr><%jetztgesamtleistung%></nobr></td>
- <td><nobr><%jetztglgesamtleistung%></nobr></td>
- <td><nobr><%jetztgkgesamtleistung%></nobr></td>
- <td><nobr><%jetztpkgesamtleistung%></nobr></td>
- <td></td>
- <td><nobr><%kummgesamtleistung%></nobr></td>
- <td><nobr><%kummglgesamtleistung%></nobr></td>
- <td><nobr><%kummgkgesamtleistung%></nobr></td>
- <td><nobr><%kummpkgesamtleistung%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Mat./Wareneinkauf</nobr></td>
- <td><nobr><%jetzt4%></nobr></td>
- <td><nobr><%jetztgl4%></nobr></td>
- <td><nobr><%jetztgk4%></nobr></td>
- <td><nobr><%jetztpk4%></nobr></td>
- <td><nobr><%jetztauf4%></nobr></td>
- <td><nobr><%kumm4%></nobr></td>
- <td><nobr><%kummgl4%></nobr></td>
- <td><nobr><%kummgk4%></nobr></td>
- <td><nobr><%kummpk4%></nobr></td>
- <td class="right"><nobr><%kummauf4%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Rohertrag</nobr></td>
- <td><nobr><%jetztrohertrag%></nobr></td>
- <td><nobr><%jetztglrohertrag%></nobr></td>
- <td><nobr><%jetztgkrohertrag%></nobr></td>
- <td><nobr><%jetztpkrohertrag%></nobr></td>
- <td><nobr><%jetztaufrohertrag%></nobr></td>
- <td><nobr><%kummrohertrag%></nobr></td>
- <td><nobr><%kummglrohertrag%></nobr></td>
- <td><nobr><%kummgkrohertrag%></nobr></td>
- <td><nobr><%kummpkrohertrag%></nobr></td>
- <td class="right"><nobr><%kummaufrohertrag%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>So.betr.Erlöse</nobr></td>
- <td><nobr><%jetzt5%></nobr></td>
- <td><nobr><%jetztgl5%></nobr></td>
- <td><nobr><%jetztgk5%></nobr></td>
- <td><nobr><%jetztpk5%></nobr></td>
- <td></td>
- <td><nobr><%kumm5%></nobr></td>
- <td><nobr><%kummgl5%></nobr></td>
- <td><nobr><%kummgk5%></nobr></td>
- <td><nobr><%kummpk5%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Betriebl. Rohertrag</nobr></td>
- <td><nobr><%jetztbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztglbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztgkbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztpkbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztaufbetriebrohertrag%></nobr></td>
- <td><nobr><%kummbetriebrohertrag%></nobr></td>
- <td><nobr><%kummglbetriebrohertrag%></nobr></td>
- <td><nobr><%kummgkbetriebrohertrag%></nobr></td>
- <td><nobr><%kummpkbetriebrohertrag%></nobr></td>
- <td
-class="right"><nobr><%kummaufbetriebrohertrag%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left">Kostenarten:</td>
- <td class="right" colspan="10"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Personalkosten</nobr></td>
- <td><nobr><%jetzt10%></nobr></td>
- <td><nobr><%jetztgl10%></nobr></td>
- <td><nobr><%jetztgk10%></nobr></td>
- <td><nobr><%jetztpk10%></nobr></td>
- <td></td>
- <td><nobr><%kumm10%></nobr></td>
- <td><nobr><%kummgl10%></nobr></td>
- <td><nobr><%kummgk10%></nobr></td>
- <td><nobr><%kummpk10%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Raumkosten</nobr></td>
- <td><nobr><%jetzt11%></nobr></td>
- <td><nobr><%jetztgl11%></nobr></td>
- <td><nobr><%jetztgk11%></nobr></td>
- <td><nobr><%jetztpk11%></nobr></td>
- <td></td>
- <td><nobr><%kumm11%></nobr></td>
- <td><nobr><%kummgl11%></nobr></td>
- <td><nobr><%kummgk11%></nobr></td>
- <td><nobr><%kummpk11%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Betriebl.Steuern</nobr></td>
- <td><nobr><%jetzt12%></nobr></td>
- <td><nobr><%jetztgl12%></nobr></td>
- <td><nobr><%jetztgk12%></nobr></td>
- <td><nobr><%jetztpk12%></nobr></td>
- <td></td>
- <td><nobr><%kumm12%></nobr></td>
- <td><nobr><%kummgl12%></nobr></td>
- <td><nobr><%kummgk12%></nobr></td>
- <td><nobr><%kummpk12%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Versich./Beiträge</nobr></td>
- <td><nobr><%jetzt13%></nobr></td>
- <td><nobr><%jetztgl13%></nobr></td>
- <td><nobr><%jetztgk13%></nobr></td>
- <td><nobr><%jetztpk13%></nobr></td>
- <td></td>
- <td><nobr><%kumm13%></nobr></td>
- <td><nobr><%kummgl13%></nobr></td>
- <td><nobr><%kummgk13%></nobr></td>
- <td><nobr><%kummpk13%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Kfz-Kosten (o.St.)</nobr></td>
- <td><nobr><%jetzt14%></nobr></td>
- <td><nobr><%jetztgl14%></nobr></td>
- <td><nobr><%jetztgk14%></nobr></td>
- <td><nobr><%jetztpk14%></nobr></td>
- <td></td>
- <td><nobr><%kumm14%></nobr></td>
- <td><nobr><%kummgl14%></nobr></td>
- <td><nobr><%kummgk14%></nobr></td>
- <td><nobr><%kummpk14%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Werbe-/Reisekosten</nobr></td>
- <td><nobr><%jetzt15%></nobr></td>
- <td><nobr><%jetztgl15%></nobr></td>
- <td><nobr><%jetztgk15%></nobr></td>
- <td><nobr><%jetztpk15%></nobr></td>
- <td></td>
- <td><nobr><%kumm15%></nobr></td>
- <td><nobr><%kummgl15%></nobr></td>
- <td><nobr><%kummgk15%></nobr></td>
- <td><nobr><%kummpk15%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Kosten Warenabgabe</nobr></td>
- <td><nobr><%jetzt16%></nobr></td>
- <td><nobr><%jetztgl16%></nobr></td>
- <td><nobr><%jetztgk16%></nobr></td>
- <td><nobr><%jetztpk16%></nobr></td>
- <td></td>
- <td><nobr><%kumm16%></nobr></td>
- <td><nobr><%kummgl16%></nobr>
-</td>
- <td><nobr><%kummgk16%></nobr></td>
- <td><nobr><%kummpk16%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Abschreibungen</nobr></td>
- <td><nobr><%jetzt17%></nobr></td>
- <td><nobr><%jetztgl17%></nobr></td>
- <td><nobr><%jetztgk17%></nobr></td>
- <td><nobr><%jetztpk17%></nobr></td>
- <td></td>
- <td><nobr><%kumm17%></nobr></td>
- <td><nobr><%kummgl17%></nobr></td>
- <td><nobr><%kummgk17%></nobr></td>
- <td><nobr><%kummpk17%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Reparatur/Instandh.</nobr></td>
- <td><nobr><%jetzt18%></nobr></td>
- <td><nobr><%jetztgl18%></nobr></td>
- <td><nobr><%jetztgk18%></nobr></td>
- <td><nobr><%jetztpk18%></nobr></td>
- <td></td>
- <td><nobr><%kumm18%></nobr></td>
- <td><nobr><%kummgl18%></nobr></td>
- <td><nobr><%kummgk18%></nobr></td>
- <td><nobr><%kummpk18%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Sonstige Kosten</nobr></td>
- <td><nobr><%jetzt20%></nobr></td>
- <td><nobr><%jetztgl20%></nobr></td>
- <td><nobr><%jetztgk20%></nobr></td>
- <td><nobr><%jetztpk20%></nobr></td>
- <td></td>
- <td><nobr><%kumm20%></nobr></td>
- <td><nobr><%kummgl20%></nobr></td>
- <td><nobr><%kummgk20%></nobr></td>
- <td><nobr><%kummpk20%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Gesamtkosten</nobr></td>
- <td><nobr><%jetztgesamtkosten%></nobr></td>
- <td><nobr><%jetztglgesamtkosten%></nobr></td>
- <td><nobr><%jetztgkgesamtkosten%></nobr></td>
- <td><nobr><%jetztpkgesamtkosten%></nobr></td>
- <td></td>
- <td><nobr><%kummgesamtkosten%></nobr></td>
- <td><nobr><%kummglgesamtkosten%></nobr></td>
- <td><nobr><%kummgkgesamtkosten%></nobr></td>
- <td><nobr><%kummpkgesamtkosten%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-
-<tr class="grey subtotal">
-<td class="left"><nobr>Betriebsergebnis</nobr></td>
- <td><nobr><%jetztbetriebsergebnis%></nobr></td>
- <td><nobr><%jetztglbetriebsergebnis%></nobr>
-</td>
- <td><nobr><%jetztgkbetriebsergebnis%></nobr></td>
- <td><nobr><%jetztpkbetriebsergebnis%></nobr></td>
- <td></td>
- <td><nobr><%kummbetriebsergebnis%></nobr></td>
- <td><nobr><%kummglbetriebsergebnis%></nobr>
-</td>
- <td><nobr><%kummgkbetriebsergebnis%></nobr></td>
- <td><nobr><%kummpkbetriebsergebnis%></nobr></td>
- <td class="right"> </td>
- </tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Zinsaufwand</nobr></td>
- <td><nobr><%jetzt30%></nobr></td>
- <td><nobr><%jetztgl30%></nobr></td>
- <td><nobr><%jetztgk30%></nobr></td>
- <td><nobr><%jetztpk30%></nobr></td>
- <td></td>
- <td><nobr><%kumm30%></nobr></td>
- <td><nobr><%kummgl30%></nobr></td>
- <td><nobr><%kummgk30%></nobr></td>
- <td><nobr><%kummpk30%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Übrige Steuern</nobr></td>
- <td><nobr><%jetzt19%></nobr></td>
- <td><nobr><%jetztgl19%></nobr></td>
- <td><nobr><%jetztgk19%></nobr></td>
- <td><nobr><%jetztpk19%></nobr></td>
- <td></td>
- <td><nobr><%kumm19%></nobr></td>
- <td><nobr><%kummg191%></nobr></td>
- <td><nobr><%kummgk19%></nobr></td>
- <td><nobr><%kummpk19%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Sonst. neutr. Aufwand</nobr></td>
- <td><nobr><%jetzt31%></nobr></td>
- <td><nobr><%jetztgl31%></nobr></td>
- <td><nobr><%jetztgk31%></nobr></td>
- <td><nobr><%jetztpk31%></nobr></td>
- <td></td>
- <td><nobr><%kumm31%></nobr></td>
- <td><nobr><%kummgl31%></nobr></td>
- <td><nobr><%kummgk31%></nobr></td>
- <td><nobr><%kummpk31%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white subtotal">
-<td class="left"><nobr>Neutraler Aufwand</nobr></td>
- <td><nobr><%jetztneutraleraufwand%></nobr></td>
- <td><nobr><%jetztglneutraleraufwand%></nobr></td>
- <td><nobr><%jetztgkneutraleraufwand%></nobr></td>
- <td><nobr><%jetztpkneutraleraufwand%></nobr></td>
- <td></td>
- <td><nobr><%kummneutraleraufwand%></nobr></td>
- <td><nobr><%kummglneutraleraufwand%></nobr></td>
- <td><nobr><%kummgkneutraleraufwand%></nobr></td>
- <td><nobr><%kummpkneutraleraufwand%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="white">
- <td class="left"><nobr>Zinserträge</nobr></td>
- <td><nobr><%jetzt32%></nobr></td>
- <td><nobr><%jetztgl32%></nobr></td>
- <td><nobr><%jetztgk32%></nobr></td>
- <td><nobr><%jetztpk32%></nobr></td>
- <td></td>
- <td><nobr><%kumm32%></nobr></td>
- <td><nobr><%kummgl32%></nobr></td>
- <td><nobr><%kummgk32%></nobr></td>
- <td><nobr><%kummpk32%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Sonst. neutr. Ertr.</nobr></td>
- <td><nobr><%jetzt33%></nobr></td>
- <td><nobr><%jetztgl33%></nobr></td>
- <td><nobr><%jetztgk33%></nobr></td>
- <td><nobr><%jetztpk33%></nobr></td>
- <td></td>
- <td><nobr><%kumm33%></nobr></td>
- <td><nobr><%kummgl33%></nobr></td>
- <td><nobr><%kummgk33%></nobr></td>
- <td><nobr><%kummpk33%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Verr.kalk.Kosten</nobr></td>
- <td><nobr><%jetzt34%></nobr></td>
- <td><nobr><%jetztgl34%></nobr>
- <td><nobr><%jetztgk34%></nobr></td>
- <td><nobr><%jetztpk34%></nobr></td>
- <td></td>
- <td><nobr><%kumm34%></nobr></td>
- <td><nobr><%kummgl34%></nobr></td>
- <td><nobr><%kummgk34%></nobr></td>
- <td><nobr><%kummpk34%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Neutraler Ertrag</nobr></td>
- <td><nobr><%jetztneutralerertrag%></nobr></td>
- <td><nobr><%jetztglneutralerertrag%></nobr></td>
- <td><nobr><%jetztgkneutralerertrag%></nobr></td>
- <td><nobr><%jetztpkneutralerertrag%></nobr></td>
- <td></td>
- <td><nobr><%kummneutralerertrag%></nobr></td>
- <td><nobr><%kummglneutralerertrag%></nobr></td>
- <td><nobr><%kummgkneutralerertrag%></nobr></td>
- <td><nobr><%kummpkneutralerertrag%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Ergebnis vor Steuern</nobr></td>
- <td><nobr><%jetztergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztglergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztgkergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztpkergebnisvorsteuern%></nobr></td>
- <td></td>
- <td><nobr><%kummergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummglergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummgkergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummpkergebnisvorsteuern%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Steuern Eink.u.Ertr.</nobr></td>
- <td><nobr><%jetzt35%></nobr></td>
- <td><nobr><%jetztgl35%></nobr></td>
- <td><nobr><%jetztgk35%></nobr></td>
- <td><nobr><%jetztpk35%></nobr></td>
- <td></td>
- <td><nobr><%kumm35%></nobr></td>
- <td><nobr><%kummgl35%></nobr></td>
- <td><nobr><%kummgk35%></nobr></td>
- <td><nobr><%kummpk35%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Vorläufiges Ergebnis</nobr></td>
- <td><nobr><%jetztergebnis%></nobr></td>
- <td><nobr><%jetztglergebnis%></nobr></td>
- <td><nobr><%jetztgkergebnis%></nobr></td>
- <td><nobr><%jetztpkergebnis%></nobr></td>
- <td></td>
- <td><nobr><%kummergebnis%></nobr></td>
- <td><nobr><%kummglergebnis%></nobr></td>
- <td><nobr><%kummgkergebnis%></nobr></td>
- <td><nobr><%kummpkergebnis%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white" id=last><td class="left right"
-colspan="11"> </td></tr>
-
-<tr>
- <td colspan=11 class=footer>Währung: Euro - FiBu: LX Office ERP
-(Version <%version%>) - Formular: 11.01.2007</td>
-</tr>
-
-</table>
-</body>
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.4cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.0cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-
-\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
-
-\parbox[t]{12cm}{
- <%company%>
-
- <%address%>}
-\hfill
-\parbox[t]{6cm}{\hfill <%source%>}
-
-\vspace*{0.6cm}
-
-<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
-
-\vspace{0.5cm}
-
-\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
-
-\vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{2.8cm}
-
-<%company%>
-
-\vspace{0.5cm}
-
-<%name%> \hfill <%datepaid%> \hfill <%source%>
-
-\vspace{0.5cm}
-\begin{tabularx}{\textwidth}{lXrr@{}}
-\textbf{Invoice No.} & \textbf{Invoice Date}
- & \textbf{Due} & \textbf{Applied} \\
-<%foreach invnumber%>
-<%invnumber%> & <%invdate%> \dotfill
- & <%due%> & <%paid%> \\
-<%end invnumber%>
-\end{tabularx}
-
-\vfill
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<h2 align=center>
-<%company%>
-<br><%address%>
-
-<p>INCOME STATEMENT
-<br><%period%>
-</h2>
-
-
-<table width=100% border=0>
-<tr>
- <th width=400 align=left colspan=2>INCOME<br><hr width=300 size=5 align=left noshade></th>
- <th><%this_period%></th>
- <th><%last_period%></th>
-</tr>
-
-<%foreach income_account%>
-<tr>
- <td width=4> </td>
- <td><%income_account%></td>
- <td align=right><%income_this_period%></td>
- <td align=right><%income_last_period%></td>
-</tr>
-<%end income_account%>
-
-<tr>
- <td colspan=2> </td>
- <td><hr noshade size=1></td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <td> </td>
- <th align=left>Total Income</th>
- <td align=right><%total_income_this_period%><hr noshade size=2></td>
- <td align=right><%total_income_last_period%><hr noshade size=2></td>
-</tr>
-
-<tr>
- <th align=left colspan=2>EXPENSES<br><hr width=300 size=5 align=left noshade></th>
-</tr>
-
-<%foreach expense_account%>
-<tr>
- <td> </td>
- <td><%expense_account%></td>
- <td align=right><%expenses_this_period%></td>
- <td align=right><%expenses_last_period%></td>
-</tr>
-<%end expense_account%>
-
-<tr>
- <td colspan=2> </td>
- <td><hr noshade size=1></td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <td> </td>
- <th align=left>Total Expenses</th>
- <td align=right><%total_expenses_this_period%><br><hr noshade size=2</td>
- <td align=right><%total_expenses_last_period%><br><hr noshade size=2</td>
-</tr>
-
-<tr valign=top>
- <th align=left colspan=2>INCOME / (LOSS)</th>
- <td align=right><%total_this_period%><br><hr noshade size=2></td>
- <td align=right><%total_last_period%><br><hr noshade size=2></td>
-</tr>
-
-</table>
-
-
-
-
-
-
-
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telephone: <%tel%>
- <br>Facsimile: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>I N V O I C E</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Invoice Date</th><td width=10> </td><td><%invdate%></td>
- </tr>
-
- <tr>
- <th align=right>Due Date</th><td width=10> </td><td><%duedate%></td>
- </tr>
-
- <tr>
- <th align=right>Number</th><td> </td><td><%invnumber%></td></tr>
- </tr>
-
-<!--
- <tr>
- <th align=right>Clerk:</th><td> </td><td><%employee%></td>
- </tr>
--->
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>To:</th>
- <th align=left><font color=ffffff>Ship To:</th>
- </tr>
-
-<!--
- other variables which can be use:
- contact, shiptocontact, shiptophone, shiptofax
--->
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qt'y</th>
- <th> </th>
- <th><font color=ffffff>Price</th>
- <th><font color=ffffff>Disc</th>
- <th><font color=ffffff>Amount</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
-<!--
-you can also use netprice instead of sellprice if you
-don't want to show the discount
-netprice = sellprice - discount
--->
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
- <tr>
-<%if taxincluded%>
- <th colspan=5 align=right>Total</th>
- <td colspan=2 align=right><%invtotal%></td>
-<%end taxincluded%>
-<%if not taxincluded%>
- <th colspan=5 align=right>Subtotal</th>
- <td colspan=2 align=right><%subtotal%></td>
-<%end taxincluded%>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=5 align=right><%taxdescription%> on <%taxbase%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
-<%if paid%>
- <tr>
- <th colspan=5 align=right>Paid</th>
- <td colspan=2 align=right>- <%paid%></td>
- </tr>
-<%end paid%>
-
- <tr>
- <td colspan=3> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=3>Terms Net <b><%terms%></b> days</td>
- <th colspan=2 align=right>Outstanding</th>
- <th colspan=2 align=right><%total%></th>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Notes</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- All prices in <b><%currency%></b> Funds
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<%if paid%>
-<tr>
- <td colspan=7>
- <table width=60%>
- <tr>
- <th align=left>Payments</th>
- </tr>
- <tr>
- <td colspan=4>
- <hr noshade>
- </td>
- </tr>
- <tr>
- <th align=left>Date</th>
- <th align=left>Account</th>
- <th align=left>Source</th>
- <th align=left>Amount</th>
- </tr>
-<%end paid%>
-
-<%foreach payment%>
- <tr>
- <td><%paymentdate%></td>
- <td><%paymentaccount%></td>
- <td><%paymentsource%></td>
- <td><%payment%></td>
- </tr>
-<%end payment%>
-
-<%if paid%>
- </table>
- </td>
-</tr>
-
-<tr>
- <td> </td>
-</tr>
-<%end paid%>
-
-<tr>
- <th colspan=7>
- <br>Thank you for your valued business!
- </th>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
- Payment due NET <%terms%> Days from date of Invoice.
- Interest on overdue amounts will acrue at the rate of 1.5% per month
- from due date until paid in full. Items returned are subject to
- a 10% restocking charge. A return authorization must be obtained
- from <%company%> before goods are returned. Returns must be shipped
- prepaid and properly insured. <%company%> will not be responsible
- for damages during transit.
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=7 align=left><font size=-2><%taxdescription%> Registration <%taxnumber%></th>
- </tr>
-<%end tax%>
-
-<%if taxincluded%>
- <tr>
- <th colspan=7 align=left><font size=-2>Taxes shown are included in price.</th>
- </tr>
-<%end taxincluded%>
-
-<!-- business number
- <tr>
- <th colspan=7 align=left><font size=-2>Business Number: <%businessnumber%></font></th>
- </tr>
--->
-
-<!-- banking information
- <tr>
- <th colspan=7 align=left>Banking Information:
- <br>Bank
- <br>Transit No.
- <br>Account No.
- </td>
- </tr>
--->
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\newsavebox{\hdr}
-\sbox{\hdr}{
- \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
- \parbox{\textwidth}{
- \parbox[b]{12cm}{
- <%company%>
-
- <%address%>}\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
- }
-}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\markboth{<%company%>\hfill <%invnumber%>}{\usebox{\hdr}}
-
-\pagestyle{myheadings}
-%\thispagestyle{empty} use this with letterhead paper
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
- \parbox[t]{10.5cm}{
- \textbf{To}
- \vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{0.3cm}
-
-%<%if contact%>
-%Attn: <%contact%>
-%\vspace{0.3cm}
-%<%end contact%>
-\vspace{0.5cm}
-
-<%if customerphone%>
-Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-Fax: <%customerfax%>
-<%end customerfax%>
-
-<%email%>
-}
-\parbox[t]{7.5cm}{
-\textbf{Ship To}
-\vspace{0.5cm}
-
-<%shiptoname%>
-
-<%shiptostreet%>
-
-<%shiptozipcode%>
-
-<%shiptocity%>
-
-<%shiptocountry%>
-
-\vspace{0.3cm}
-
-\vspace{0.3cm}
-
-<%if shiptocontact%>
-Attn: <%shiptocontact%>
-\vspace{0.3cm}
-<%end shiptocontact%>
-
-<%if shiptophone%>
-Tel: <%shiptophone%>
-<%end shiptophone%>
-
-<%if shiptofax%>
-Fax: <%shiptofax%>
-<%end shiptofax%>
-
-<%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{I N V O I C E}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabular}[t]{l@{\hspace{0.3cm}}l}
- \textbf{Date} & <%invdate%> \\
- \textbf{Number} & <%invnumber%> \\
- \textbf{Order} & <%ordnumber%> \\
- \textbf{Clerk} & <%employee%>
-\end{tabular}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Number} & \textbf{Description} & \textbf{Qt'y} &
- \textbf{Unit} & \textbf{Price} & \textbf{Disc} & \textbf{Amount} \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> &
- <%unit%> & <%sellprice%> & <%discount%> & <%linetotal%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\vspace{0.2cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- \textbf{Subtotal} & \textbf{<%subtotal%>} \\
-<%foreach tax%>
- <%taxdescription%> on <%taxbase%> & <%tax%> \\
-<%end tax%>
-<%if paid%>
- \textbf{Paid} & - <%paid%> \\
-<%end paid%>
- \hline
- \textbf{Balance Owing} & \textbf{<%total%>} \\
-\end{tabularx}
-
-\vspace{0.3cm}
-
-\hfill
- All prices in \textbf{<%currency%>} funds.
-
-\vspace{12pt}
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-\vfill
-
-<%if paid%>
-\begin{tabularx}{10cm}{@{}lXlr@{}}
- \textbf{Payments} & & & \\
- \hline
- \textbf{Date} & \textbf{Account} & \textbf{Source} & \textbf{Amount} \\
-<%end paid%>
-<%foreach payment%>
- <%paymentdate%> & <%paymentaccount%> & <%paymentsource%> & <%payment%> \\
-<%end payment%>
-<%if paid%>
-\end{tabularx}
-<%end paid%>
-
-\vspace{1cm}
-
-\centerline{\textbf{Thank You for your valued business!}}
-
-\renewcommand{\thefootnote}{\fnsymbol{footnote}}
-
-\footnotetext[1]{\tiny
-Payment due NET <%terms%> Days from date of Invoice. Interest on overdue
-amounts will acrue at the rate of 1.5\% per month starting <%duedate%>
-until paid in full. Items returned are subject to a 10\% restocking charge.
-A return authorization must be obtained from <%company%> before goods are
-returned. Returns must be shipped prepaid and properly insured.
-<%company%> will not be responsible for damages during transit.}
-
-\end{document}
-
-
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
-
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>P I C K L I S T</h4>
- </th>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% callspacing=0 cellpadding=0>
- <tr bgcolor=000000>
- <th width=50% align=left><font color=ffffff>Ship To:</th>
- <th width=50%> </th>
- </tr>
-
- <tr valign=top>
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
-
- <td>
- <%if shiptocontact%>
- <br>Attn: <%shiptocontact%>
- <%end shiptocontact%>
-
- <%if shiptophone%>
- <br>Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- <br>Fax: <%shiptofax%>
- <%end shiptofax%>
-
- <%shiptoemail%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height=5></tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left>Order #</th>
- <th width=17% align=left>Date</th>
- <th width=17% align=left nowrap>Contact</th>
- <%if warehouse%>
- <th width=17% align=left>Warehouse</th>
- <%end warehouse%>
- <th width=17% align=left>Shipping Point</th>
- <th width=15% align=left>Ship via</th>
- </tr>
-
- <tr>
- <td><%ordnumber%> </td>
-
- <%if shippingdate%>
- <td><%shippingdate%></td>
- <%end shippingdate%>
-
- <%if not shippingdate%>
- <td><%orddate%></td>
- <%end shippingdate%>
-
- <td><%employee%> </td>
-
- <%if warehouse%>
- <td><%warehouse%> </td>
- <%end warehouse%>
-
- <td><%shippingpoint%> </td>
- <td><%shipvia%> </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>Pos</th>
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qty</th>
- <th><font color=ffffff>Ship</th>
- <th> </th>
- <th><font color=ffffff>Bin</th>
- </tr>
-
- <%foreach number%>
- <tr valign=top>
- <td><%runningnumber%>
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td align=right>[ ]</td>
- <td><%unit%></td>
- <td align=right><%bin%></td>
- </tr>
- <%end number%>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td><hr noshade></td>
- </tr>
-
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{
- <%company%>
-
- <%address%>
- }
- \parbox[b]{.2\textwidth}{
- \includegraphics[scale=0.3]{sql-ledger}
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
- \textbf{Ship To}
-} \hfill
-
-\vspace{0.7cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
-
-<%shiptoname%> \\
-<%shiptostreet%> \\
-<%shiptozipcode%> \\
-<%shiptocity%> \\
-<%shiptocountry%>
-}
-\parbox[t]{.4\textwidth}{
- <%shiptocontact%>
-
- <%if shiptophone%>
- Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- Fax: <%shiptofax%>
- <%end shiptofax%>
-
- <%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{P I C K} \parbox{0.3cm}{\hfill} \textbf{L I S T}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{Order \#} & \textbf{Date} & \textbf{Contact}
- <%if warehouse%>
- & \textbf{Warehouse}
- <%end warehouse%>
- & \textbf{Shipping Point} & \textbf{Ship via} \\ [0.5em]
- \hline
- <%ordnumber%>
- <%if shippingdate%>
- & <%shippingdate%>
- <%end shippingdate%>
- <%if not shippingdate%>
- & <%orddate%>
- <%end shippingdate%>
- & <%employee%>
- <%if warehouse%>
- & <%warehouse%>
- <%end warehouse%>
- & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}rlp{\descrwidth}@{\extracolsep\fill}rcll@{}}
- \textbf{Pos} & \textbf{Number} & \textbf{Description} &
- \textbf{Qty} & \textbf{Ship} & & \textbf{Bin} \\
-<%foreach number%>
- <%runningnumber%> & <%number%> & <%description%> &
- <%qty%> & [\hspace{1cm}] & <%unit%> & <%bin%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-}
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telephone: <%tel%>
- <br>Facsimile: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>P U R C H A S E O R D E R</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Order Date</th><td width=10> </td><td><%orddate%></td>
- </tr>
-
- <tr>
- <th align=right>Required by</th><td width=10> </td><td><%reqdate%></td>
- </tr>
-
- <tr>
- <th align=right>Number</th><td> </td><td><%ordnumber%></td></tr>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left width=50%><font color=ffffff>To:</th>
- <th align=left width=50%><font color=ffffff>Ship To:</th>
- </tr>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
-
-<br>
-<%if contact%>
-<br>Attn: <%contact%>
-<%end contact%>
-<%if vendorphone%>
-<br>Tel: <%vendorphone%>
-<%end vendorphone%>
-<%if vendorfax%>
-<br>Fax: <%vendorfax%>
-<%end vendorfax%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
-
-<br>
-<%if shiptocontact%>
-<br>Attn: <%shiptocontact%>
-<%end shiptocontact%>
-<%if shiptophone%>
-<br>Tel: <%shiptophone%>
-<%end shiptophone%>
-<%if shiptofax%>
-<br>Fax: <%shiptofax%>
-<%end shiptofax%>
-
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qt'y</th>
- <th> </th>
- <th><font color=ffffff>Price</th>
- <th><font color=ffffff>Amount</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=6><hr noshade></td>
- </tr>
-
- <tr>
- <th colspan=4 align=right>Subtotal</th>
- <td colspan=2 align=right><%subtotal%></td>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=4 align=right><%taxdescription%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=2> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=2>Terms Net <b><%terms%></b> days</td>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%ordtotal%></th>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Notes</td>
- <td><pre><%notes%></pre></td>
-<%end notes%>
- <td align=right>
- All prices in <b><%currency%></b> Funds
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
- Payment due NET <%terms%> Days from date of Invoice.
- Interest on overdue amounts will acrue at the rate of 1.5% per month
- from due date until paid in full. Items returned are subject to
- a 10% restocking charge. A return authorization must be obtained
- from <%company%> before goods are returned. Returns must be shipped
- prepaid and properly insured. <%company%> will not be responsible
- for damages during transit.
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\newsavebox{\hdr}
-\sbox{\hdr}{
- \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
- \parbox{\textwidth}{
- \parbox[b]{12cm}{
- <%company%>
-
- <%address%>}\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
- }
-}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\markboth{<%company%>\hfill <%ordnumber%>}{\usebox{\hdr}}
-
-\pagestyle{myheadings}
-%\thispagestyle{empty} use this with letterhead paper
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{10.5cm}{
-\textbf{To}
-\vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{0.3cm}
-
-<%if contact%>
-Attn: <%contact%>
-\vspace{0.3cm}
-<%end contact%>
-
-<%if vendorphone%>
-Tel: <%vendorphone%>
-<%end vendorphone%>
-
-<%if vendorfax%>
-Fax: <%vendorfax%>
-<%end vendorfax%>
-
-<%email%>
-}
-\parbox[t]{7.5cm}{
-\textbf{Ship To}
-\vspace{0.5cm}
-
-<%shiptoname%>
-
-<%shiptostreet%>
-
-<%shiptozipcode%>
-
-<%shiptocity%>
-
-<%shiptocountry%>
-
-\vspace{0.3cm}
-
-<%if shiptocontact%>
-Attn: <%shiptocontact%>
-\vspace{0.3cm}
-<%end shiptocontact%>
-
-<%if shiptophone%>
-Tel: <%shiptophone%>
-<%end shiptophone%>
-
-<%if shiptofax%>
-Fax: <%shiptofax%>
-<%end shiptofax%>
-
-<%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{P U R C H A S E} \parbox{0.3cm}{\hfill} \textbf{O R D E R}
-\hfill
-\begin{tabular}[t]{l@{\hspace{0.3cm}}l}
- \textbf{Date} & <%orddate%> \\
-<%if reqdate%>
- \textbf{Required by} & <%reqdate%> \\
-<%end reqdate%>
- \textbf{Number} & <%ordnumber%>
-\end{tabular}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrr@{}}
- \textbf{Number} & \textbf{Description} & \textbf{Qt'y} &
- \textbf{Unit} & \textbf{Price} & \textbf{Amount} \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> &
- <%unit%> & <%sellprice%> & <%linetotal%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\vspace{0.2cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- \textbf{Subtotal} & \textbf{<%subtotal%>} \\
-<%foreach tax%>
- <%taxdescription%> on <%taxbase%> & <%tax%>\\
-<%end tax%>
- \hline
- \textbf{Total} & \textbf{<%ordtotal%>}\\
-\end{tabularx}
-
-\vspace{0.3cm}
-
-\hfill
- All prices in \textbf{<%currency%>} funds.
-
-\vspace{12pt}
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-
-%\renewcommand{\thefootnote}{\fnsymbol{footnote}}
-
-%\footnotetext[1]{\tiny }
-
-\end{document}
-
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.4cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.0cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-
-\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
-
-\parbox[t]{12cm}{
- <%company%>
-
- <%address%>}
-\hfill
-\parbox[t]{6cm}{\hfill <%source%>}
-
-\vspace*{0.6cm}
-
-<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
-
-\vspace{0.5cm}
-
-\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
-
-\vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{2.8cm}
-
-<%company%>
-
-\vspace{0.5cm}
-
-<%name%> \hfill <%datepaid%> \hfill <%source%>
-
-\vspace{0.5cm}
-\begin{tabularx}{\textwidth}{lXrr@{}}
-\textbf{Invoice No.} & \textbf{Invoice Date}
- & \textbf{Due} & \textbf{Applied} \\
-<%foreach invnumber%>
-<%invnumber%> & <%invdate%> \dotfill
- & <%due%> & <%paid%> \\
-<%end invnumber%>
-\end{tabularx}
-
-\vfill
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58>
- </td>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>R E Q U E S T F O R Q U O T A T I O N</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left width=50%><font color=ffffff>To:</th>
- <th align=left width=50%><font color=ffffff>Ship To:</th>
- </tr>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
-<br>
-<%if contact%>
-<br>Attn: <%contact%>
-<%end contact%>
-<%if vendorphone%>
-<br>Tel: <%vendorphone%>
-<%end vendorphone%>
-<%if vendorfax%>
-<br>Fax: <%vendorfax%>
-<%end vendorfax%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
-<br>
-<%if shiptocontact%>
-<br>Attn: <%shiptocontact%>
-<%end shiptocontact%>
-<%if shiptophone%>
-<br>Tel: <%shiptophone%>
-<%end shiptophone%>
-<%if shiptofax%>
-<br>Fax: <%shiptofax%>
-<%end shiptofax%>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr><td> </td></tr>
-
- <tr>
- <td colspan=2>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left>RFQ #</th>
- <th width=17% align=left>Date</th>
- <th width=17% align=left>Required by</th>
- <th width=17% align=left>Contact</th>
- <th width=17% align=left>Shipping Point</th>
- <th width=15% align=left>Ship via</th>
- </tr>
-
- <tr>
- <td><%quonumber%></td>
- <td><%quodate%></td>
- <td><%reqdate%></td>
- <td><%employee%></td>
- <td><%shippingpoint%></td>
- <td><%shipvia%></td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height="10"></tr>
-
- <tr>
- <td>Please provide price and delivery time for the following items:</td>
- </tr>
-
- <tr height="10"></tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr>
-<!-- <th align=right>No.</th> -->
- <th align=left>Number</th>
- <th align=left>Description</th>
- <th>Qt'y</th>
- <th> </th>
- <th>Delivery</th>
- <th>Unit Price</th>
- <th>Extended</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-other per line item variables available <%reqdate%>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
-
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
-<%if notes%>
- <tr valign=top>
- <td>Notes</td>
- <td><%notes%></td>
- </tr>
-<%end notes%>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td width=70%> </td>
-
- <td width=30%>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{
- <%company%>
-
- <%address%>
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.45\textwidth}{
-\textbf{To}
-\vspace{0.7cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{0.3cm}
-
-<%if contact%>
-<%contact%>
-<%end contact%>
-
-\vspace{0.2cm}
-
-<%if vendorphone%>
-Tel: <%vendorphone%>
-<%end vendorphone%>
-
-<%if vendorfax%>
-Fax: <%vendorfax%>
-<%end vendorfax%>
-
-<%email%>
-}
-\parbox[t]{.45\textwidth}{
-\textbf{Ship To}
-\vspace{0.7cm}
-
-<%shiptoname%>
-
-<%shiptostreet%>
-
-<%shiptozipcode%>
-
-<%shiptocity%>
-
-<%shiptocountry%>
-
-\vspace{0.3cm}
-
-<%if shiptocontact%>
-<%shiptocontact%>
-<%end shiptocontact%>
-
-<%if shiptophone%>
-Tel: <%shiptophone%>
-<%end shiptophone%>
-
-<%if shiptofax%>
-Fax: <%shiptofax%>
-<%end shiptofax%>
-
-<%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{R E Q U E S T for Q U O T A T I O N}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{RFQ \#} & \textbf{Date} & \textbf{Required by} & \textbf{Contact} & \textbf{Shipping Point} & \textbf{Ship via} \\ [0.5ex]
- \hline
- <%quonumber%> & <%quodate%> & <%reqdate%> & <%employee%> & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-Please provide price and delivery time for the following items:
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rllrr@{}}
- \textbf{Number} & \textbf{Description} & \textbf{Qt'y} & &
- \textbf{Delivery} & \textbf{Unit Price} & \textbf{Extended} \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> & <%unit%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\hfill
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telephone: <%tel%>
- <br>Facsimile: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>S A L E S O R D E R</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Order Date</th><td width=10> </td><td><%orddate%></td>
- </tr>
-
- <tr>
- <th align=right>Required by</th><td width=10> </td><td><%reqdate%></td>
- </tr>
-
- <tr>
- <th align=right>Number</th><td> </td><td><%ordnumber%></td></tr>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>To:</th>
- <th align=left><font color=ffffff>Ship To:</th>
- </tr>
-
- <tr>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qt'y</th>
- <th> </th>
- <th><font color=ffffff>Price</th>
- <th><font color=ffffff>Disc</th>
- <th><font color=ffffff>Amount</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
- <tr>
-<%if taxincluded%>
- <th colspan=5 align=right>Total</th>
- <td colspan=2 align=right><%ordtotal%></td>
-<%end taxincluded%>
-
-<%if not taxincluded%>
- <th colspan=5 align=right>Subtotal</th>
- <td colspan=2 align=right><%subtotal%></td>
-<%end taxincluded%>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=5 align=right><%taxdescription%> on <%taxbase%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=2> </td>
- <td colspan=5><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=3>Terms Net <b><%terms%></b> days</td>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%ordtotal%></th>
- </tr>
-<%if taxincluded%>
- <tr>
- <td colspan=3>Tax is included in Total</td>
- </tr>
-<%end taxincluded%>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Notes</td>
- <td><pre><%notes%></pre></td>
-<%end notes%>
- <td align=right>
- All prices in <b><%currency%></b> Funds
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
- A 10% order cancellation fee will be applied for any special order
- products or products that have been customized, enhanced or
- upgraded at customers request.
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\newsavebox{\hdr}
-\sbox{\hdr}{
- \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
- \parbox{\textwidth}{
- \parbox[b]{12cm}{
- <%company%>
-
- <%address%>}\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
- }
-}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\markboth{<%company%>\hfill <%ordnumber%>}{\usebox{\hdr}}
-
-\pagestyle{myheadings}
-%\thispagestyle{empty} use this with letterhead paper
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{2cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{3.5cm}
-
-\textbf{S A L E S} \parbox{0.3cm}{\hfill} \textbf{O R D E R}
-\hfill
-\begin{tabular}[t]{l@{\hspace{0.3cm}}l}
- \textbf{Order Date} & <%orddate%> \\
-<%if reqdate%>
- \textbf{Required by} & <%reqdate%> \\
-<%end reqdate%>
- \textbf{Number} & <%ordnumber%>
-\end{tabular}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Number} & \textbf{Description} & \textbf{Qt'y} &
- \textbf{Unit} & \textbf{Price} & \textbf{Disc} & \textbf{Amount} \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> &
- <%unit%> & <%sellprice%> & <%discount%> & <%linetotal%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\vspace{0.2cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- \textbf{Subtotal} & \textbf{<%subtotal%>} \\
-<%foreach tax%>
- <%taxdescription%> on <%taxbase%> & <%tax%>\\
-<%end tax%>
- \hline
- \textbf{Total} & \textbf{<%ordtotal%>}\\
-\end{tabularx}
-
-\vspace{0.3cm}
-
-\hfill
- All prices in \textbf{<%currency%>} funds.
-
-\vspace{12pt}
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-
-\renewcommand{\thefootnote}{\fnsymbol{footnote}}
-
-\footnotetext[1]{\tiny
-A 10\% order cancellation fee will be applied for any special order products or
-products that have been customized, enhanced or upgraded at customers request.
-Items which are non-returnable are indicated above.
-}
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr valign=top>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
-<tr><td colspan=3> </td></tr>
-
- <tr>
- <th colspan=3>
- <h4>Q U O T A T I O N</h4>
- </th>
- </tr>
-
- </table>
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td>
- <table width=100%>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
-<br>
-<%if contact%>
-<br>Attn: <%contact%>
-<%end contact%>
-
-<%if customerphone%>
-<br>Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-<br>Fax: <%customerfax%>
-<%end customerfax%>
-
-<%if email%>
-<br><%email%>
-<%end email%>
- </td>
-
- </tr>
- </table>
- </td>
- </tr>
-
- <tr><td> </td></tr>
-
- <tr>
- <td colspan=2>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left nowrap>Number</th>
- <th width=17% align=left>Date</th>
- <th width=17% align=left>Valid until</th>
- <th width=17% align=left nowrap>Contact</th>
- <th width=17% align=left nowrap>Shipping Point</th>
- <th width=15% align=left nowrap>Ship via</th>
- </tr>
-
- <tr>
- <td><%quonumber%></td>
- <td><%quodate%></td>
- <td><%reqdate%></td>
- <td><%employee%></td>
- <td><%shippingpoint%></td>
- <td><%shipvia%></td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=right><font color=ffffff>No.</th>
- <th align=left><font color=ffffff>Number</th>
- <th align=left><font color=ffffff>Description</th>
- <th><font color=ffffff>Qt'y</th>
- <th> </th>
- <th><font color=ffffff>Price</th>
- <th><font color=ffffff>Disc</th>
- <th><font color=ffffff>Amount</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
- <td align=right><%runningnumber%></td>
-
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=8><hr noshade></td>
- </tr>
-
- <tr>
-<%if taxincluded%>
- <th colspan=6 align=right>Total</th>
- <td colspan=2 align=right><%invtotal%></td>
-<%end taxincluded%>
-
-<%if not taxincluded%>
- <th colspan=6 align=right>Subtotal</th>
- <td colspan=2 align=right><%subtotal%></td>
-<%end taxincluded%>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=6 align=right><%taxdescription%> on <%taxbase%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=4> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=4>
-<%if terms%>
- Terms Net <b><%terms%></b> days
-<%end terms%>
- </td>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%quototal%></th>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Notes</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- All prices in <b><%currency%></b> Funds
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td width=60%><font size=-3>
- Special order items are subject to a 10% cancellation fee.
- </font>
- </td>
- <td width=40%>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{
- <%company%>
-
- <%address%>
- }
- \parbox[b]{.2\textwidth}{
- \includegraphics[scale=0.3]{sql-ledger}
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Telephone & <%tel%>\\
- Facsimile & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.45\textwidth}{
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{0.3cm}
-
-<%if contact%>
-<%contact%>
-<%end contact%>
-
-\vspace{0.2cm}
-
-<%if customerphone%>
-Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-Fax: <%customerfax%>
-<%end customerfax%>
-
-<%email%>
-}
-
-\vspace{1cm}
-
-\textbf{Q U O T A T I O N}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{Quotation \#} & \textbf{Date} & \textbf{Valid until} & \textbf{Contact} & \textbf{Shipping Point} & \textbf{Ship via} \\ [0.5ex]
- \hline
- <%quonumber%> & <%quodate%> & <%reqdate%> & <%employee%> & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rlrrr@{}}
- \textbf{Number} & \textbf{Description} & \textbf{Qt'y} &
- \textbf{Unit} & \textbf{Price} & \textbf{Disc} & \textbf{Amount} \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> &
- <%unit%> & <%sellprice%> & <%discount%> & <%linetotal%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\vspace{0.2cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- Subtotal & <%subtotal%> \\
-<%foreach tax%>
- <%taxdescription%> on <%taxbase%> & <%tax%>\\
-<%end tax%>
- \hline
- Total & <%quototal%>\\
-\end{tabularx}
-
-\vspace{0.3cm}
-
-\hfill
- All prices in \textbf{<%currency%>}.
-
-\vspace{12pt}
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-\vfill
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
- <th><img src=http://www.sql-ledger.org/images/sql-ledger.png border=0 width=64 height=58></th>
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
- <tr>
- <th colspan=3><h4>S T A T E M E N T</h4></th>
- </tr>
- <tr>
- <td colspan=3 align=right><%statementdate%></td>
- </tr>
- </table>
- </td>
- </tr>
- <tr>
- <td> </td>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- <br>
-<%if customerphone%>
- <br>Tel: <%customerphone%>
-<%end customerphone%>
-<%if customerfax%>
- <br>Fax: <%customerfax%>
-<%end customerfax%>
-<%if email%>
- <br><%email%>
-<%end email%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
- <tr height=10></tr>
- <tr>
- <td> </td>
- <td>
- <table width=100%>
- <tr>
- <th align=left>Invoice #</th>
- <th width=15%>Date</th>
- <th width=15%>Due</th>
- <th width=10%>Current</th>
- <th width=10%>30</th>
- <th width=10%>60</th>
- <th width=10%>90+</th>
- </tr>
-<%foreach invnumber%>
- <tr>
- <td><%invnumber%></td>
- <td><%invdate%></td>
- <td><%duedate%></td>
- <td align=right><%c0%></td>
- <td align=right><%c30%></td>
- <td align=right><%c60%></td>
- <td align=right><%c90%></td>
- </tr>
-<%end invnumber%>
- <tr>
- <td colspan=7><hr size=1></td>
- </tr>
- <tr>
- <td> </td>
- <td> </td>
- <td> </td>
- <th align=right><%c0total%></td>
- <th align=right><%c30total%></td>
- <th align=right><%c60total%></td>
- <th align=right><%c90total%></td>
- </tr>
- </table>
- </td>
- </tr>
- <tr height=10></tr>
- <tr>
- <td> </td>
- <td align=right>
- <table width=50%>
- <tr>
- <th>Total Outstanding</th>
- <th align=right><%total%></th>
- </tr>
- </table>
- </td>
- </tr>
- <tr>
- <td> </td>
- <td><hr noshade></td>
- </tr>
- <tr>
- <td> </td>
- <td>Please make check payable to <b><%company%></b>.
- </td>
- </tr>
- <tr height=20></tr>
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{19.2cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\newsavebox{\hdr}
-\sbox{\hdr}{
- \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
- \parbox{\textwidth}{
- \parbox[b]{12cm}{
- <%company%>
-
- <%address%>}\hfill
- \begin{tabular}[b]{rrr@{}}
- Tel & <%tel%>\\
- Fax & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
- }
-}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\markboth{<%company%>\hfill <%statementdate%>}{\usebox{\hdr}}
-
-\pagestyle{myheadings}
-%\thispagestyle{empty} use this with letterhead paper
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{10.5cm}{
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-}
-\parbox[t]{7.5cm}{
-<%if customerphone%>
-Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-Fax: <%customerfax%>
-<%end customerfax%>
-
-<%email%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{S T A T E M E N T} \hfill \textbf{<%statementdate%>}
-
-\vspace{2cm}
-
-\begin{tabular*}{\textwidth}{@{}l@{\extracolsep\fill}ccrrrr@{}}
- \textbf{Invoice \#} & \textbf{Date} & \textbf{Due} &
- \textbf{Current} & \textbf{30} & \textbf{60} & \textbf{90+} \\
-<%foreach invnumber%>
- <%invnumber%> & <%invdate%> & <%duedate%> &
- <%c0%> & <%c30%> & <%c60%> & <%c90%> \\
-<%end invnumber%>
-\textbf{Subtotal} & & & <%c0total%> & <%c30total%> & <%c60total%> & <%c90total%>
-\end{tabular*}
-\rule{\textwidth}{1pt}
-
-\vspace{0.5cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- \textbf{Total outstanding} & <%total%>
-\end{tabularx}
-
-\vfill
-
-Please make check payable to <%company%>
-
-\end{document}
-
+++ /dev/null
-;; This file was produced by lx-office
-;; for using in taxbird.
-;; You probably don't want to touch this
-;; file. In case you do want it anyway,
-;; be warned: BE CAREFUL!!
-;;
-'("Umsatzsteuervoranmeldung <%year%>" (
-("vend-id" . "74931")
-("land-lieferant" . "<%elsterland%>")
-("name-lieferant" . "<%company%>")
-("berufsbez" . "")
-("strasse-lieferant" . "<%co_street%>")
-("plz-lieferant" . "<%co_zip%> ")
-("ort-lieferant" . "<%co_city%>")
-("vorwahl" . "<%co_phone_prefix%>")
-("anschluss" . "<%co_phone%>")
-("land" . "<%taxbird_land_nr%>")
-("zeitraum" . "<%taxbird_period%>")
-("stnr" . "<%taxbird_steuernummer%>")
-
-<%foreach id%>
-("<%id%>" . "<%amount%>")<%end%>
-))
\ No newline at end of file
+++ /dev/null
-% German USTVA template for taxreports
-% Contributed by Marcus Habermehl
-% Based on template by Jacky und Stefan Tenne (German-ustva-2008.tex)
-%
-%
-\documentclass[twoside]{scrartcl}
-\usepackage{a4,german}
-\usepackage[frame]{xy}
-\usepackage[utf8]{inputenc}
-\usepackage[german]{babel}
-\usepackage{graphicx}
-\usepackage{tabularx}
-\usepackage{times, german}
-\usepackage{german}
-\setlength{\voffset}{-0.7cm} %hier wird die Höhenverschiebung
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0cm}
-\setlength{\headsep}{0cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{0cm}
-\setlength{\evensidemargin}{0cm}
-\setlength{\textwidth}{20.9cm}
-\setlength{\textheight}{29.6cm}
-\setlength{\footskip}{-0cm}
-\setlength{\parindent}{1mm}
-
-\begin{document}
-
-\fontfamily{cmss}\fontshape{n}\large\selectfont
-\pagestyle{myheadings}
-\markboth{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 54 783 700 790,page=2]{ustva-2012.pdf}}}%Seite 2
-{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 70 700 700 790,page=1]{ustva-2012.pdf}}}%Seite 1
-\hspace{1mm}
-\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{7mm}p{28mm}p{3mm}}
-\multicolumn{7}{c}{}\\[-2mm]
- & \multicolumn{6}{l}{<%steuernummer%>}\\
-\multicolumn{7}{c}{}\\[15mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
-\multicolumn{2}{p{7.5cm}}{} & & & & &\\[3mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[3mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%co_street%>}}& & & & &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%co_city%>}}& & & &<%FA_10%> &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{
-<%if tel%>
-\small{Tel: <%tel%>}~--~
-<%else%>
-\small{~}
-<%end tel%>
-<%if fax%>
-\small{Fax: <%fax%>}
-<%else%>
-\small{~}
-<%end fax%>
-}& & & & &\\[1.8mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}&~& & & &\\[-1mm]
-\end{tabular}\\[2.5mm]
-\begin{tabular}[b]{p{99mm}p{26.5mm}p{4.55mm}p{4mm}p{35mm}}
-&&&&\\[9.5mm]
-\multicolumn{2}{r}{<%41%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%44%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%49%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%43%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%48%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%81%>} & & \multicolumn{2}{r}{<%811%>}\\[1.8mm]
-\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%861%>}\\[1.8mm]
-\multicolumn{2}{r}{<%35%>} & & \multicolumn{2}{r}{<%36%>}\\[1.8mm]
-\multicolumn{2}{r}{<%77%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%76%>} & & \multicolumn{2}{r}{<%80%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%91%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%89%>} & & \multicolumn{2}{r}{<%891%>}\\[1.8mm]
-\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%931%>}\\[1.8mm]
-\multicolumn{2}{r}{<%95%>} & & \multicolumn{2}{r}{<%98%>}\\[1.8mm]
-\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%42%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%60%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%21%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%45%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z43%>}\\
-\end{tabular}
-\newpage
-
-\vspace*{-9.5mm}\hspace{27mm}<%steuernummer%>\\[-2.7mm]
-\begin{tabular}[b]{p{99mm}p{25.2mm}p{2.55mm}p{10mm}p{32mm}}
-&&&&\\
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z45%>}\\[13.5mm]
-\multicolumn{2}{r}{<%46%>} & & \multicolumn{2}{r}{<%47%>}\\[1.8mm]
-\multicolumn{2}{r}{<%52%>} & & \multicolumn{2}{r}{<%53%>}\\[1.8mm]
-\multicolumn{2}{r}{<%73%>} & & \multicolumn{2}{r}{<%74%>}\\[1.8mm]
-\multicolumn{2}{r}{<%84%>} & & \multicolumn{2}{r}{<%85%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%65%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z53%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%61%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%67%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%63%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%64%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%59%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z62%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%69%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%39%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%83%>}}\\[25.6mm]
-\end{tabular}\\[35mm]
-<%if FA_steuerberater%>
-\vspace{11mm}
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item <%FA_steuerberater_name%>
-\item <%FA_steuerberater_street%>
-\item <%FA_steuerberater_city%>
-\item Tel:~<%FA_steuerberater_tel%>
-\end{small}\\[15mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-<%if not FA_steuerberater%>
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item ~
-\item ~
-\item ~
-\item ~
-\end{small}\\[26mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-\end{document}
+++ /dev/null
-<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN">
-<html>
-<head>
- <meta content="text/html; charset=utf-8" http-equiv="content-type">
- <title>Vorschau: UStVa</title>
-<!--
-Optik an Formulare angepasst: Hartmut Goebel <h.goebel@goebel-consult.de>
-Variablen hinzugefügt: Udo Spallek <udono@gmx.net>
-Text-Erklärung und unterschiedliche Zeilenfärbung ergänzt: Kai-Martin Knaak <kmk@familieknaak.de>
--->
- <style>
-table {
- text-align: right;
- border:0;
- border-collapse:collapse;
-}
-td {
- font-size:100%;
- vertical-align:top;
-}
-td.text {
- text-align: left;
- background-color:#BDBEBD;
-}
-td.text2 {
- text-align: left;
- background-color:#ADBEBD;
-}
-td.spalte,
-td.zeile,
-td.betrag {
- border:solid thin black;
-}
-td.spalte { font-weight:bold; font-size:120%; }
-td.zeile { font-weight:bold; }
-td.betrag { width:10em; }
-td.summe { border:solid medium black; }
-td.spacer { border:0 }
-
-tr.uebertrag td { border-top:solid medium black; }
-b.h3 { font-size:120%; }
-.ausfuellen { background-color:#FFFFC0; }
-.nodis { display:none; }
- </style>
-</head>
-<body>
-<h1>Vorschau Umsatzsteuer-Voranmeldung</h1>
-<h2>Zeitraum vom <%fromdate%> bis <%todate%> </h2>
-
-<!-- Diese HTML-Formular ist nicht selbstrechnend.
-<p><small>Wenn ein (selbstrechnendes) Formular verwendet wird, genügt es, die
-gelb hinterlegten Felder auszufüllen. Die anderen Felder werden dann
-automatisch berechnet.</small></p>
--->
-
-<table width="100%">
-<tr align="left">
- <td class="text">Steuernummer: <%steuernummer%></td>
- <td class="text" width="100px"> </td>
- <td class="text" align="right">Datum (<%Datum_heute%>)</td>
-</tr>
-<tr>
- <td class="text" colspan="3"><br /></td>
-</tr>
-<tr align="left">
- <td class="text">
- Finanzamt <%FA_Name%><br />
- <%FA_Strasse%><br />
- <%FA_PLZ%> <%FA_Ort%><br />
- Fax: <%FA_FAX%>
- </td>
- <td class="text"> </td>
- <td class="text">
- Firma <%company%><br />
- <%if company_street%>
- <%company_street%><br />
- <%company_city%><br />
- <%end company_street%>
- <%if not company_street%>
- <%address%><!--used Address-->
- <%end company_street%>
- </td>
-</tr>
-<tr>
- <td class="text" colspan="3"><br />
- </td>
-</tr>
-</table>
-<table border="0" cellspacing="2" cellpadding="2">
- <tbody>
- <tr>
- <td class="text"><b class="h3">I. Anmeldung der
-Umsatzsteuer-Vorauszahlung </b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text"><b class="h4">Lieferungen und sonstige Leistungen</b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text2">an innergemeinschaftliche Abnehmer <b>mit</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>41<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%41%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text">neuer Fahrzeuge an Abnehmer <b>ohne</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>44<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%44%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">neuer Fahrzeuge außerhalb eines Unternehmens</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>49<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%49%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text">Weitere steuerfreie Umsätze mit Vorsteuerabzug</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>43<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%43%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Steuerfreie Umsätze ohne
-Vorsteuerabzug. </b><br />Umsätze nach § 4 Nr. 8 bis 20 UStG</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>48<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%48%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-
- <tr>
- <td class="text"><b class="h4">Steuerpflichtige Umsätze</b></td>
- <td colspan="4"></td>
- </tr>
-<%if not year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 16 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>51<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%51%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 51 rechts)</span></td>
- <td class="betrag"><%511%></td>
- </tr>
-<%end year2007%>
-<%if year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 19 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>81<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%81%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 81 rechts)</span></td>
- <td class="betrag"><%811%></td>
- </tr>
-<%end year2007%>
-
- <tr>
- <td class="text">zum Steuersatz von 7 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>86<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%86%></td>
- <td class="spalte"><span class="nodis">(Spalte 86 rechts)</span></td>
- <td class="betrag"><%861%></td>
- </tr>
- <tr>
- <td class="text2">andere Steuersätze</td>
- <td class="spalte ausfuellen"><span class="nodis"></span>35 <span class="nodis"></span></td>
- <td class="betrag ausfuellen"><%35%></td>
- <td class="spalte">36</td>
- <td class="betrag ausfuellen"><%36%></td>
- </tr>
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
- <tr>
- <td class="text">Lieferungen in das übrige Gemeinschaftsgebiet <b>mit</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>77<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%77%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Umsätze, nach §24 UStG (Sägewerkserzeugnisse, alkoholische Getränke etc.)</td>
- <td class="spalte ausfuellen"><span class="nodis"></span>76 <span class="nodis"></span></td>
- <td class="betrag ausfuellen"><%76%></td>
- <td class="spalte">80</td>
- <td class="betrag ausfuellen"><%80%></td>
- </tr>
- <tr><td class="text"> </td><td class="spacer" colspan="4"></td></tr>
- <tr>
- <td class="text"><b class="h3">Innergemeinschaftliche Erwerbe</b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text2">Steuerfrei nach §4b UStG</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>91<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%91%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%if not year2007%>
- <tr>
- <td class="text">Steuerpflichtige zum Steuersatz von 16 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>97<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%97%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 97 rechts)</span></td>
- <td class="betrag"><%971%></td>
- </tr>
-<%end if year2007%>
-<%if year2007%>
- <tr>
- <td class="text">Steuerpflichtige zum Steuersatz von 19 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>89<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%89%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 89 rechts)</span></td>
- <td class="betrag"><%891%></td>
- </tr>
-<%end if year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 7 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>93<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%93%></td>
- <td class="spalte"><span class="nodis">(Spalte 93 rechts)</span></td>
- <td class="betrag"><%931%></td>
- </tr>
- <tr>
- <td class="text">zu anderen Steuersätzen</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>95<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%95%></td>
- <td class="spalte">98</td>
- <td class="betrag"><%98%></td>
- </tr>
- <tr>
- <td class="text2"><b class="h4">neuer Fahrzeuge von Lieferern</b>
- von Lieferanten <b>ohne</b> USt.IdNr. <br class="nodis" />
- zum allgemeinen Steuersatz</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>94<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%94%></td>
- <td class="spalte"><span class="nodis">(Spalte </span>96<span class="nodis">)</span></td>
- <td class="betrag"><%96%></td>
- </tr>
- <tr><td class="text"> </td><td colspan="4"></td></tr>
- <tr>
- <td class="text">Lieferungen des ersten Abnehmers bei
- innergemeinschaftlichen Dreiecksgeschften (§25b Abs. 2 UStG)</td>
- <td class="spalte ausfuellen">42</td>
- <td class="betrag ausfuellen" width="70"><%42%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Steuerpflichtige Umstze im Sinne, für die der
- <b>Leistungsempfänger die Steuer schuldet</b></td>
- <td class="spalte ausfuellen">60</td>
- <td class="betrag ausfuellen" width="70"><%60%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%if year2010%>
- <tr>
- <td class="text2"><b>Nicht steuerbare Leistungen</b> gem. § 18b Satz 1 Nr. 2 UStG</td>
- <td class="spalte ausfuellen">21</td>
- <td class="betrag ausfuellen" width="70"><%21%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%end if year2010%>
- <tr>
- <td class="text">Im Inland nicht steuerbare Umsätze</td>
- <td class="spalte ausfuellen">45</td>
- <td class="betrag ausfuellen" width="70"><%45%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-
- <tr><td class="text"> </td><td class="spacer" colspan="2"></td><td colspan="2"></td></tr>
-
- <tr>
- <td class="text" colspan="3"><b class="h3">Übertrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 43<span class="nodis">)</span></td>
- <td class="betrag"><%Z43%></td>
- </tr>
-
- <tr class="uebertrag">
- <td class="text" colspan="3"><b class="h3">Übertrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 45<span class="nodis">)</span></td>
- <td class="betrag"><%Z45%></td>
- </tr>
-
-<%if year2010%>
- <tr>
- <td class="text2">Im Inland steuerpflichtige sonstige Leistungen von im übrigen Gemeinschaftsgebiet ansässigen Unternehmen (§13b Abs. 1 UStG)</td>
- <td class="spalte ausfuellen">46</td>
- <td class="betrag ausfuellen"><%46%></td>
- <td class="spalte">47</td>
- <td class="betrag"><%47%></td>
- </tr>
-<%end if year2010%>
- <tr>
- <td class="text2">Leistungen eines im Ausland ansässigen Unternehmers</td>
- <td class="spalte ausfuellen">52</td>
- <td class="betrag ausfuellen"><%52%></td>
- <td class="spalte">53</td>
- <td class="betrag"><%53%></td>
- </tr>
- <tr>
- <td class="text">Lieferungen sicherungsbereigneter Gegenstände und
- Umsätze, die unter das GrEStG fallen.</td>
- <td class="spalte ausfuellen">73</td>
- <td class="betrag ausfuellen"><%73%></td>
- <td class="spalte">74</td>
- <td class="betrag"><%74%></td>
- </tr>
- <tr>
- <td class="text2">Bauleistungen eines im Inland ansässigen Unternehmers</td>
- <td class="spalte ausfuellen">84</td>
- <td class="betrag ausfuellen"><%84%></td>
- <td class="spalte">85</td>
- <td class="betrag"><%85%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Steuer wegen Wechsel der Besteuerungsform und
- Nachsteuer auf versteuerte Anzahlungen wegen Steuersatzerhöhung.</td>
- <td class="spalte ausfuellen">65</td>
- <td class="betrag ausfuellen"><%65%></td>
- </tr>
-
-
-
- <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Umsatzsteuer</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 53<span class="nodis">)</span></td>
- <td class="betrag"><%Z53%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
-
- <tr>
- <td class="text" colspan="3"><b class="h3">Abziehbare Vorsteuerbeträge</b></td>
- <td colspan="2"></td></tr>
- </tr>
-
- <tr>
- <td class="text2" colspan="3">Vorsteuerbeträge von Rechnungen von anderen Unternehmern</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>66<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%66%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Vorsteuerbeträge aus dem innergemeinschaftlichen Erwerb</td>
- <td class="spalte ausfuellen">61</td>
- <td class="betrag ausfuellen"><%61%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Entrichtete Einfuhrumsatzsteuer</td>
- <td class="spalte ausfuellen">62</td>
- <td class="betrag ausfuellen"><%62%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Vorsteuerbeträge aus Leistungen im Sinne
- des §13b Abs. 1 UStG</td>
- <td class="spalte ausfuellen">67</td>
- <td class="betrag ausfuellen"><%67%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Vorsteuerbeträge, die nach allgemeinen
- Durchschnittsästzen berechnet sind </td>
- <td class="spalte ausfuellen">63</td>
- <td class="betrag ausfuellen"><%63%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Berichtigung des Vorsteuerabzugs</td>
- <td class="spalte ausfuellen">64</td>
- <td class="betrag ausfuellen"><%64%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Vorsteuerabzug für innergemeinschaftliche Lieferungen
- neuer Fahrzeuge außerhalb eines Unternehmens sowie von Kleinunternehmern</td>
- <td class="spalte ausfuellen">59</td>
- <td class="betrag ausfuellen"><%59%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Verbleibender Betrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 62<span class="nodis">)</span></td>
- <td class="betrag"><%Z62%></td>
- </tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Andere Steuerbeträge</b></td>
- <td colspan="2"></td></tr>
- </tr>
- <tr>
- <td class="text" colspan="3">in Rechnungen unrichtig oder unberechtigt ausgewiesene
- Steuerbeträge sowie Steuerbeträge, die nach
- §4 Nr. 4a, § 6a Abs. 4, §7 oder §25b UStG geschuldet werden</td>
- <td class="spalte ausfuellen">69</td>
- <td class="betrag ausfuellen"><%69%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Umsatzsteuer-Vorauszahlung/Überschuss</b></td>
- <td class="zeile"><span class="nodis">(</span>Zeile 65<span class="nodis">)</span></td>
- <td class="betrag"><%Z65%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Anrechnung (Abzug) der festgesetzten Sondervorauszahlung
- für Dauerfristverlängerung (nur in der letzten Voranmeldung des
- Besteuerungszeitraums, ausfüllen)</td>
- <td class="spalte ausfuellen">39</td>
- <td class="betrag ausfuellen"><%39%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
-
- <tr class="noborder">
- <td class="text2" colspan="3"><b class="h3">Verbleibende Umsatzsteuer-Vorauszahlung bzw.
- Verbleibender Überschuss</b></td>
- <td class="spalte ausfuellen">83</td>
- <td class="summe"><%83%></td>
- </tr>
-
- </tbody>
-</table>
-<%if FA_steuerberater%>
-<p>
-Steuerberater:<br />
-<%FA_steuerberater_name%><br />
-<%FA_steuerberater_street%><br />
-<%FA_steuerberater_city%><br />
-Tel: <%FA_steuerberater_tel%></p>
-<%end FA_steuerberater%>
-</body>
-</html>
+++ /dev/null
-% German USTVA template for taxreports
-%
-% Contributed by Jens Koerner, Peter Schorer, Udo Spallek
-%
-%
-\documentclass[twoside]{scrartcl}
-\usepackage{a4,german}
-\usepackage[frame]{xy}
-\usepackage[utf8]{inputenc}
-\usepackage[german]{babel}
-\usepackage{graphicx}
-\usepackage{tabularx}
-\usepackage{times, german}
-\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getÀtigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÀrts
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0cm}
-\setlength{\headsep}{0cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{0cm}
-\setlength{\evensidemargin}{0cm}
-\setlength{\textwidth}{20.9cm}
-\setlength{\textheight}{29.6cm}
-\setlength{\footskip}{-0cm}
-\setlength{\parindent}{0pt}
-
-\begin{document}
-
-\fontfamily{cmss}\fontshape{n}\large\selectfont
-\pagestyle{myheadings}
-\markboth{\hspace{7mm}\protect\includegraphics[viewport = 60 700 700 790]{ustva2.pdf}}
-{\protect\includegraphics[viewport = 60 700 700 790]{ustva1.pdf}}
-\hspace{1mm}
-\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{5mm}p{27mm}p{3mm}}
-\multicolumn{7}{c}{}\\[-2mm]
- & \multicolumn{6}{l}{<%steuernummer%>}\\
-\multicolumn{7}{c}{}\\[15mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
-\multicolumn{2}{p{7.5cm}}{} & & & & &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company_street%>}}& & & & &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company_city%>}}& & & & &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{
-<%if tel%>
-\small{Tel: <%tel%>}~--~
-<%end tel%>
-<%if fax%>
-\small{Fax: <%fax%>}
-<%end fax%>
-}& & & &<%FA_10%> &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}& & & & &\\[-1mm]
-\end{tabular}\\[28.5mm]
-\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
-&&&&\\[42mm]
-\multicolumn{2}{r}{<%51%>} & & \multicolumn{2}{r}{<%51r%>}\\[1.5mm]
-\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%86r%>}\\[46mm]
-\multicolumn{2}{r}{<%97%>} & & \multicolumn{2}{r}{<%97r%>}\\[1.5mm]
-\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%93r%>}\\[7.9mm]
-\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[14mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\
-%\multicolumn{2}{||r|}{1000} & & & \\
-%\multicolumn{2}{||r|}{1000} & & \multicolumn{2}{r}{100.000.000~~00}\\
-%\multicolumn{3}{||r|}{1.000.000.000~~00} & \multicolumn{2}{r}{100.000.000~~00}\\
-\end{tabular}
-
-\newpage
-
-\vspace*{-10mm}\hspace{27mm}<%steuernummer%>\\[-2.5mm]
-\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
-&&&&\\
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%45%>}\\[46mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\[7.9mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[7.9mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[58.5mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%67%>}}\\[26mm]
-\end{tabular}\\[35mm]
-<%if FA_steuerberater%>
-\vspace{11mm}
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item <%FA_steuerberater_name%>
-\item <%FA_steuerberater_street%>
-\item <%FA_steuerberater_city%>
-\item Tel:~<%FA_steuerberater_tel%>
-\end{small}\\[15mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-<%if not FA_steuerberater%>
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item ~
-\item ~
-\item ~
-\item ~
-\end{small}\\[26mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-\end{document}
+++ /dev/null
-<?xml version="1.0" encoding="UTF-8" ?>
-<!-- Diese Datei ist mit Lx-Office <%version%> generiert -->
-<WinstonAusgang>
- <Formular Typ="UST"></Formular>
- <Ordnungsnummer><%elsterFFFF%><%elstersteuernummer%></Ordnungsnummer>
- <AnmeldeJahr><%year%></AnmeldeJahr>
- <AnmeldeZeitraum><%period%></AnmeldeZeitraum>
-
-<%foreach id%>
- <Kennzahl nr="<%id%>"><%amount%></Kennzahl>
-<%end%>
-
-</WinstonAusgang>
-
+++ /dev/null
-
-<body bgcolor="#ffffff">
-
-<h2 align="center">
-<%company%>
-<br><%address%>
-
-<p>BILANZ
-<br><%period%>
-</h2>
-
-<table border="0">
-<tr>
- <th align="left" width="400" colspan="2">AKTIVA<br><hr align="left" width="250" size="5" noshade></th>
- <th><%this_period%></th>
- <th><%last_period%></th>
-</tr>
-
-<%foreach asset_account%>
-<tr>
- <td> </td>
- <td><%asset_account%></td>
- <td align="right"><%asset_this_period%></td>
- <td align="right"><%asset_last_period%></td>
-</tr>
-<%end asset_account%>
-
-<tr>
- <td colspan="2"> </td>
- <td><hr noshade size="1"></td>
- <td><hr noshade size="1"></td>
-</tr>
-
-<tr valign="top">
- <th align="left" colspan="2">TOTAL</th>
- <td align="right"><%total_assets_this_period%><hr noshade size="2"></td>
- <td align="right"><%total_assets_last_period%><hr noshade size="2"></td>
-</tr>
-
-<tr>
- <th align="left" colspan="4">PASSIVA<b><hr align="left" width="250" size="5" noshade></th>
-</tr>
-
-<%foreach liability_account%>
-<tr>
- <td></td>
- <td><%liability_account%></td>
- <td align="right"><%liability_this_period%></td>
- <td align="right"><%liability_last_period%></td>
-</tr>
-<%end liability_account%>
-
-<tr>
- <td colspan="2"> </td>
- <td><hr noshade size="1"></td>
- <td><hr noshade size="1"></td>
-</tr>
-
-<tr valign="top">
- <td></td>
- <th align="left">TOTAL</th>
- <td align="right"><%total_liabilities_this_period%><br><hr noshade size="2"</td>
- <td align="right"><%total_liabilities_last_period%><br><hr noshade size="2"</td>
-</tr>
-
-<tr>
- <th align="left" colspan="4">EIGENTUM<br><hr align="left" width="250" size="5" noshade></th>
-</tr>
-
-<%foreach equity_account%>
-<tr>
- <td></td>
- <td><%equity_account%></td>
- <td align="right"><%equity_this_period%></td>
- <td align="right"><%equity_last_period%></td>
-</tr>
-<%end equity_account%>
-
-<tr>
- <td colspan="2"> </td>
- <td><hr noshade size="1"></td>
- <td><hr noshade size="1"></td>
-</tr>
-
-<tr valign="top">
- <td></td>
- <th align="left">TOTAL</th>
- <td align="right"><%total_equity_this_period%><br><hr noshade size="2"</td>
- <td align="right"><%total_equity_last_period%><br><hr noshade size="2"</td>
-</tr>
-
-<tr valign="top">
- <th align="left" colspan="2">TOTAL PASSIVA & EIGENTUM</th>
- <td align="right"><%total_this_period%><br><hr noshade size="2"></td>
- <td align="right"><%total_last_period%><br><hr noshade size="2"></td>
-</tr>
-</table>
-
-
-
+++ /dev/null
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
-
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <th align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>L A G E R L I S T E</h4>
- </th>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% cellspacing=0 cellpadding=0>
- <tr bgcolor=000000>
- <th align=left width=50%><font color=ffffff>Absender</th>
- <th align=left width=50%><font color=ffffff>Lieferanschrift</th>
- </tr>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- <br>
-
- <%if contact%>
- <br>Kontakt: <%contact%>
- <%end contact%>
-
- <%if vendorphone%>
- <br>Tel: <%vendorphone%>
- <%end vendorphone%>
-
- <%if vendorfax%>
- <br>Fax: <%vendorfax%>
- <%end vendorfax%>
-
- <%if email%>
- <br><%email%>
- <%end email%>
-
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
-
- <br>
- <%if shiptocontact%>
- <br>Kontakt: <%shiptocontact%>
- <%end shiptocontact%>
-
- <%if shiptophone%>
- <br>Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- <br>Fax: <%shiptofax%>
- <%end shiptofax%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height=5></tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left nowrap>BestellNr. #</th>
- <th width=17% align=left nowrap>Datum</th>
- <th width=17% align=left nowrap>Kontakt</th>
- <%if warehouse%>
- <th width=17% align=left nowrap>Lager</th>
- <%end warehouse%>
- <th width=17% align=left>Versandort</th>
- <th width=15% align=left>Lieferung durch</th>
- </tr>
-
- <tr>
- <td><%ordnumber%> </td>
-
- <%if shippingdate%>
- <td><%shippingdate%></td>
- <%end shippingdate%>
-
- <%if not shippingdate%>
- <td><%orddate%></td>
- <%end shippingdate%>
-
- <td><%employee%> </td>
-
- <%if warehouse%>
- <td><%warehouse%></td>
- <%end warehouse%>
-
- <td><%shippingpoint%> </td>
- <td><%shipvia%> </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>Pos</th>
- <th align=left><font color=ffffff>ArtNr.</th>
- <th align=left><font color=ffffff>Beschreibung</th>
- <th><font color=ffffff>Seriennummer</th>
- <th> </th>
- <th><font color=ffffff>Menge</th>
- <th><font color=ffffff>Erh</th>
- <th> </th>
- <th><font color=ffffff>Lagerplatz</th>
- </tr>
-
- <%foreach number%>
- <tr valign=top>
- <td><%runningnumber%></td>
- <td><%number%></td>
- <td><%description%></td>
- <td><%serialnumber%></td>
- <td><%deliverydate%></td>
- <td align=right><%qty%></td>
- <td align=right><%ship%></td>
- <td><%unit%></td>
- <td><%bin%></td>
- </tr>
- <%end number%>
-
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td><hr noshade></td>
- </tr>
-
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{%
- <%company%>
-
- <%address%>
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Tel & <%tel%>\\
- Fax & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
-\textbf{Von}
-\vspace{0.7cm}
-
-<%name%> \\
-<%street%> \\
-<%zipcode%> \\
-<%city%> \\
-<%country%>
-}
-\parbox[t]{.4\textwidth}{
-\textbf{Lieferanschrift}
-\vspace{0.7cm}
-
-<%shiptoname%> \\
-<%shiptostreet%> \\
-<%shiptozipcode%> \\
-<%shiptocity%> \\
-<%shiptocountry%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{L A G E R L I S T E}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{BestellNr. \#} & \textbf{Datum} & \textbf{Kontakt}
- <%if warehouse%>
- & \textbf{Lager}
- <%end warehouse%>
- & \textbf{Lagerplatz} & \textbf{Lieferung mit} \\ [0.5em]
- \hline
-
- <%ordnumber%>
- <%if shippingdate%>
- & <%shippingdate%>
- <%end shippingdate%>
- <%if not shippingdate%>
- & <%orddate%>
- <%end shippingdate%>
- & <%employee%>
- <%if warehouse%>
- & <%warehouse%>
- <%end warehouse%>
- & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{@{}rlXllrrll@{}}
- \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} & \textbf{Seriennumner} & & \textbf{Menge} & \textbf{Erh} & & \textbf{Lagerplatz} \\
-
-<%foreach number%>
- <%runningnumber%> & <%number%> & <%description%> & <%serialnumber%> &
- <%deliverydate%> & <%qty%> & <%ship%> & <%unit%> & <%bin%> \\
-<%end number%>
-\end{tabularx}
-
-
-\rule{\textwidth}{2pt}
-
-\end{document}
-
+++ /dev/null
-<body>
-<style type="text/css">
-<!--
-/* Allgemeine Schriftdefinition */
-th,td {
- font-family: Arial, Verdana, Helvetica, Sans-serif;
- font-size:small;
-}
-
-@page {
- size: landscape;
- margin: 0.5cm;
-}
-
-/* Definition Tabellenueberschrift */
-
-.left { text-align:left; }
-.center { text-align:center; }
-.right { text-align:right; }
-
-tr.headline { border:0; }
-tr.headline td { border:0; }
-h1 { font-size:120%; }
-h2 { font-size:100%; }
-
-/* Tabellenkopf */
-th {
- font-weight: bold;
- border-bottom: solid thin black;
- padding:0 10px;
- text-align:right;
-}
-
-th.left { border-left: solid thin black; }
-th.right { border-right: solid thin black; }
-
-.querkopf th.right { text-align:center; }
-.querkopf th {
- border-top: solid thin black;
- border-bottom:0;
-}
-
-/* Tabelleninhalt */
-td {
- text-align:right;
- padding:0 0.5em;
-}
-td.left { border-left: solid thin black; }
-td.right { border-right: solid thin black; }
-
-
-/* jede zweite Zeile grau hinterlegen */
-tr.grey {
- background:#f0f0f0;
-}
-
-/* letzte Zeile in der Tabelle */
-#last td{ border-bottom: solid thin black; }
-
-/* Zwischensumme/-ueberschriften */
-tr.subtotal td { font-weight: bold; }
-
-/* Fusszeile unter der Tabelle */
-td.footer {
- text-align:right;
- font-size:smaller;
-}
-//-->
-</style>
-
-<table border=0 cellpadding=0 cellspacing=0>
-<tr class="headline">
- <td class="left"><%company%></td>
- <td class=center colspan="9">
- <h1>Kurzfristige Erfolgsrechnung <%period%></h1>
- <h2>SKR3 BWA</h2>
- </td>
- <td class="right">Blatt 1</td>
-</tr>
-
-
-</tr>
-<tr class="querkopf">
- <th class="left"> </th>
- <th class="center" colspan="5">Im Betrachtungszeitraum</th>
- <th class="right" colspan="5">Kumuliert seit Jahresanfang</th>
-</tr>
-
-<tr>
- <th class="left">Bezeichnung</th>
- <th>Wert</th>
- <th>% Ges.- Leistg.</th>
- <th>% Ges.- Kosten</th>
- <th>% Pers.- Kosten</th>
- <th>Aufschlag</th>
- <th>Wert</th>
- <th>% Ges.- Leistg.</th>
- <th>% Ges.- Kosten</th>
- <th>% Pers.- Kosten</th>
- <th class="right">Aufschlag</th>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Umsatzerlöse</nobr></td>
- <td><nobr><%jetzt1%></nobr></td>
- <td><nobr><%jetztgl1%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm1%></nobr></td>
- <td><nobr><%kummgl1%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Best.Verdg. FE/UE</nobr></td>
- <td><nobr><%jetzt2%></nobr></td>
- <td><nobr><%jetztgl2%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm2%></nobr></td>
- <td><nobr><%kummgl2%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Akt.Eigenleistungen</nobr></td>
- <td><nobr><%jetzt3%></nobr></td>
- <td><nobr><%jetztgl3%></nobr></td>
- <td></td>
- <td></td>
- <td></td>
- <td><nobr><%kumm3%></nobr></td>
- <td><nobr><%kummgl3%></nobr></td>
- <td></td>
- <td></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Gesamtleistung</nobr></td>
- <td><nobr><%jetztgesamtleistung%></nobr></td>
- <td><nobr><%jetztglgesamtleistung%></nobr></td>
- <td><nobr><%jetztgkgesamtleistung%></nobr></td>
- <td><nobr><%jetztpkgesamtleistung%></nobr></td>
- <td></td>
- <td><nobr><%kummgesamtleistung%></nobr></td>
- <td><nobr><%kummglgesamtleistung%></nobr></td>
- <td><nobr><%kummgkgesamtleistung%></nobr></td>
- <td><nobr><%kummpkgesamtleistung%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Mat./Wareneinkauf</nobr></td>
- <td><nobr><%jetzt4%></nobr></td>
- <td><nobr><%jetztgl4%></nobr></td>
- <td><nobr><%jetztgk4%></nobr></td>
- <td><nobr><%jetztpk4%></nobr></td>
- <td><nobr><%jetztauf4%></nobr></td>
- <td><nobr><%kumm4%></nobr></td>
- <td><nobr><%kummgl4%></nobr></td>
- <td><nobr><%kummgk4%></nobr></td>
- <td><nobr><%kummpk4%></nobr></td>
- <td class="right"><nobr><%kummauf4%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Rohertrag</nobr></td>
- <td><nobr><%jetztrohertrag%></nobr></td>
- <td><nobr><%jetztglrohertrag%></nobr></td>
- <td><nobr><%jetztgkrohertrag%></nobr></td>
- <td><nobr><%jetztpkrohertrag%></nobr></td>
- <td><nobr><%jetztaufrohertrag%></nobr></td>
- <td><nobr><%kummrohertrag%></nobr></td>
- <td><nobr><%kummglrohertrag%></nobr></td>
- <td><nobr><%kummgkrohertrag%></nobr></td>
- <td><nobr><%kummpkrohertrag%></nobr></td>
- <td class="right"><nobr><%kummaufrohertrag%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>So.betr.Erlöse</nobr></td>
- <td><nobr><%jetzt5%></nobr></td>
- <td><nobr><%jetztgl5%></nobr></td>
- <td><nobr><%jetztgk5%></nobr></td>
- <td><nobr><%jetztpk5%></nobr></td>
- <td></td>
- <td><nobr><%kumm5%></nobr></td>
- <td><nobr><%kummgl5%></nobr></td>
- <td><nobr><%kummgk5%></nobr></td>
- <td><nobr><%kummpk5%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Betriebl. Rohertrag</nobr></td>
- <td><nobr><%jetztbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztglbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztgkbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztpkbetriebrohertrag%></nobr></td>
- <td><nobr><%jetztaufbetriebrohertrag%></nobr></td>
- <td><nobr><%kummbetriebrohertrag%></nobr></td>
- <td><nobr><%kummglbetriebrohertrag%></nobr></td>
- <td><nobr><%kummgkbetriebrohertrag%></nobr></td>
- <td><nobr><%kummpkbetriebrohertrag%></nobr></td>
- <td
-class="right"><nobr><%kummaufbetriebrohertrag%></nobr> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left">Kostenarten:</td>
- <td class="right" colspan="10"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Personalkosten</nobr></td>
- <td><nobr><%jetzt10%></nobr></td>
- <td><nobr><%jetztgl10%></nobr></td>
- <td><nobr><%jetztgk10%></nobr></td>
- <td><nobr><%jetztpk10%></nobr></td>
- <td></td>
- <td><nobr><%kumm10%></nobr></td>
- <td><nobr><%kummgl10%></nobr></td>
- <td><nobr><%kummgk10%></nobr></td>
- <td><nobr><%kummpk10%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Raumkosten</nobr></td>
- <td><nobr><%jetzt11%></nobr></td>
- <td><nobr><%jetztgl11%></nobr></td>
- <td><nobr><%jetztgk11%></nobr></td>
- <td><nobr><%jetztpk11%></nobr></td>
- <td></td>
- <td><nobr><%kumm11%></nobr></td>
- <td><nobr><%kummgl11%></nobr></td>
- <td><nobr><%kummgk11%></nobr></td>
- <td><nobr><%kummpk11%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Betriebl.Steuern</nobr></td>
- <td><nobr><%jetzt12%></nobr></td>
- <td><nobr><%jetztgl12%></nobr></td>
- <td><nobr><%jetztgk12%></nobr></td>
- <td><nobr><%jetztpk12%></nobr></td>
- <td></td>
- <td><nobr><%kumm12%></nobr></td>
- <td><nobr><%kummgl12%></nobr></td>
- <td><nobr><%kummgk12%></nobr></td>
- <td><nobr><%kummpk12%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Versich./Beiträge</nobr></td>
- <td><nobr><%jetzt13%></nobr></td>
- <td><nobr><%jetztgl13%></nobr></td>
- <td><nobr><%jetztgk13%></nobr></td>
- <td><nobr><%jetztpk13%></nobr></td>
- <td></td>
- <td><nobr><%kumm13%></nobr></td>
- <td><nobr><%kummgl13%></nobr></td>
- <td><nobr><%kummgk13%></nobr></td>
- <td><nobr><%kummpk13%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Kfz-Kosten (o.St.)</nobr></td>
- <td><nobr><%jetzt14%></nobr></td>
- <td><nobr><%jetztgl14%></nobr></td>
- <td><nobr><%jetztgk14%></nobr></td>
- <td><nobr><%jetztpk14%></nobr></td>
- <td></td>
- <td><nobr><%kumm14%></nobr></td>
- <td><nobr><%kummgl14%></nobr></td>
- <td><nobr><%kummgk14%></nobr></td>
- <td><nobr><%kummpk14%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Werbe-/Reisekosten</nobr></td>
- <td><nobr><%jetzt15%></nobr></td>
- <td><nobr><%jetztgl15%></nobr></td>
- <td><nobr><%jetztgk15%></nobr></td>
- <td><nobr><%jetztpk15%></nobr></td>
- <td></td>
- <td><nobr><%kumm15%></nobr></td>
- <td><nobr><%kummgl15%></nobr></td>
- <td><nobr><%kummgk15%></nobr></td>
- <td><nobr><%kummpk15%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Kosten Warenabgabe</nobr></td>
- <td><nobr><%jetzt16%></nobr></td>
- <td><nobr><%jetztgl16%></nobr></td>
- <td><nobr><%jetztgk16%></nobr></td>
- <td><nobr><%jetztpk16%></nobr></td>
- <td></td>
- <td><nobr><%kumm16%></nobr></td>
- <td><nobr><%kummgl16%></nobr>
-</td>
- <td><nobr><%kummgk16%></nobr></td>
- <td><nobr><%kummpk16%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Abschreibungen</nobr></td>
- <td><nobr><%jetzt17%></nobr></td>
- <td><nobr><%jetztgl17%></nobr></td>
- <td><nobr><%jetztgk17%></nobr></td>
- <td><nobr><%jetztpk17%></nobr></td>
- <td></td>
- <td><nobr><%kumm17%></nobr></td>
- <td><nobr><%kummgl17%></nobr></td>
- <td><nobr><%kummgk17%></nobr></td>
- <td><nobr><%kummpk17%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Reparatur/Instandh.</nobr></td>
- <td><nobr><%jetzt18%></nobr></td>
- <td><nobr><%jetztgl18%></nobr></td>
- <td><nobr><%jetztgk18%></nobr></td>
- <td><nobr><%jetztpk18%></nobr></td>
- <td></td>
- <td><nobr><%kumm18%></nobr></td>
- <td><nobr><%kummgl18%></nobr></td>
- <td><nobr><%kummgk18%></nobr></td>
- <td><nobr><%kummpk18%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Sonstige Kosten</nobr></td>
- <td><nobr><%jetzt20%></nobr></td>
- <td><nobr><%jetztgl20%></nobr></td>
- <td><nobr><%jetztgk20%></nobr></td>
- <td><nobr><%jetztpk20%></nobr></td>
- <td></td>
- <td><nobr><%kumm20%></nobr></td>
- <td><nobr><%kummgl20%></nobr></td>
- <td><nobr><%kummgk20%></nobr></td>
- <td><nobr><%kummpk20%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Gesamtkosten</nobr></td>
- <td><nobr><%jetztgesamtkosten%></nobr></td>
- <td><nobr><%jetztglgesamtkosten%></nobr></td>
- <td><nobr><%jetztgkgesamtkosten%></nobr></td>
- <td><nobr><%jetztpkgesamtkosten%></nobr></td>
- <td></td>
- <td><nobr><%kummgesamtkosten%></nobr></td>
- <td><nobr><%kummglgesamtkosten%></nobr></td>
- <td><nobr><%kummgkgesamtkosten%></nobr></td>
- <td><nobr><%kummpkgesamtkosten%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-
-<tr class="grey subtotal">
-<td class="left"><nobr>Betriebsergebnis</nobr></td>
- <td><nobr><%jetztbetriebsergebnis%></nobr></td>
- <td><nobr><%jetztglbetriebsergebnis%></nobr>
-</td>
- <td><nobr><%jetztgkbetriebsergebnis%></nobr></td>
- <td><nobr><%jetztpkbetriebsergebnis%></nobr></td>
- <td></td>
- <td><nobr><%kummbetriebsergebnis%></nobr></td>
- <td><nobr><%kummglbetriebsergebnis%></nobr>
-</td>
- <td><nobr><%kummgkbetriebsergebnis%></nobr></td>
- <td><nobr><%kummpkbetriebsergebnis%></nobr></td>
- <td class="right"> </td>
- </tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Zinsaufwand</nobr></td>
- <td><nobr><%jetzt30%></nobr></td>
- <td><nobr><%jetztgl30%></nobr></td>
- <td><nobr><%jetztgk30%></nobr></td>
- <td><nobr><%jetztpk30%></nobr></td>
- <td></td>
- <td><nobr><%kumm30%></nobr></td>
- <td><nobr><%kummgl30%></nobr></td>
- <td><nobr><%kummgk30%></nobr></td>
- <td><nobr><%kummpk30%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Übrige Steuern</nobr></td>
- <td><nobr><%jetzt19%></nobr></td>
- <td><nobr><%jetztgl19%></nobr></td>
- <td><nobr><%jetztgk19%></nobr></td>
- <td><nobr><%jetztpk19%></nobr></td>
- <td></td>
- <td><nobr><%kumm19%></nobr></td>
- <td><nobr><%kummg191%></nobr></td>
- <td><nobr><%kummgk19%></nobr></td>
- <td><nobr><%kummpk19%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Sonst. neutr. Aufwand</nobr></td>
- <td><nobr><%jetzt31%></nobr></td>
- <td><nobr><%jetztgl31%></nobr></td>
- <td><nobr><%jetztgk31%></nobr></td>
- <td><nobr><%jetztpk31%></nobr></td>
- <td></td>
- <td><nobr><%kumm31%></nobr></td>
- <td><nobr><%kummgl31%></nobr></td>
- <td><nobr><%kummgk31%></nobr></td>
- <td><nobr><%kummpk31%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white subtotal">
-<td class="left"><nobr>Neutraler Aufwand</nobr></td>
- <td><nobr><%jetztneutraleraufwand%></nobr></td>
- <td><nobr><%jetztglneutraleraufwand%></nobr></td>
- <td><nobr><%jetztgkneutraleraufwand%></nobr></td>
- <td><nobr><%jetztpkneutraleraufwand%></nobr></td>
- <td></td>
- <td><nobr><%kummneutraleraufwand%></nobr></td>
- <td><nobr><%kummglneutraleraufwand%></nobr></td>
- <td><nobr><%kummgkneutraleraufwand%></nobr></td>
- <td><nobr><%kummpkneutraleraufwand%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="white">
- <td class="left"><nobr>Zinserträge</nobr></td>
- <td><nobr><%jetzt32%></nobr></td>
- <td><nobr><%jetztgl32%></nobr></td>
- <td><nobr><%jetztgk32%></nobr></td>
- <td><nobr><%jetztpk32%></nobr></td>
- <td></td>
- <td><nobr><%kumm32%></nobr></td>
- <td><nobr><%kummgl32%></nobr></td>
- <td><nobr><%kummgk32%></nobr></td>
- <td><nobr><%kummpk32%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey">
- <td class="left"><nobr>Sonst. neutr. Ertr.</nobr></td>
- <td><nobr><%jetzt33%></nobr></td>
- <td><nobr><%jetztgl33%></nobr></td>
- <td><nobr><%jetztgk33%></nobr></td>
- <td><nobr><%jetztpk33%></nobr></td>
- <td></td>
- <td><nobr><%kumm33%></nobr></td>
- <td><nobr><%kummgl33%></nobr></td>
- <td><nobr><%kummgk33%></nobr></td>
- <td><nobr><%kummpk33%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white">
- <td class="left"><nobr>Verr.kalk.Kosten</nobr></td>
- <td><nobr><%jetzt34%></nobr></td>
- <td><nobr><%jetztgl34%></nobr>
- <td><nobr><%jetztgk34%></nobr></td>
- <td><nobr><%jetztpk34%></nobr></td>
- <td></td>
- <td><nobr><%kumm34%></nobr></td>
- <td><nobr><%kummgl34%></nobr></td>
- <td><nobr><%kummgk34%></nobr></td>
- <td><nobr><%kummpk34%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Neutraler Ertrag</nobr></td>
- <td><nobr><%jetztneutralerertrag%></nobr></td>
- <td><nobr><%jetztglneutralerertrag%></nobr></td>
- <td><nobr><%jetztgkneutralerertrag%></nobr></td>
- <td><nobr><%jetztpkneutralerertrag%></nobr></td>
- <td></td>
- <td><nobr><%kummneutralerertrag%></nobr></td>
- <td><nobr><%kummglneutralerertrag%></nobr></td>
- <td><nobr><%kummgkneutralerertrag%></nobr></td>
- <td><nobr><%kummpkneutralerertrag%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Ergebnis vor Steuern</nobr></td>
- <td><nobr><%jetztergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztglergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztgkergebnisvorsteuern%></nobr></td>
- <td><nobr><%jetztpkergebnisvorsteuern%></nobr></td>
- <td></td>
- <td><nobr><%kummergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummglergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummgkergebnisvorsteuern%></nobr></td>
- <td><nobr><%kummpkergebnisvorsteuern%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey">
- <td class="left"><nobr>Steuern Eink.u.Ertr.</nobr></td>
- <td><nobr><%jetzt35%></nobr></td>
- <td><nobr><%jetztgl35%></nobr></td>
- <td><nobr><%jetztgk35%></nobr></td>
- <td><nobr><%jetztpk35%></nobr></td>
- <td></td>
- <td><nobr><%kumm35%></nobr></td>
- <td><nobr><%kummgl35%></nobr></td>
- <td><nobr><%kummgk35%></nobr></td>
- <td><nobr><%kummpk35%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white"><td class="left right" colspan="11"> </td></tr>
-
-<tr class="grey subtotal">
- <td class="left"><nobr>Vorläufiges Ergebnis</nobr></td>
- <td><nobr><%jetztergebnis%></nobr></td>
- <td><nobr><%jetztglergebnis%></nobr></td>
- <td><nobr><%jetztgkergebnis%></nobr></td>
- <td><nobr><%jetztpkergebnis%></nobr></td>
- <td></td>
- <td><nobr><%kummergebnis%></nobr></td>
- <td><nobr><%kummglergebnis%></nobr></td>
- <td><nobr><%kummgkergebnis%></nobr></td>
- <td><nobr><%kummpkergebnis%></nobr></td>
- <td class="right"> </td>
-</tr>
-
-<tr class="white" id=last><td class="left right"
-colspan="11"> </td></tr>
-
-<tr>
- <td colspan=11 class=footer>Währung: Euro - FiBu: LX Office ERP
-(Version <%version%>) - Formular: 11.01.2007</td>
-</tr>
-
-</table>
-</body>
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.4cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.0cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-
-\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
-
-\parbox[t]{12cm}{
- <%company%>
-
- <%address%>}
-\hfill
-\parbox[t]{6cm}{\hfill <%source%>}
-
-\vspace*{0.6cm}
-
-<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
-
-\vspace{0.5cm}
-
-\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
-
-\vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{2.8cm}
-
-<%company%>
-
-\vspace{0.5cm}
-
-<%name%> \hfill <%datepaid%> \hfill <%source%>
-
-\vspace{0.5cm}
-\begin{tabularx}{\textwidth}{lXrr@{}}
-\textbf{Rechnung} & \textbf{Ausgestellt}
- & \textbf{Fällig} & \textbf{Verrechnet} \\
-<%foreach invnumber%>
-<%invnumber%> & <%invdate%> \dotfill
- & <%due%> & <%paid%> \\
-<%end invnumber%>
-\end{tabularx}
-
-\vfill
-
-\end{document}
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage{ifthen}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\setlength{\parindent}{0cm}
-
-\pagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Gutschrift}}} \vspace*{0.2cm}
- \rightline{\large\textbf{\textit{Nr. <%invnumber%>% \vspace*{0.2cm}
- }}}
- für Rechnung: \hfill <%invnumber_for_credit_note%>
-
- Gutschriftdatum:\hfill <%invdate%>
-
- Auftrag-Nr:\hfill <%ordnumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-Ihre Bestellung <%cusordnumber%> vom <%orddate%>
-% \hfill
-
-\vspace*{0.5cm}
-
-Sehr geehrte Damen und Herren,
-
-\vspace{0.5cm}
-
-\begin{tabularx}{\textwidth}{lrXrr}
- \hline
- \textbf{Pos} & \textbf{Menge} & \textbf{Bezeichnung} &
- \textbf{E-Preis/\euro} & \textbf{G-Preis/\euro} \\
- \hline
- <%foreach number%>
- <%runningnumber%> & <%qty%> <%unit%> & \raggedright <%description%> &
- <%sellprice%> \euro & <%linetotal%> \euro \\
- <%if discount_sub%> & Zwischensumme: & & <%discount_sub%> \euro & <%end if%>\\
- <%end number%>\hline
- \multicolumn{4}{l}{Nettobetrag} & <%subtotal%> \euro \\
- <%foreach tax%>
- \multicolumn{4}{l}{<%taxdescription%>} & <%tax%> \euro \\
- <%end tax%>
- \multicolumn{4}{l}{\textbf{Endbetrag}} & \textbf{<%invtotal%> \euro} \\ \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\end{document}
-
+++ /dev/null
-<body>
-
-<h2 align=center>
-Einnahmenüberschußrechnung</h2>
-<h3 align=center>-EÜR- (Gewinnermittlung nach §4 Abs. 3 EStG)
-<br><%period%>
-</h3>
-
-<table width=100% border=0>
-<tr>
- <td width=75% align=left colspan=2><font size="+1"><b>A. Betriebseinnahmen</font></b><br></td>
- <td></td>
-</tr>
-
-<tr>
- <td>
- Umsatzerlöse
- </td>
- <td>
- <%eur1%>
- </td>
-</tr>
-<tr>
- <td>
- sonstige Erlöse
- </td>
- <td>
- <%eur2%>
- </td>
-</tr>
-<tr>
- <td>
- Privatanteile
- </td>
- <td>
- <%eur3%>
- </td>
-</tr>
-<tr>
- <td>
- Zinserträge
- </td>
- <td>
- <%eur4%>
- </td>
-</tr>
-<tr>
- <td>
- Außerordentliche Erträge
- </td>
- <td>
- <%eur5%>
- </td>
-</tr>
-<tr>
- <td>
- Vereinnahmte Umsatzsteuer
- </td>
- <td>
- <%eur6%>
- </td>
-</tr>
-<tr>
- <td>
- Umsatzsteuererstattungen
- </td>
- <td>
- <%eur7%>
- </td>
-</tr>
-
-
-<tr>
- <td> </td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <th align=left><b>Summe Einnahmen</b></th>
- <td align=right><%sumeura%><hr noshade size=2></td>
-</tr>
-<tr>
- <td></td>
- <td><br><br></td>
-</tr>
-<tr>
- <td align=left><font size="+1"><b>B. Betriebsausgaben</font></b><br></td>
- <td></td>
-</tr>
-
-<tr>
- <td>
- Wareneingänge
- </td>
- <td>
- <%eur8%>
- </td>
-</tr>
-<tr>
- <td>
- Löhne und Gehäter
- </td>
- <td>
- <%eur9%>
- </td>
-</tr>
-<tr>
- <td>
- Gesetzlicher sozialer Aufwand
- </td>
- <td>
- <%eur10%>
- </td>
-</tr>
-<tr>
- <td>
- Mieten
- </td>
- <td>
- <%eur11%>
- </td>
-</tr>
-<tr>
- <td>
- Gas, Strom, Wasser
- </td>
- <td>
- <%eur12%>
- </td>
-</tr>
-<tr>
- <td>
- Instandhaltung
- </td>
- <td>
- <%eur13%>
- </td>
-</tr>
-<tr>
- <td>
- Steuern, Versicherungen, Beiträge
- </td>
- <td>
- <%eur14%>
- </td>
-</tr>
-<tr>
- <td>
- Kfz-Steuern
- </td>
- <td>
- <%eur15%>
- </td>
-</tr><tr>
- <td>
- Kfz-Versicherungen
- </td>
- <td>
- <%eur16%>
- </td>
-</tr><tr>
- <td>
- Sonstige Fahrzeugkosten
- </td>
- <td>
- <%eur17%>
- </td>
-</tr><tr>
- <td>
- Werbe- und Reisekosten
- </td>
- <td>
- <%eur18%>
- </td>
-</tr><tr>
- <td>
- Instandhaltung und Werkzeuge
- </td>
- <td>
- <%eur19%>
- </td>
-</tr><tr>
- <td>
- Fachzeitschriften, Bücher
- </td>
- <td>
- <%eur20%>
- </td>
-</tr><tr>
- <td>
- Miete für Einrichtungen
- </td>
- <td>
- <%eur21%>
- </td>
-</tr><tr>
- <td>
- Rechts- und Beratungskosten
- </td>
- <td>
- <%eur22%>
- </td>
-</tr><tr>
- <td>
- Bürobedarf, Porto, Telefon
- </td>
- <td>
- <%eur23%>
- </td>
-</tr><tr>
- <td>
- Sonstige Aufwendungen
- </td>
- <td>
- <%eur24%>
- </td>
-</tr><tr>
- <td>
- Abschreibungen auf Anlagevermögen
- </td>
- <td>
- <%eur25%>
- </td>
-</tr><tr>
- <td>
- Abschreibungen auf GWG
- </td>
- <td>
- <%eur26%>
- </td>
-</tr><tr>
- <td>
- Vorsteuer
- </td>
- <td>
- <%eur27%>
- </td>
-</tr><tr>
- <td>
- Umsatzsteuerzahlungen
- </td>
- <td>
- <%eur28%>
- </td>
-</tr><tr>
- <td>
- Zinsaufwand
- </td>
- <td>
- <%eur29%>
- </td>
-</tr><tr>
- <td>
- Außerordentlicher Aufwand
- </td>
- <td>
- <%eur30%>
- </td>
-</tr><tr>
- <td>
- Betriebliche Steuern
- </td>
- <td>
- <%eur31%>
- </td>
-</tr>
-
-
-<tr>
- <td> </td>
- <td><hr noshade size=1></td>
-</tr>
-
-<tr valign=top>
- <th align=left><b>Summe Ausgaben</b></th>
- <td align=right><%sumeurb%> <br><hr noshade size=2</td>
-</tr>
-<tr>
- <td></td>
- <td><br><br></td>
-</tr>
-<tr valign=top>
- <td align=left>GEWINN / VERLUST</td>
- <td align=right><%guvsumme%><br><hr noshade size=2></td>
-</tr>
-
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telefon <%tel%>
- <br>Telefax <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>R E C H N U N G</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Ausgestellt am</th><td width=10> </td><td><%invdate%></td>
- </tr>
-
- <tr>
- <th align=right>Bezahlbar bis</th><td width=10> </td><td><%duedate%></td>
- </tr>
-
- <tr>
- <th align=right>Nummer</th><td> </td><td><%invnumber%></td></tr>
- </tr>
-
- <tr>
- <th align=right>Lieferdatum</th><td> </td><td><%deliverydate%></td></tr>
- </tr>
-<!--
- <tr>
- <th align=right>Clerk:</th><td> </td><td><%username%></td>
- </tr>
--->
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>An:</th>
- <th align=left><font color=ffffff>Lieferaddresse:</th>
- </tr>
-
-<!--
- other variables which can be use:
- contact, shiptocontact, shiptophone, shiptofax
--->
-
- <tr>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Nummer</th>
- <th align=left><font color=ffffff>Beschreibung</th>
- <th><font color=ffffff>Anz.</th>
- <th> </th>
- <th><font color=ffffff>Preis</th>
- <th><font color=ffffff>Rab</th>
- <th><font color=ffffff>Total</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
-<!--
-you can also use netprice instead of sellprice if you
-don't want to show the discount
-netprice = sellprice - discount
--->
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
-<%if taxincluded%>
- <tr>
- <th colspan=5 align=right>Total</th>
- <td colspan=2 align=right><%invtotal%></td>
- </tr>
-<%end taxincluded%>
-<%if not taxincluded%>
- <tr>
- <th colspan=5 align=right>Zwischensumme</th>
- <td colspan=2 align=right><%subtotal%></td>
- </tr>
-<%end taxincluded%>
-
-<%foreach tax%>
- <tr>
- <th colspan=5 align=right><%taxdescription%> auf <%taxbase%></th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
-<%if paid%>
- <tr>
- <th colspan=5 align=right>Bezahlt</th>
- <td colspan=2 align=right>- <%paid%></td>
- </tr>
-<%end paid%>
-
- <tr>
- <td colspan=3> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=3>Bezahlbar innerhalb von <b><%terms%></b> Tagen</td>
-<%if total%>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%total%></th>
-<%end total%>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Bemerkungen:</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- Alle Preise in <b><%currency%></b>
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
- Rechnung ist bezahlbar innerhalb von <%terms%> Tagen.
- Nach dem <%duedate%> werden Zinsen zu einem
- monatlichen Satz von 1.5% verrechnet.
- Waren bleiben im Besitz von <%company%> bis die Rechnung voll bezahlt ist.
- Rückgaben werden mit 10% Lagergebühren belastet. Beschädigte Waren
- und Waren ohne eine Rückgabenummer werden nicht entgegengenommen.
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=7 align=left><font size=-2><%taxdescription%> Registration <%taxnumber%></th>
- </tr>
-<%end tax%>
-
-<%if taxincluded%>
- <tr>
- <th colspan=7 align=left><font size=-2>Steuern sind im Preis inbegriffen.</th>
- </tr>
-<%end taxincluded%>
-
-<!-- business number
- <tr>
- <th colspan=7 align=left><font size=-2>Business Number: <%businessnumber%></font></th>
- </tr>
--->
-
- <tr>
- <th colspan=7 align=left>
- <hr>
- <br>Bankverbindung
- <br>Bank
- <br>Bankleitzahl
- <br>Konto No.
- </td>
- </tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage{ifthen}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\setlength{\parindent}{0cm}
-
-\pagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Rechnung}}} \vspace*{0.2cm}
- \rightline{\large\textbf{\textit{Nr. <%invnumber%>% \vspace*{0.2cm}
- }}}
-
- Rechnungsdatum:\hfill <%invdate%>
-
- Auftrag-Nr:\hfill <%ordnumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-Ihre Bestellung <%cusordnumber%> vom <%orddate%>
-% \hfill
-
-
-\vspace*{0.5cm}
-
-Sehr geehrte Damen und Herren,
-
-für unsere erbrachten Lieferungen und Leistungen erlauben wir uns,
-folgende Positionen in Rechnung zu stellen.
-
-\vspace{0.5cm}
-
-\begin{tabularx}{\textwidth}{lrXrr}
- \hline
- \textbf{Pos} & \textbf{Menge} & \textbf{Bezeichnung} &
- \textbf{E-Preis/\euro} & \textbf{G-Preis/\euro} \\
- \hline
- <%foreach number%>
- <%runningnumber%> & <%qty%> <%unit%> & \raggedright <%description%> &
- <%sellprice%> \euro & <%linetotal%> \euro \\
- <%if discount_sub%> & Zwischensumme: & & <%discount_sub%> \euro & <%end if%>\\
- <%end number%>\hline
- \multicolumn{4}{l}{Nettobetrag} & <%subtotal%> \euro \\
- <%foreach tax%>
- \multicolumn{4}{l}{<%taxdescription%>} & <%tax%> \euro \\
- <%end tax%>
- \multicolumn{4}{l}{\textbf{Endbetrag}} & \textbf{<%invtotal%> \euro} \\ \hline
-\end{tabularx}
-
-\vspace{1cm}
-\ifthenelse{\equal{<%deliverydate%>}{}}{Das Leistungsdatum entspricht, soweit nicht anders angegeben, dem Rechnungsdatum.}{Liefertermin: <%deliverydate%>} \\
-Zahlbar bis <%duedate%> in Summe <%invtotal%> \euro\ ohne Abzüge.
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
-
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>S A M M E L L I S T E</h4>
- </th>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% callspacing=0 cellpadding=0>
- <tr bgcolor=000000>
- <th width=50% align=left><font color=ffffff>Lieferanschrift:</th>
- <th width=50%> </th>
- </tr>
-
- <tr valign=top>
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
-
- <td>
- <%if shiptocontact%>
- <br>Kontakt: <%shiptocontact%>
- <%end shiptocontact%>
-
- <%if shiptophone%>
- <br>Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- <br>Fax: <%shiptofax%>
- <%end shiptofax%>
-
- <%shiptoemail%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height=5></tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left>BestellNr. #</th>
- <th width=17% align=left>Datum</th>
- <th width=17% align=left nowrap>Kontakt</th>
- <%if warehouse%>
- <th width=17% align=left>Lager</th>
- <%end warehouse%>
- <th width=17% align=left>Versandort</th>
- <th width=15% align=left>Transportmittel</th>
- </tr>
-
- <tr>
- <td><%ordnumber%> </td>
-
- <%if shippingdate%>
- <td><%shippingdate%></td>
- <%end shippingdate%>
-
- <%if not shippingdate%>
- <td><%orddate%></td>
- <%end shippingdate%>
-
- <td><%employee%> </td>
-
- <%if warehouse%>
- <td><%warehouse%> </td>
- <%end warehouse%>
-
- <td><%shippingpoint%> </td>
- <td><%shipvia%> </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>Pos</th>
- <th align=left><font color=ffffff>Nummer</th>
- <th align=left><font color=ffffff>Beschreibung</th>
- <th><font color=ffffff>Menge</th>
- <th><font color=ffffff>geliefert</th>
- <th> </th>
- <th><font color=ffffff>Lagerplatz</th>
- </tr>
-
- <%foreach number%>
- <tr valign=top>
- <td><%runningnumber%>
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td align=right>[ ]</td>
- <td><%unit%></td>
- <td align=right><%bin%></td>
- </tr>
- <%end number%>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
-
- <td><hr noshade></td>
- </tr>
-
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\usepackage{graphicx}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{9cm}
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{
- <%company%>
-
- <%address%>
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Tel & <%tel%>\\
- Fax & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
- \textbf{Lieferanschrift}
-} \hfill
-
-\vspace{0.7cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.5\textwidth}{
-
-<%shiptoname%> \\
-<%shiptostreet%> \\
-<%shiptozipcode%> \\
-<%shiptocity%> \\
-<%shiptocountry%>
-}
-\parbox[t]{.4\textwidth}{
- <%shiptocontact%>
-
- <%if shiptophone%>
- Tel: <%shiptophone%>
- <%end shiptophone%>
-
- <%if shiptofax%>
- Fax: <%shiptofax%>
- <%end shiptofax%>
-
- <%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{S A M M E L L I S T E}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{BestellNr. \#} & \textbf{Datum} & \textbf{Kontakt}
- <%if warehouse%>
- & \textbf{Lager}
- <%end warehouse%>
- & \textbf{Lagerplatz} & \textbf{Lieferung mit} \\ [0.5em]
- \hline
- <%ordnumber%>
- <%if shippingdate%>
- & <%shippingdate%>
- <%end shippingdate%>
- <%if not shippingdate%>
- & <%orddate%>
- <%end shippingdate%>
- & <%employee%>
- <%if warehouse%>
- & <%warehouse%>
- <%end warehouse%>
- & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}rlp{\descrwidth}@{\extracolsep\fill}rcll@{}}
- \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} &
- \textbf{Menge} & \textbf{Lagerausgang} & & \textbf{Lagerplatz} \\
-<%foreach number%>
- <%runningnumber%> & <%number%> & <%description%> &
- <%qty%> & [\hspace{1cm}] & <%unit%> & <%bin%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-}
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telefon <%tel%>
- <br>Telefax <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>B E S T E L L U N G</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Bestellungsdatum</th><td width=10> </td><td><%orddate%></td>
- </tr>
-
- <tr>
- <th align=right>Lieferbar bis</th><td width=10> </td><td><%reqdate%></td>
- </tr>
-
- <tr>
- <th align=right>Bestellnummer</th><td> </td><td><%ordnumber%></td></tr>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>An:</th>
- </tr>
-
- <tr>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Nummer</th>
- <th align=left><font color=ffffff>Artikel</th>
- <th><font color=ffffff>Anz</th>
- <th> </th>
- <th><font color=ffffff>Preis</th>
- <th><font color=ffffff>Total</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=6><hr noshade></td>
- </tr>
-
- <tr>
- <th colspan=4 align=right>Zwischensumme</th>
- <td colspan=2 align=right><%subtotal%></td>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=4 align=right><%taxdescription%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=2> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=2>Netto <b><%terms%></b> Tage</td>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%total%></th>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Bemerkungen</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- Alle Preise in <b><%currency%></b>
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
-
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\thispagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\setlength{\parindent}{0cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Bestellung}}}
- \rightline{\large\textbf{\textit{Nr. <%ordnumber%>%
- }}}
-
- Datum:\hfill <%orddate%>
-
- Kunden-Nr:\hfill <%customernumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-
-Hiermit bestellen wir verbindlich folgende Positionen:
-\vspace{0.5cm}
-
-\begin{tabularx}{\textwidth}{lrXrr}
- \hline
- \textbf{Pos} & \textbf{Menge} & \textbf{Bezeichnung} &
- \textbf{E-Preis/\euro} & \textbf{G-Preis/\euro} \\
- \hline
- <%foreach number%>
- <%runningnumber%> & <%qty%> <%unit%> & \raggedright <%description%> &
- <%sellprice%> \euro & <%linetotal%> \euro \\
- <%end number%> \hline
- \multicolumn{4}{l}{Nettobetrag} & <%subtotal%> \euro\\
- <%foreach tax%>
- \multicolumn{4}{l}{<%taxdescription%>} & <%tax%>\euro \\
- <%end tax%>
- \multicolumn{4}{l}{\textbf{Endbetrag}} & \textbf{<%ordtotal%> \euro} \\
-\end{tabularx}
-\hrule
-
-\end{document}
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.4cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.0cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-
-\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
-
-\parbox[t]{12cm}{
- <%company%>
-
- <%address%>}
-\hfill
-\parbox[t]{6cm}{\hfill <%source%>}
-
-\vspace*{0.6cm}
-
-<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
-
-\vspace{0.5cm}
-
-\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
-
-\vspace{0.5cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{2.8cm}
-
-<%company%>
-
-\vspace{0.5cm}
-
-<%name%> \hfill <%datepaid%> \hfill <%source%>
-
-\vspace{0.5cm}
-\begin{tabularx}{\textwidth}{lXrr@{}}
-\textbf{Rechnung} & \textbf{Ausgestellt}
- & \textbf{Fällig} & \textbf{Verrechnet} \\
-<%foreach invnumber%>
-<%invnumber%> & <%invdate%> \dotfill
- & <%due%> & <%paid%> \\
-<%end invnumber%>
-\end{tabularx}
-
-\vfill
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58>
- </td>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>A N F R A G E</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left width=50%><font color=ffffff>Rechnungsanschrift:</th>
- <th align=left width=50%><font color=ffffff>Lieferanschrift:</th>
- </tr>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
-<br>
-<%if contact%>
-<br>Kontakt: <%contact%>
-<%end contact%>
-<%if vendorphone%>
-<br>Tel: <%vendorphone%>
-<%end vendorphone%>
-<%if vendorfax%>
-<br>Fax: <%vendorfax%>
-<%end vendorfax%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
-<br>
-<%if shiptocontact%>
-<br>Kontakt: <%shiptocontact%>
-<%end shiptocontact%>
-<%if shiptophone%>
-<br>Tel: <%shiptophone%>
-<%end shiptophone%>
-<%if shiptofax%>
-<br>Fax: <%shiptofax%>
-<%end shiptofax%>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr><td> </td></tr>
-
- <tr>
- <td colspan=2>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left>AnfrageNr. #</th>
- <th width=17% align=left>Datum</th>
- <th width=17% align=left>Erforderlich am</th>
- <th width=17% align=left>Kontakt</th>
- <th width=17% align=left>Lagerplatz</th>
- <th width=15% align=left>Versand mit:</th>
- </tr>
-
- <tr>
- <td><%quonumber%></td>
- <td><%quodate%></td>
- <td><%reqdate%></td>
- <td><%employee%></td>
- <td><%shippingpoint%></td>
- <td><%shipvia%></td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr height="10"></tr>
-
- <tr>
- <td>Bitte teilen Sie uns Preise und Lieferzeit für folgende Artikel mit:</td>
- </tr>
-
- <tr height="10"></tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr>
-<!-- <th align=right>No.</th> -->
- <th align=left>ArtNr.</th>
- <th align=left>Beschreibung</th>
- <th>Menge</th>
- <th> </th>
- <th>Lieferung</th>
- <th>Stückpreis</th>
- <th>Gesamtpreis</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-other per line item variables available <%reqdate%>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
-
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
-<%if notes%>
- <tr valign=top>
- <td>Bemerkungen</td>
- <td><%notes%></td>
- </tr>
-<%end notes%>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td width=70%> </td>
-
- <td width=30%>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage{graphicx}
-\usepackage{german}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.7cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{12cm}
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\pagestyle{myheadings}
-\thispagestyle{empty}
-
-\vspace*{-1.3cm}
-
-\parbox{\textwidth}{
- \parbox[b]{.42\textwidth}{
- <%company%>
-
- <%address%>
- }\hfill
- \begin{tabular}[b]{rr@{}}
- Tel & <%tel%>\\
- Fax & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
-}
-
-
-\vspace*{0.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{.45\textwidth}{
-\textbf{To}
-\vspace{0.7cm}
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-\vspace{0.3cm}
-
-<%if contact%>
-<%contact%>
-<%end contact%>
-
-\vspace{0.2cm}
-
-<%if vendorphone%>
-Tel: <%vendorphone%>
-<%end vendorphone%>
-
-<%if vendorfax%>
-Fax: <%vendorfax%>
-<%end vendorfax%>
-
-<%email%>
-}
-\parbox[t]{.45\textwidth}{
-\textbf{Lieferanschrift}
-\vspace{0.7cm}
-
-<%shiptoname%>
-
-<%shiptostreet%>
-
-<%shiptozipcode%>
-
-<%shiptocity%>
-
-<%shiptocountry%>
-
-\vspace{0.3cm}
-
-<%if shiptocontact%>
-<%shiptocontact%>
-<%end shiptocontact%>
-
-<%if shiptophone%>
-Tel: <%shiptophone%>
-<%end shiptophone%>
-
-<%if shiptofax%>
-Fax: <%shiptofax%>
-<%end shiptofax%>
-
-<%shiptoemail%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{A N F R A G E}
-\hfill
-
-\vspace{1cm}
-
-\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
- \textbf{AnfrageNr. \#} & \textbf{Datum} & \textbf{Benötigt am} & \textbf{Kontakt} & \textbf{Lagerplatz} & \textbf{Lieferung mit} \\ [0.5ex]
- \hline
- <%quonumber%> & <%quodate%> & <%reqdate%> & <%employee%> & <%shippingpoint%> & <%shipvia%> \\
- \hline
-\end{tabularx}
-
-\vspace{1cm}
-
-Bitte nennen Sie uns für folgende Artikel Preis und Liefertermin:
-
-\vspace{1cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rl}
- \textbf{Nummer} & \textbf{Beschreibung} & \textbf{Menge} & \\
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> & <%unit%> \\
-<%end number%>
-\end{tabular*}
-
-
-\parbox{\textwidth}{
-\rule{\textwidth}{2pt}
-
-\hfill
-
-<%if notes%>
- <%notes%>
-<%end if%>
-
-}
-
-\end{document}
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage{ifthen}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\setlength{\parindent}{0cm}
-
-\pagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Lieferschein}}} \vspace*{0.2cm}
- \rightline{\large\textbf{\textit{Nr. <%donumber%>% \vspace*{0.2cm}
- }}}
-
- Lieferscheindatum:\hfill <%dodate%>
-
- Kunden-Nr:\hfill <%customernumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rl@{}}
- \textbf{Nummer} & \textbf{Artikel} & \textbf{Anz} & \textbf{Einh} \\
-
-<%foreach number%>
- <%number%> & <%description%> & <%qty%> & <%unit%> \\
- & <%serialnumber%> & & \\
-<%end number%>
-\end{tabular*}
-
-\vspace{1cm}
-<%if deliverydate%>
- Die Auslieferung/Fertigstellung erfolgte am : <%deliverydate%>
-<%end if%>
-<%if notes%>
- <%notes%>
-<%end if%>
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <td align=right>
- <h4>
- Telefon <%tel%>
- <br>Telefax <%fax%>
- </h4>
- </td>
- </tr>
-
- <tr>
- <th colspan=3>
- <h4>B E S T E L L U N G</h4>
- </th>
- </tr>
-
- </table>
-
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td align=right>
- <table>
- <tr>
- <th align=right>Bestelldatum</th><td width=10> </td><td><%orddate%></td>
- </tr>
-
- <tr>
- <th align=right>Lieferbar bei</th><td width=10> </td><td><%reqdate%></td>
- </tr>
-
- <tr>
- <th align=right>Bestellnummer</th><td> </td><td><%ordnumber%></td></tr>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
- </td>
- </table>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=left><font color=ffffff>Verrechnet An:</th>
- <th align=left><font color=ffffff>Lieferaddresse:</th>
- </tr>
-
- <tr>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- </td>
-
- <td><%shiptoname%>
- <br><%shiptostreet%>
- <br><%shiptozipcode%>
- <br><%shiptocity%>
- <br><%shiptocountry%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
-<!-- <th align=right><font color=ffffff>No.</th> -->
- <th align=left><font color=ffffff>Nummer</th>
- <th align=left><font color=ffffff>Artikel</th>
- <th><font color=ffffff>Anz</th>
- <th> </th>
- <th><font color=ffffff>Preis</th>
- <th><font color=ffffff>Rab</th>
- <th><font color=ffffff>Total</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
-<!-- <td align=right><%runningnumber%>.</td>
-adjust the colspan if you include this to shift subtotal one to the right
--->
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=7><hr noshade></td>
- </tr>
-
-<%if taxincluded%>
- <tr>
- <th colspan=5 align=right>Total</th>
- <td colspan=2 align=right><%ordtotal%></td>
- </tr>
-<%end taxincluded%>
-
-<%if not taxincluded%>
- <tr>
- <th colspan=5 align=right>Zwischensumme</th>
- <td colspan=2 align=right><%subtotal%></td>
- </tr>
-<%end taxincluded%>
-
-<%foreach tax%>
- <tr>
- <th colspan=5 align=right><%taxdescription%> auf <%taxbase%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=2> </td>
- <td colspan=5><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=3>Netto <b><%terms%></b> Tage</td>
- <th colspan=2 align=right>Total</th>
- <th colspan=2 align=right><%ordtotal%></th>
- </tr>
-<%if taxincluded%>
- <tr>
- <td colspan=3>Steuern sind im Preis inbegriffen</td>
- </tr>
-<%end taxincluded%>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Bemerkungen</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- Alle Preise in <b><%currency%></b>
- <br><%shippingpoint%>
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><font size=-3>
- Spezialprodukte werden nicht zurückgenommen. Für alle anderen Waren
- wird eine 10% Stornogebühr verrechnet.
- </font>
- </td>
- <td width=150>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\thispagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\setlength{\parindent}{0cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Auftragsbestätigung}}} \vspace*{0.2cm}
- \rightline{\large\textbf{\textit{Nr. <%ordnumber%>%
- }}} \vspace*{0.2cm}
-
- Datum:\hfill <%orddate%>
-
- Kunden-Nr:\hfill <%customernumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-\hfill
-
-\vspace{0.5cm}
-
-\begin{tabularx}{\textwidth}{lrXrr}
- \hline
- \textbf{Pos} & \textbf{Menge} & \textbf{Bezeichnung} &
- \textbf{E-Preis/\euro} & \textbf{G-Preis/\euro} \\
- \hline
- <%foreach number%>
- <%runningnumber%> & <%qty%> <%unit%> & \raggedright <%description%> &
- <%sellprice%> \euro & <%linetotal%> \euro \\
- <%end number%> \hline
- \multicolumn{4}{l}{Nettobetrag} & <%subtotal%> \euro\\
- <%foreach tax%>
- \multicolumn{4}{l}{<%taxdescription%>} & <%tax%>\euro \\
- <%end tax%>
- \multicolumn{4}{l}{\textbf{Endbetrag}} & \textbf{<%ordtotal%> \euro} \\
-\end{tabularx}
-\hrule
-
-\vspace{1cm}
-Vereinbarter Liefertermin: <%reqdate%> \\ \\
-\textit{Bitte kontrollieren Sie alle Positionen auf Übereinstimmung
- mit Ihrer Bestellung! Abweichungen teilen Sie innerhalb von 3 Tagen
- mit!} \\ \\
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
-<tr valign=bottom>
- <td width=10> </td>
- <td>
-
- <table width=100%>
- <tr valign=top>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
-
- <th><img src=http://localhost/lx-erp/lx-office-erp.png border=0 width=64 height=58></th>
-
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
-
-<tr><td colspan=3> </td></tr>
-
- <tr>
- <th colspan=3>
- <h4>A N G E B O T</h4>
- </th>
- </tr>
-
- </table>
-
- <table width=100% callspacing=0 cellpadding=0>
-
- <tr>
- <td>
- <table width=100%>
-
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
-<br>
-<%if contact%>
-<br>Kontakt: <%contact%>
-<%end contact%>
-
-<%if customerphone%>
-<br>Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-<br>Fax: <%customerfax%>
-<%end customerfax%>
-
-<%if email%>
-<br><%email%>
-<%end email%>
- </td>
-
- </tr>
- </table>
- </td>
- </tr>
-
- <tr><td> </td></tr>
-
- <tr>
- <td colspan=2>
- <table width=100% border=1>
- <tr>
- <th width=17% align=left nowrap>Nummer</th>
- <th width=17% align=left>Datum</th>
- <th width=17% align=left>Gültig bis</th>
- <th width=17% align=left nowrap>Kontakt</th>
- <th width=17% align=left nowrap>Lagerplatz</th>
- <th width=15% align=left nowrap>Lieferung mit</th>
- </tr>
-
- <tr>
- <td><%quonumber%></td>
- <td><%quodate%></td>
- <td><%reqdate%></td>
- <td><%employee%></td>
- <td><%shippingpoint%></td>
- <td><%shipvia%></td>
- </tr>
- </table>
- </td>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- <tr>
- <td>
- <table width=100%>
- <tr bgcolor=000000>
- <th align=right><font color=ffffff>Nr.</th>
- <th align=left><font color=ffffff>Artikelnummer</th>
- <th align=left><font color=ffffff>Beschreibung</th>
- <th><font color=ffffff>Menge</th>
- <th> </th>
- <th><font color=ffffff>Preis</th>
- <th><font color=ffffff>Rabatt</th>
- <th><font color=ffffff>Gesamtpreis</th>
- </tr>
-
-<%foreach number%>
- <tr valign=top>
- <td align=right><%runningnumber%></td>
-
- <td><%number%></td>
- <td><%description%></td>
- <td align=right><%qty%></td>
- <td><%unit%></td>
- <td align=right><%sellprice%></td>
- <td align=right><%discount%></td>
- <td align=right><%linetotal%></td>
- </tr>
-<%end number%>
-
- <tr>
- <td colspan=8><hr noshade></td>
- </tr>
-
- <tr>
-<%if taxincluded%>
- <th colspan=6 align=right>Gesamtbetrag netto</th>
- <td colspan=2 align=right><%invtotal%></td>
-<%end taxincluded%>
-
-<%if not taxincluded%>
- <th colspan=6 align=right>Zwischensumme</th>
- <td colspan=2 align=right><%subtotal%></td>
-<%end taxincluded%>
- </tr>
-
-<%foreach tax%>
- <tr>
- <th colspan=6 align=right><%taxdescription%> von <%taxbase%> @ <%taxrate%> %</th>
- <td colspan=2 align=right><%tax%></td>
- </tr>
-<%end tax%>
-
- <tr>
- <td colspan=4> </td>
- <td colspan=4><hr noshade></td>
- </tr>
-
- <tr>
- <td colspan=4>
-<%if terms%>
- Zahlungsziel <b><%terms%></b> Tage
-<%end terms%>
- </td>
- <th colspan=2 align=right>Gesamtbetrag brutto</th>
- <th colspan=2 align=right><%quototal%></th>
- </tr>
-
- <tr>
- <td> </td>
- </tr>
-
- </table>
- </td>
- </tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
-<%if notes%>
- <td>Bemerkungen</td>
- <td><%notes%></td>
-<%end notes%>
- <td align=right>
- Alle Preise in <b><%currency%></b> Euro
- </td>
- </tr>
-
- </table>
- </td>
-</tr>
-
-<tr><td> </td></tr>
-
-<tr>
- <td>
- <table width=100%>
- <tr valign=top>
- <td width=60%><font size=-3>
- Spezialanfertigungen können nicht zurückgenommen werden.
- </font>
- </td>
- <td width=40%>
- X <hr noshade>
- </td>
- </tr>
- </table>
- </td>
-</tr>
-
-</table>
-
-</td>
-</tr>
-</table>
-
-</body>
-</html>
-
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage{eurosym}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\begin{document}
-
-\thispagestyle{empty}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{10cm}
-\setlength{\parindent}{0cm}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\begin{minipage}{8cm}
- <%name%>
-
- <%street%>
-
- <%zipcode%> <%city%>
-
- <%country%>
-\end{minipage}
-\hfill
-\begin{minipage}{6cm}
- \rightline{\LARGE\textbf{\textit{Angebot}}}
- \rightline{\large\textbf{\textit{Nr. <%quonumber%>%
- }}}
-
- Datum:\hfill <%transdate%>
-
- Kunden-Nr:\hfill <%customernumber%>
-
- Telefon:\hfill <%phone%>
-
- Telefax:\hfill <%fax%>
-
- Ansprechpartner:\hfill <%employee%>
-\end{minipage}
-
-\vspace*{0.5cm}
-
-\hfill
-
-\vspace{0.5cm}
-
-\begin{tabularx}{\textwidth}{lrXrr}
- \hline
- \textbf{Pos} & \textbf{Menge} & \textbf{Bezeichnung} &
- \textbf{E-Preis/\euro} & \textbf{G-Preis/\euro} \\
- \hline
- <%foreach number%>
- <%runningnumber%> & <%qty%> <%unit%> & \raggedright <%description%> &
- <%sellprice%> \euro & <%linetotal%> \euro \\
- <%end number%> \hline
- \multicolumn{4}{l}{Nettobetrag} & <%subtotal%> \euro \\
- <%foreach tax%>
- \multicolumn{4}{l}{<%taxdescription%>} & <%tax%> \euro \\
- <%end tax%>
- \multicolumn{4}{l}{\textbf{Endbetrag}} & \textbf{<%ordtotal%> \euro }
-\end{tabularx}
-\hrule
-
-\vspace{0.2cm}
-
-Wir danken für Ihre Anfrage und hoffen, Ihnen hiermit ein interessantes Angebot gemacht zu haben. Das Angebot ist
- gültig bis zum <%reqdate%>. Sollten Sie noch Fragen oder Änderungswünsche haben, können Sie uns gerne jederzeit
- unter den oben genannten Telefonnummern oder eMail-Adressen kontaktieren. \\
- Bei der Durchführung des Auftrags gelten unsere AGB, die wir Ihnen gerne zuschicken. \\ \\
- Mit freundlichen Grüßen, \\ \\ \\
- <%employee_name%>
-
-
-
-\end{document}
-
+++ /dev/null
-
-<body bgcolor=ffffff>
-
-<table width=100%>
- <tr>
- <td width=10> </td>
- <td>
- <table width=100%>
- <tr>
- <td>
- <h4>
- <%company%>
- <br><%address%>
- </h4>
- </td>
- <th></th>
- <td align=right>
- <h4>
- Tel: <%tel%>
- <br>Fax: <%fax%>
- </h4>
- </td>
- </tr>
- <tr>
- <th colspan=3><h4>S T A T E M E N T</h4></th>
- </tr>
- <tr>
- <td colspan=3 align=right><%statementdate%></td>
- </tr>
- </table>
- </td>
- </tr>
- <tr>
- <td> </td>
- <td>
- <table width=100%>
- <tr valign=top>
- <td><%name%>
- <br><%street%>
- <br><%zipcode%>
- <br><%city%>
- <br><%country%>
- <br>
-<%if customerphone%>
- <br>Tel: <%customerphone%>
-<%end customerphone%>
-<%if customerfax%>
- <br>Fax: <%customerfax%>
-<%end customerfax%>
-<%if email%>
- <br><%email%>
-<%end email%>
- </td>
- </tr>
- </table>
- </td>
- </tr>
- <tr height=10></tr>
- <tr>
- <td> </td>
- <td>
- <table width=100%>
- <tr>
- <th align=left>Invoice #</th>
- <th width=15%>Date</th>
- <th width=15%>Due</th>
- <th width=10%>Current</th>
- <th width=10%>30</th>
- <th width=10%>60</th>
- <th width=10%>90+</th>
- </tr>
-<%foreach invnumber%>
- <tr>
- <td><%invnumber%></td>
- <td><%invdate%></td>
- <td><%duedate%></td>
- <td align=right><%c0%></td>
- <td align=right><%c30%></td>
- <td align=right><%c60%></td>
- <td align=right><%c90%></td>
- </tr>
-<%end invnumber%>
- <tr>
- <td colspan=7><hr size=1></td>
- </tr>
- <tr>
- <td> </td>
- <td> </td>
- <td> </td>
- <th align=right><%c0total%></td>
- <th align=right><%c30total%></td>
- <th align=right><%c60total%></td>
- <th align=right><%c90total%></td>
- </tr>
- </table>
- </td>
- </tr>
- <tr height=10></tr>
- <tr>
- <td> </td>
- <td align=right>
- <table width=50%>
- <tr>
- <th>Total Outstanding</th>
- <th align=right><%total%></th>
- </tr>
- </table>
- </td>
- </tr>
- <tr>
- <td> </td>
- <td><hr noshade></td>
- </tr>
- <tr>
- <td> </td>
- <td>Please make check payable to <b><%company%></b>.
- </td>
- </tr>
- <tr height=20></tr>
-</table>
-
+++ /dev/null
-\documentclass[twoside]{scrartcl}
-\usepackage[frame]{xy}
-\usepackage{tabularx}
-\usepackage[utf8]{inputenc}
-\setlength{\voffset}{0.5cm}
-\setlength{\hoffset}{-2.0cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{1.0cm}
-\setlength{\evensidemargin}{1.0cm}
-\setlength{\textwidth}{17cm}
-\setlength{\textheight}{24.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\renewcommand{\baselinestretch}{1}
-\begin{document}
-
-\newlength{\descrwidth}\setlength{\descrwidth}{9cm}
-
-\newsavebox{\hdr}
-\sbox{\hdr}{
- \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
- \parbox{\textwidth}{
- \parbox[b]{12cm}{
- <%company%>
-
- <%address%>}\hfill
- \begin{tabular}[b]{rrr@{}}
- Tel & <%tel%>\\
- Fax & <%fax%>
- \end{tabular}
-
- \rule[1.5ex]{\textwidth}{0.5pt}
- }
-}
-
-\fontfamily{cmss}\fontshape{n}\selectfont
-
-\markboth{<%company%>\hfill <%statementdate%>}{\usebox{\hdr}}
-
-\pagestyle{myheadings}
-%\thispagestyle{empty} use this with letterhead paper
-
-\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
-
-\vspace*{1.5cm}
-
-\parbox[t]{1cm}{\hfill}
-\parbox[t]{10.5cm}{
-
-<%name%>
-
-<%street%>
-
-<%zipcode%>
-
-<%city%>
-
-<%country%>
-
-}
-\parbox[t]{7.5cm}{
-<%if customerphone%>
-Tel: <%customerphone%>
-<%end customerphone%>
-
-<%if customerfax%>
-Fax: <%customerfax%>
-<%end customerfax%>
-
-<%email%>
-}
-\hfill
-
-\vspace{1cm}
-
-\textbf{S T A T E M E N T} \hfill
-
-\hfill <%statementdate%>
-
-\vspace{2cm}
-
-\begin{tabular*}{\textwidth}{@{}l@{\extracolsep\fill}ccrrrr@{}}
- \textbf{Invoice \#} & \textbf{Date} & \textbf{Due} &
- \textbf{Current} & \textbf{30} & \textbf{60} & \textbf{90+} \\
-<%foreach invnumber%>
- <%invnumber%> & <%invdate%> & <%duedate%> &
- <%c0%> & <%c30%> & <%c60%> & <%c90%> \\
-<%end invnumber%>
-\textbf{Subtotal} & & & <%c0total%> & <%c30total%> & <%c60total%> & <%c90total%>
-\end{tabular*}
-\rule{\textwidth}{1pt}
-
-\vspace{1cm}
-
-\hfill
-\begin{tabularx}{7cm}{Xr@{}}
- \textbf{Total outstanding} & <%total%>
-\end{tabularx}
-
-\vfill
-
-Please make check payable to <%company%>
-
-\renewcommand{\thefootnote}{\fnsymbol{footnote}}
-
-\footnotetext[1]{\tiny
-}
-
-\end{document}
-
+++ /dev/null
-;; This file was produced by lx-office
-;; for using in taxbird.
-;; You probably don't want to touch this
-;; file. In case you do want it anyway,
-;; be warned: BE CAREFUL!!
-;;
-'("Umsatzsteuervoranmeldung <%year%>" (
-("vend-id" . "74931")
-("land-lieferant" . "<%elsterland%>")
-("name-lieferant" . "<%company%>")
-("berufsbez" . "")
-("strasse-lieferant" . "<%co_street%>")
-("plz-lieferant" . "<%co_zip%> ")
-("ort-lieferant" . "<%co_city%>")
-("vorwahl" . "<%co_phone_prefix%>")
-("anschluss" . "<%co_phone%>")
-("land" . "<%taxbird_land_nr%>")
-("zeitraum" . "<%taxbird_period%>")
-("stnr" . "<%taxbird_steuernummer%>")
-
-<%foreach id%>
-("<%id%>" . "<%amount%>")<%end%>
-))
\ No newline at end of file
+++ /dev/null
-% German USTVA template for taxreports
-% Contributed by Marcus Habermehl
-% Based on template by Jacky und Stefan Tenne (German-ustva-2008.tex)
-%
-%
-\documentclass[twoside]{scrartcl}
-\usepackage{a4,german}
-\usepackage[frame]{xy}
-\usepackage[utf8]{inputenc}
-\usepackage[german]{babel}
-\usepackage{graphicx}
-\usepackage{tabularx}
-\usepackage{times, german}
-\usepackage{german}
-\setlength{\voffset}{-0.7cm} %hier wird die Höhenverschiebung
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0cm}
-\setlength{\headsep}{0cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{0cm}
-\setlength{\evensidemargin}{0cm}
-\setlength{\textwidth}{20.9cm}
-\setlength{\textheight}{29.6cm}
-\setlength{\footskip}{-0cm}
-\setlength{\parindent}{1mm}
-
-\begin{document}
-
-\fontfamily{cmss}\fontshape{n}\large\selectfont
-\pagestyle{myheadings}
-\markboth{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 54 783 700 790,page=2]{ustva-2012.pdf}}}%Seite 2
-{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 70 700 700 790,page=1]{ustva-2012.pdf}}}%Seite 1
-\hspace{1mm}
-\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{7mm}p{28mm}p{3mm}}
-\multicolumn{7}{c}{}\\[-2mm]
- & \multicolumn{6}{l}{<%steuernummer%>}\\
-\multicolumn{7}{c}{}\\[15mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
-\multicolumn{2}{p{7.5cm}}{} & & & & &\\[3mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[3mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%co_street%>}}& & & & &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%co_city%>}}& & & &<%FA_10%> &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{
-<%if tel%>
-\small{Tel: <%tel%>}~--~
-<%else%>
-\small{~}
-<%end tel%>
-<%if fax%>
-\small{Fax: <%fax%>}
-<%else%>
-\small{~}
-<%end fax%>
-}& & & & &\\[1.8mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}&~& & & &\\[-1mm]
-\end{tabular}\\[2.5mm]
-\begin{tabular}[b]{p{99mm}p{26.5mm}p{4.55mm}p{4mm}p{35mm}}
-&&&&\\[9.5mm]
-\multicolumn{2}{r}{<%41%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%44%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%49%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%43%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%48%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%81%>} & & \multicolumn{2}{r}{<%811%>}\\[1.8mm]
-\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%861%>}\\[1.8mm]
-\multicolumn{2}{r}{<%35%>} & & \multicolumn{2}{r}{<%36%>}\\[1.8mm]
-\multicolumn{2}{r}{<%77%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%76%>} & & \multicolumn{2}{r}{<%80%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%91%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%89%>} & & \multicolumn{2}{r}{<%891%>}\\[1.8mm]
-\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%931%>}\\[1.8mm]
-\multicolumn{2}{r}{<%95%>} & & \multicolumn{2}{r}{<%98%>}\\[1.8mm]
-\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%42%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%60%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%21%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{<%45%>} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z43%>}\\
-\end{tabular}
-\newpage
-
-\vspace*{-9.5mm}\hspace{27mm}<%steuernummer%>\\[-2.7mm]
-\begin{tabular}[b]{p{99mm}p{25.2mm}p{2.55mm}p{10mm}p{32mm}}
-&&&&\\
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z45%>}\\[13.5mm]
-\multicolumn{2}{r}{<%46%>} & & \multicolumn{2}{r}{<%47%>}\\[1.8mm]
-\multicolumn{2}{r}{<%52%>} & & \multicolumn{2}{r}{<%53%>}\\[1.8mm]
-\multicolumn{2}{r}{<%73%>} & & \multicolumn{2}{r}{<%74%>}\\[1.8mm]
-\multicolumn{2}{r}{<%84%>} & & \multicolumn{2}{r}{<%85%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%65%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z53%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%61%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%67%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%63%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%64%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%59%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z62%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%69%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%39%>}\\[1.8mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%83%>}}\\[25.6mm]
-\end{tabular}\\[35mm]
-<%if FA_steuerberater%>
-\vspace{11mm}
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item <%FA_steuerberater_name%>
-\item <%FA_steuerberater_street%>
-\item <%FA_steuerberater_city%>
-\item Tel:~<%FA_steuerberater_tel%>
-\end{small}\\[15mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-<%if not FA_steuerberater%>
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item ~
-\item ~
-\item ~
-\item ~
-\end{small}\\[26mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-\end{document}
+++ /dev/null
-<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN">
-<html>
-<head>
- <meta content="text/html; charset=utf-8" http-equiv="content-type">
- <title>Vorschau: UStVa</title>
-<!--
-Optik an Formulare angepasst: Hartmut Goebel <h.goebel@goebel-consult.de>
-Variablen hinzugefügt: Udo Spallek <udono@gmx.net>
-Text-Erklärung und unterschiedliche Zeilenfärbung ergänzt: Kai-Martin Knaak <kmk@familieknaak.de>
--->
- <style>
-table {
- text-align: right;
- border:0;
- border-collapse:collapse;
-}
-td {
- font-size:100%;
- vertical-align:top;
-}
-td.text {
- text-align: left;
- background-color:#BDBEBD;
-}
-td.text2 {
- text-align: left;
- background-color:#ADBEBD;
-}
-td.spalte,
-td.zeile,
-td.betrag {
- border:solid thin black;
-}
-td.spalte { font-weight:bold; font-size:120%; }
-td.zeile { font-weight:bold; }
-td.betrag { width:10em; }
-td.summe { border:solid medium black; }
-td.spacer { border:0 }
-
-tr.uebertrag td { border-top:solid medium black; }
-b.h3 { font-size:120%; }
-.ausfuellen { background-color:#FFFFC0; }
-.nodis { display:none; }
- </style>
-</head>
-<body>
-<h1>Vorschau Umsatzsteuer-Voranmeldung</h1>
-<h2>Zeitraum vom <%fromdate%> bis <%todate%> </h2>
-
-<!-- Diese HTML-Formular ist nicht selbstrechnend.
-<p><small>Wenn ein (selbstrechnendes) Formular verwendet wird, genügt es, die
-gelb hinterlegten Felder auszufüllen. Die anderen Felder werden dann
-automatisch berechnet.</small></p>
--->
-
-<table width="100%">
-<tr align="left">
- <td class="text">Steuernummer: <%steuernummer%></td>
- <td class="text" width="100px"> </td>
- <td class="text" align="right">Datum (<%Datum_heute%>)</td>
-</tr>
-<tr>
- <td class="text" colspan="3"><br /></td>
-</tr>
-<tr align="left">
- <td class="text">
- Finanzamt <%FA_Name%><br />
- <%FA_Strasse%><br />
- <%FA_PLZ%> <%FA_Ort%><br />
- Fax: <%FA_FAX%>
- </td>
- <td class="text"> </td>
- <td class="text">
- Firma <%company%><br />
- <%if company_street%>
- <%company_street%><br />
- <%company_city%><br />
- <%end company_street%>
- <%if not company_street%>
- <%address%><!--used Address-->
- <%end company_street%>
- </td>
-</tr>
-<tr>
- <td class="text" colspan="3"><br />
- </td>
-</tr>
-</table>
-<table border="0" cellspacing="2" cellpadding="2">
- <tbody>
- <tr>
- <td class="text"><b class="h3">I. Anmeldung der
-Umsatzsteuer-Vorauszahlung </b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text"><b class="h4">Lieferungen und sonstige Leistungen</b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text2">an innergemeinschaftliche Abnehmer <b>mit</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>41<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%41%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text">neuer Fahrzeuge an Abnehmer <b>ohne</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>44<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%44%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">neuer Fahrzeuge außerhalb eines Unternehmens</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>49<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%49%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text">Weitere steuerfreie Umsätze mit Vorsteuerabzug</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>43<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%43%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Steuerfreie Umsätze ohne
-Vorsteuerabzug. </b><br />Umsätze nach § 4 Nr. 8 bis 20 UStG</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>48<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%48%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-
- <tr>
- <td class="text"><b class="h4">Steuerpflichtige Umsätze</b></td>
- <td colspan="4"></td>
- </tr>
-<%if not year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 16 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>51<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%51%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 51 rechts)</span></td>
- <td class="betrag"><%511%></td>
- </tr>
-<%end year2007%>
-<%if year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 19 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>81<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%81%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 81 rechts)</span></td>
- <td class="betrag"><%811%></td>
- </tr>
-<%end year2007%>
-
- <tr>
- <td class="text">zum Steuersatz von 7 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>86<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%86%></td>
- <td class="spalte"><span class="nodis">(Spalte 86 rechts)</span></td>
- <td class="betrag"><%861%></td>
- </tr>
- <tr>
- <td class="text2">andere Steuersätze</td>
- <td class="spalte ausfuellen"><span class="nodis"></span>35 <span class="nodis"></span></td>
- <td class="betrag ausfuellen"><%35%></td>
- <td class="spalte">36</td>
- <td class="betrag ausfuellen"><%36%></td>
- </tr>
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
- <tr>
- <td class="text">Lieferungen in das übrige Gemeinschaftsgebiet <b>mit</b> USt-IdNr</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>77<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%77%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Umsätze, nach §24 UStG (Sägewerkserzeugnisse, alkoholische Getränke etc.)</td>
- <td class="spalte ausfuellen"><span class="nodis"></span>76 <span class="nodis"></span></td>
- <td class="betrag ausfuellen"><%76%></td>
- <td class="spalte">80</td>
- <td class="betrag ausfuellen"><%80%></td>
- </tr>
- <tr><td class="text"> </td><td class="spacer" colspan="4"></td></tr>
- <tr>
- <td class="text"><b class="h3">Innergemeinschaftliche Erwerbe</b></td>
- <td colspan="4"></td>
- </tr>
- <tr>
- <td class="text2">Steuerfrei nach §4b UStG</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>91<span class="nodis">)</span></td>
- <td class="betrag ausfuellen" width="70"><%91%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%if not year2007%>
- <tr>
- <td class="text">Steuerpflichtige zum Steuersatz von 16 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>97<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%97%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 97 rechts)</span></td>
- <td class="betrag"><%971%></td>
- </tr>
-<%end if year2007%>
-<%if year2007%>
- <tr>
- <td class="text">Steuerpflichtige zum Steuersatz von 19 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>89<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%89%><br></td>
- <td class="spalte"><span class="nodis">(Spalte 89 rechts)</span></td>
- <td class="betrag"><%891%></td>
- </tr>
-<%end if year2007%>
- <tr>
- <td class="text2">zum Steuersatz von 7 v.H.</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>93<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%93%></td>
- <td class="spalte"><span class="nodis">(Spalte 93 rechts)</span></td>
- <td class="betrag"><%931%></td>
- </tr>
- <tr>
- <td class="text">zu anderen Steuersätzen</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>95<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%95%></td>
- <td class="spalte">98</td>
- <td class="betrag"><%98%></td>
- </tr>
- <tr>
- <td class="text2"><b class="h4">neuer Fahrzeuge von Lieferern</b>
- von Lieferanten <b>ohne</b> USt.IdNr. <br class="nodis" />
- zum allgemeinen Steuersatz</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>94<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%94%></td>
- <td class="spalte"><span class="nodis">(Spalte </span>96<span class="nodis">)</span></td>
- <td class="betrag"><%96%></td>
- </tr>
- <tr><td class="text"> </td><td colspan="4"></td></tr>
- <tr>
- <td class="text">Lieferungen des ersten Abnehmers bei
- innergemeinschaftlichen Dreiecksgeschften (§25b Abs. 2 UStG)</td>
- <td class="spalte ausfuellen">42</td>
- <td class="betrag ausfuellen" width="70"><%42%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
- <tr>
- <td class="text2">Steuerpflichtige Umstze im Sinne, für die der
- <b>Leistungsempfänger die Steuer schuldet</b></td>
- <td class="spalte ausfuellen">60</td>
- <td class="betrag ausfuellen" width="70"><%60%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%if year2010%>
- <tr>
- <td class="text2"><b>Nicht steuerbare Leistungen</b> gem. § 18b Satz 1 Nr. 2 UStG</td>
- <td class="spalte ausfuellen">21</td>
- <td class="betrag ausfuellen" width="70"><%21%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-<%end if year2010%>
- <tr>
- <td class="text">Im Inland nicht steuerbare Umsätze</td>
- <td class="spalte ausfuellen">45</td>
- <td class="betrag ausfuellen" width="70"><%45%><br></td>
- <td class="spalte"><span class="nodis"></span></td>
- <td class="betrag"></td>
- </tr>
-
- <tr><td class="text"> </td><td class="spacer" colspan="2"></td><td colspan="2"></td></tr>
-
- <tr>
- <td class="text" colspan="3"><b class="h3">Übertrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 43<span class="nodis">)</span></td>
- <td class="betrag"><%Z43%></td>
- </tr>
-
- <tr class="uebertrag">
- <td class="text" colspan="3"><b class="h3">Übertrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 45<span class="nodis">)</span></td>
- <td class="betrag"><%Z45%></td>
- </tr>
-
-<%if year2010%>
- <tr>
- <td class="text2">Im Inland steuerpflichtige sonstige Leistungen von im übrigen Gemeinschaftsgebiet ansässigen Unternehmen (§13b Abs. 1 UStG)</td>
- <td class="spalte ausfuellen">46</td>
- <td class="betrag ausfuellen"><%46%></td>
- <td class="spalte">47</td>
- <td class="betrag"><%47%></td>
- </tr>
-<%end if year2010%>
- <tr>
- <td class="text2">Leistungen eines im Ausland ansässigen Unternehmers</td>
- <td class="spalte ausfuellen">52</td>
- <td class="betrag ausfuellen"><%52%></td>
- <td class="spalte">53</td>
- <td class="betrag"><%53%></td>
- </tr>
- <tr>
- <td class="text">Lieferungen sicherungsbereigneter Gegenstände und
- Umsätze, die unter das GrEStG fallen.</td>
- <td class="spalte ausfuellen">73</td>
- <td class="betrag ausfuellen"><%73%></td>
- <td class="spalte">74</td>
- <td class="betrag"><%74%></td>
- </tr>
- <tr>
- <td class="text2">Bauleistungen eines im Inland ansässigen Unternehmers</td>
- <td class="spalte ausfuellen">84</td>
- <td class="betrag ausfuellen"><%84%></td>
- <td class="spalte">85</td>
- <td class="betrag"><%85%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Steuer wegen Wechsel der Besteuerungsform und
- Nachsteuer auf versteuerte Anzahlungen wegen Steuersatzerhöhung.</td>
- <td class="spalte ausfuellen">65</td>
- <td class="betrag ausfuellen"><%65%></td>
- </tr>
-
-
-
- <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Umsatzsteuer</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 53<span class="nodis">)</span></td>
- <td class="betrag"><%Z53%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
-
- <tr>
- <td class="text" colspan="3"><b class="h3">Abziehbare Vorsteuerbeträge</b></td>
- <td colspan="2"></td></tr>
- </tr>
-
- <tr>
- <td class="text2" colspan="3">Vorsteuerbeträge von Rechnungen von anderen Unternehmern</td>
- <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>66<span class="nodis">)</span></td>
- <td class="betrag ausfuellen"><%66%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Vorsteuerbeträge aus dem innergemeinschaftlichen Erwerb</td>
- <td class="spalte ausfuellen">61</td>
- <td class="betrag ausfuellen"><%61%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Entrichtete Einfuhrumsatzsteuer</td>
- <td class="spalte ausfuellen">62</td>
- <td class="betrag ausfuellen"><%62%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Vorsteuerbeträge aus Leistungen im Sinne
- des §13b Abs. 1 UStG</td>
- <td class="spalte ausfuellen">67</td>
- <td class="betrag ausfuellen"><%67%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Vorsteuerbeträge, die nach allgemeinen
- Durchschnittsästzen berechnet sind </td>
- <td class="spalte ausfuellen">63</td>
- <td class="betrag ausfuellen"><%63%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Berichtigung des Vorsteuerabzugs</td>
- <td class="spalte ausfuellen">64</td>
- <td class="betrag ausfuellen"><%64%></td>
- </tr>
- <tr>
- <td class="text2" colspan="3">Vorsteuerabzug für innergemeinschaftliche Lieferungen
- neuer Fahrzeuge außerhalb eines Unternehmens sowie von Kleinunternehmern</td>
- <td class="spalte ausfuellen">59</td>
- <td class="betrag ausfuellen"><%59%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Verbleibender Betrag</td>
- <td class="zeile"><span class="nodis">(</span>Zeile 62<span class="nodis">)</span></td>
- <td class="betrag"><%Z62%></td>
- </tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Andere Steuerbeträge</b></td>
- <td colspan="2"></td></tr>
- </tr>
- <tr>
- <td class="text" colspan="3">in Rechnungen unrichtig oder unberechtigt ausgewiesene
- Steuerbeträge sowie Steuerbeträge, die nach
- §4 Nr. 4a, § 6a Abs. 4, §7 oder §25b UStG geschuldet werden</td>
- <td class="spalte ausfuellen">69</td>
- <td class="betrag ausfuellen"><%69%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
-
- <tr>
- <td class="text2" colspan="3"><b class="h3">Umsatzsteuer-Vorauszahlung/Überschuss</b></td>
- <td class="zeile"><span class="nodis">(</span>Zeile 65<span class="nodis">)</span></td>
- <td class="betrag"><%Z65%></td>
- </tr>
- <tr>
- <td class="text" colspan="3">Anrechnung (Abzug) der festgesetzten Sondervorauszahlung
- für Dauerfristverlängerung (nur in der letzten Voranmeldung des
- Besteuerungszeitraums, ausfüllen)</td>
- <td class="spalte ausfuellen">39</td>
- <td class="betrag ausfuellen"><%39%></td>
- </tr>
-
- <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
-
- <tr class="noborder">
- <td class="text2" colspan="3"><b class="h3">Verbleibende Umsatzsteuer-Vorauszahlung bzw.
- Verbleibender Überschuss</b></td>
- <td class="spalte ausfuellen">83</td>
- <td class="summe"><%83%></td>
- </tr>
-
- </tbody>
-</table>
-<%if FA_steuerberater%>
-<p>
-Steuerberater:<br />
-<%FA_steuerberater_name%><br />
-<%FA_steuerberater_street%><br />
-<%FA_steuerberater_city%><br />
-Tel: <%FA_steuerberater_tel%></p>
-<%end FA_steuerberater%>
-</body>
-</html>
+++ /dev/null
-% German USTVA template for taxreports
-%
-% Contributed by Jens Koerner, Peter Schorer, Udo Spallek
-%
-%
-\documentclass[twoside]{scrartcl}
-\usepackage{a4,german}
-\usepackage[frame]{xy}
-\usepackage[utf8]{inputenc}
-\usepackage[german]{babel}
-\usepackage{graphicx}
-\usepackage{tabularx}
-\usepackage{times, german}
-\usepackage{german}
-\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getÀtigt
-\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÀrts
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0cm}
-\setlength{\headsep}{0cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{0cm}
-\setlength{\evensidemargin}{0cm}
-\setlength{\textwidth}{20.9cm}
-\setlength{\textheight}{29.6cm}
-\setlength{\footskip}{-0cm}
-\setlength{\parindent}{0pt}
-
-\begin{document}
-
-\fontfamily{cmss}\fontshape{n}\large\selectfont
-\pagestyle{myheadings}
-\markboth{\hspace{7mm}\protect\includegraphics[viewport = 60 700 700 790]{ustva2.pdf}}
-{\protect\includegraphics[viewport = 60 700 700 790]{ustva1.pdf}}
-\hspace{1mm}
-\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{5mm}p{27mm}p{3mm}}
-\multicolumn{7}{c}{}\\[-2mm]
- & \multicolumn{6}{l}{<%steuernummer%>}\\
-\multicolumn{7}{c}{}\\[15mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
-\multicolumn{2}{p{7.5cm}}{} & & & & &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company_street%>}}& & & & &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%company_city%>}}& & & & &\\[1mm]
-\multicolumn{2}{p{7.5cm}}{
-<%if tel%>
-\small{Tel: <%tel%>}~--~
-<%end tel%>
-<%if fax%>
-\small{Fax: <%fax%>}
-<%end fax%>
-}& & & &<%FA_10%> &\\[-1mm]
-\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}& & & & &\\[-1mm]
-\end{tabular}\\[28.5mm]
-\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
-&&&&\\[42mm]
-\multicolumn{2}{r}{<%51%>} & & \multicolumn{2}{r}{<%51r%>}\\[1.5mm]
-\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%86r%>}\\[46mm]
-\multicolumn{2}{r}{<%97%>} & & \multicolumn{2}{r}{<%97r%>}\\[1.5mm]
-\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%93r%>}\\[7.9mm]
-\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[14mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\
-%\multicolumn{2}{||r|}{1000} & & & \\
-%\multicolumn{2}{||r|}{1000} & & \multicolumn{2}{r}{100.000.000~~00}\\
-%\multicolumn{3}{||r|}{1.000.000.000~~00} & \multicolumn{2}{r}{100.000.000~~00}\\
-\end{tabular}
-
-\newpage
-
-\vspace*{-10mm}\hspace{27mm}<%steuernummer%>\\[-2.5mm]
-\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
-&&&&\\
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%45%>}\\[46mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\[7.9mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[7.9mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[58.5mm]
-\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%67%>}}\\[26mm]
-\end{tabular}\\[35mm]
-<%if FA_steuerberater%>
-\vspace{11mm}
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item <%FA_steuerberater_name%>
-\item <%FA_steuerberater_street%>
-\item <%FA_steuerberater_city%>
-\item Tel:~<%FA_steuerberater_tel%>
-\end{small}\\[15mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-<%if not FA_steuerberater%>
-\begin{list}{}{
-\setlength{\leftmargin}{2mm}
-\setlength{\itemsep}{0mm}
-\setlength{\parsep}{0mm}
-%\setlength{\topsep}{0mm}
-%\setlength{\parskip}{0mm}
-%\setlength{\partopsep}{0mm}
-}
-\begin{small}
-\item ~
-\item ~
-\item ~
-\item ~
-\end{small}\\[26mm]
-\item <%Datum_heute%>,
-\end{list}
-<%end FA_steuerberater%>
-\end{document}
+++ /dev/null
-<?xml version="1.0" encoding="UTF-8" ?>
-<!-- Diese Datei ist mit Lx-Office <%version%> generiert -->
-<WinstonAusgang>
- <Formular Typ="UST"></Formular>
- <Ordnungsnummer><%elsterFFFF%><%elstersteuernummer%></Ordnungsnummer>
- <AnmeldeJahr><%year%></AnmeldeJahr>
- <AnmeldeZeitraum><%period%></AnmeldeZeitraum>
-
-<%foreach id%>
- <Kennzahl nr="<%id%>"><%amount%></Kennzahl>
-<%end%>
-
-</WinstonAusgang>
-
+++ /dev/null
-\documentclass[10pt, oneside]{scrartcl}
-\usepackage[utf8]{inputenc}
-\usepackage{german}
-\usepackage{tabularx}
-\usepackage{xspace}
-\usepackage{ifthen}
-\usepackage{eso-pic}
-\usepackage{longtable}
-\usepackage{eurosym}
-
-\setlength{\voffset}{-0.3cm}
-\setlength{\hoffset}{-2.2cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{2cm}
-%\setlength{\evensidemargin}{2cm}
-\setlength{\textwidth}{16.4cm}
-% \setlength{\textwidth}{13.4cm}
-\setlength{\textheight}{23.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\setlength{\tabcolsep}{0cm}
-
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-\pagestyle{empty}
-\fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
-
-% \vspace*{5cm}
-
-<%name%>
-
-% \ifthenelse{\equal{<%cp_name%>}{}}{}{z.Hd. <%cp_name%>}
-
-<%street%>
-
-<%zipcode%> <%city%>
-
-\begin{flushright}<%dunning_date%>\end{flushright}
-
-\vspace*{2.5cm} %\\
-\large
-\textbf{Zahlungserinnerung} \\ \\ \\
-\normalsize
-Sehr geehrte Damen und Herren, \\ \\ \\
-man kann seine Augen nicht überall haben - offensichtlich haben Sie übersehen, die folgenden Rechnungen zu begleichen: \\
-\vspace{0.5cm} \\
-\begin{tabularx}{\textwidth}{l@{\hspace*{2cm}}X@{\hspace*{0.5cm}}r}
- \textbf{Rechnungsnummer} & \textbf{Rechnungsdatum} & \textbf{Rechnungsbetrag} \\ \hline && \\
- <%foreach dn_invnumber%>
- <%dn_invnumber%> & <%dn_transdate%> & <%dn_amount%> \euro \\[0.1cm]
- <%end dn_invnumber%>
-\end{tabularx}
-\vspace*{0.5cm} \\
-Wir bitten Sie, diese bis zum <%dunning_duedate%> zu begleichen. \\ \\ \\
-Bitte beachten Sie, dass wir Zahlungseingänge nur bis zum <%dunning_date%> berücksichtigen konnten. Sollten Sie zwischenzeitlich bezahlt haben, betrachten Sie diese Zahlungserinnerung bitte als gegenstandslos. \\ \\ \\
-Mit freundlichen Grüßen, \\ \\ \\ \\
-<%employee_name%>
-\end{document}
+++ /dev/null
-\documentclass[10pt, oneside]{scrartcl}
-\usepackage[utf8]{inputenc}
-\usepackage{german}
-\usepackage{tabularx}
-\usepackage{xspace}
-\usepackage{ifthen}
-\usepackage{eso-pic}
-\usepackage{longtable}
-\usepackage{eurosym}
-
-\setlength{\voffset}{-0.3cm}
-\setlength{\hoffset}{-2.2cm}
-\setlength{\topmargin}{0cm}
-\setlength{\headheight}{0.5cm}
-\setlength{\headsep}{1cm}
-\setlength{\topskip}{0pt}
-\setlength{\oddsidemargin}{2cm}
-%\setlength{\evensidemargin}{2cm}
-\setlength{\textwidth}{16.4cm}
-% \setlength{\textwidth}{13.4cm}
-\setlength{\textheight}{23.5cm}
-\setlength{\footskip}{1cm}
-\setlength{\parindent}{0pt}
-\setlength{\tabcolsep}{0cm}
-
-\renewcommand{\baselinestretch}{1}
-
-\begin{document}
-\pagestyle{empty}
-\fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
-
-<%name%>
-
-<%street%>
-
-<%zipcode%> <%city%>
-
-\begin{flushright}<%invdate%>\end{flushright}
-
-\vspace*{2.5cm}
-
-\large
-\textbf{Rechnung <%invnumber%>}
-
-\vspace*{1cm}
-
-\normalsize
-Sehr geehrte Damen und Herren,
-
-\vspace*{1cm}
-Hiermit stellen wir Ihnen zu Mahnung <%dunning_id%> die folgenden Posten in Rechnung:
-
-\vspace*{0.5cm}
-
-\begin{tabularx}{\textwidth}{Xr}
- \textbf{Posten} & \multicolumn{1}{l}{\textbf{Betrag}}\\
- \hline
- Mahngebühren & <%fee%> EUR \\
- Zinsen & <%interest%> EUR \\
- \cline{2-2}
- Gesamtsumme & <%invamount%> EUR\\
-\end{tabularx}
-
-\vspace*{0.5cm}
-
-Bitte begleichen Sie diese Forderung bis zum <%duedate%>.
-
-\vspace*{0.5cm}
-
-Mit freundlichen Grüßen,
-
-\vspace*{2cm}
-<%employee_name%>
-
-\end{document}
--- /dev/null
+
+<body bgcolor="#ffffff">
+
+<h2 align="center">
+<%company%>
+<br><%address%>
+
+<p>BILANZ
+<br><%period%>
+</h2>
+
+<table border="0">
+<tr>
+ <th align="left" width="400" colspan="2">AKTIVA<br><hr align="left" width="250" size="5" noshade></th>
+ <th><%this_period%></th>
+ <th><%last_period%></th>
+</tr>
+
+<%foreach asset_account%>
+<tr>
+ <td> </td>
+ <td><%asset_account%></td>
+ <td align="right"><%asset_this_period%></td>
+ <td align="right"><%asset_last_period%></td>
+</tr>
+<%end asset_account%>
+
+<tr>
+ <td colspan="2"> </td>
+ <td><hr noshade size="1"></td>
+ <td><hr noshade size="1"></td>
+</tr>
+
+<tr valign="top">
+ <th align="left" colspan="2">TOTAL</th>
+ <td align="right"><%total_assets_this_period%><hr noshade size="2"></td>
+ <td align="right"><%total_assets_last_period%><hr noshade size="2"></td>
+</tr>
+
+<tr>
+ <th align="left" colspan="4">PASSIVA<b><hr align="left" width="250" size="5" noshade></th>
+</tr>
+
+<%foreach liability_account%>
+<tr>
+ <td></td>
+ <td><%liability_account%></td>
+ <td align="right"><%liability_this_period%></td>
+ <td align="right"><%liability_last_period%></td>
+</tr>
+<%end liability_account%>
+
+<tr>
+ <td colspan="2"> </td>
+ <td><hr noshade size="1"></td>
+ <td><hr noshade size="1"></td>
+</tr>
+
+<tr valign="top">
+ <td></td>
+ <th align="left">TOTAL</th>
+ <td align="right"><%total_liabilities_this_period%><br><hr noshade size="2"</td>
+ <td align="right"><%total_liabilities_last_period%><br><hr noshade size="2"</td>
+</tr>
+
+<tr>
+ <th align="left" colspan="4">EIGENTUM<br><hr align="left" width="250" size="5" noshade></th>
+</tr>
+
+<%foreach equity_account%>
+<tr>
+ <td></td>
+ <td><%equity_account%></td>
+ <td align="right"><%equity_this_period%></td>
+ <td align="right"><%equity_last_period%></td>
+</tr>
+<%end equity_account%>
+
+<tr>
+ <td colspan="2"> </td>
+ <td><hr noshade size="1"></td>
+ <td><hr noshade size="1"></td>
+</tr>
+
+<tr valign="top">
+ <td></td>
+ <th align="left">TOTAL</th>
+ <td align="right"><%total_equity_this_period%><br><hr noshade size="2"</td>
+ <td align="right"><%total_equity_last_period%><br><hr noshade size="2"</td>
+</tr>
+
+<tr valign="top">
+ <th align="left" colspan="2">TOTAL PASSIVA & EIGENTUM</th>
+ <td align="right"><%total_this_period%><br><hr noshade size="2"></td>
+ <td align="right"><%total_last_period%><br><hr noshade size="2"></td>
+</tr>
+</table>
+
+
+
--- /dev/null
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\usepackage{graphicx}
+\setlength{\voffset}{0.5cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.7cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+
+\begin{document}
+
+\pagestyle{myheadings}
+\thispagestyle{empty}
+
+\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
+
+\vspace*{-1.3cm}
+
+\parbox{\textwidth}{
+ \parbox[b]{.42\textwidth}{%
+ <%company%>
+
+ <%address%>
+ }\hfill
+ \begin{tabular}[b]{rr@{}}
+ Tel & <%tel%>\\
+ Fax & <%fax%>
+ \end{tabular}
+
+ \rule[1.5ex]{\textwidth}{0.5pt}
+}
+
+
+<%pagebreak 90 27 37%>
+\end{tabularx}
+
+\newpage
+
+\markboth{<%company%>\hfill <%ordnumber%>}{<%company%>\hfill <%ordnumber%>}
+
+\vspace*{-12pt}
+
+\begin{tabularx}{\textwidth}{@{}rlXllrrll@{}}
+ \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} & \textbf{Seriennummer} & & \textbf{Menge} & \textbf{Erh} & & \textbf{Lagerplatz} \\
+<%end pagebreak%>
+
+
+\vspace*{0.5cm}
+
+\parbox[t]{1cm}{\hfill}
+\parbox[t]{.5\textwidth}{
+\textbf{Von}
+\vspace{0.7cm}
+
+<%name%> \\
+<%street%> \\
+<%zipcode%> \\
+<%city%> \\
+<%country%>
+}
+\parbox[t]{.4\textwidth}{
+\textbf{Lieferanschrift}
+\vspace{0.7cm}
+
+<%shiptoname%> \\
+<%shiptostreet%> \\
+<%shiptozipcode%> \\
+<%shiptocity%> \\
+<%shiptocountry%>
+}
+\hfill
+
+\vspace{1cm}
+
+\textbf{L A G E R L I S T E}
+\hfill
+
+\vspace{1cm}
+
+\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
+ \textbf{BestellNr. \#} & \textbf{Datum} & \textbf{Kontakt}
+ <%if warehouse%>
+ & \textbf{Lager}
+ <%end warehouse%>
+ & \textbf{Lagerplatz} & \textbf{Lieferung mit} \\ [0.5em]
+ \hline
+
+ <%ordnumber%>
+ <%if shippingdate%>
+ & <%shippingdate%>
+ <%end shippingdate%>
+ <%if not shippingdate%>
+ & <%orddate%>
+ <%end shippingdate%>
+ & <%employee%>
+ <%if warehouse%>
+ & <%warehouse%>
+ <%end warehouse%>
+ & <%shippingpoint%> & <%shipvia%> \\
+ \hline
+\end{tabularx}
+
+\vspace{1cm}
+
+\begin{tabularx}{\textwidth}{@{}rlXllrrll@{}}
+ \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} & \textbf{Seriennumner} & & \textbf{Menge} & \textbf{Erh} & & \textbf{Lagerplatz} \\
+
+<%foreach number%>
+ <%runningnumber%> & <%number%> & <%description%> & <%serialnumber%> &
+ <%deliverydate%> & <%qty%> & <%ship%> & <%unit%> & <%bin%> \\
+<%end number%>
+\end{tabularx}
+
+
+\rule{\textwidth}{2pt}
+
+\end{document}
+
--- /dev/null
+<body>
+<style type="text/css">
+<!--
+/* Allgemeine Schriftdefinition */
+th,td {
+ font-family: Arial, Verdana, Helvetica, Sans-serif;
+ font-size:small;
+}
+
+@page {
+ size: landscape;
+ margin: 0.5cm;
+}
+
+/* Definition Tabellenueberschrift */
+
+.left { text-align:left; }
+.center { text-align:center; }
+.right { text-align:right; }
+
+tr.headline { border:0; }
+tr.headline td { border:0; }
+h1 { font-size:120%; }
+h2 { font-size:100%; }
+
+/* Tabellenkopf */
+th {
+ font-weight: bold;
+ border-bottom: solid thin black;
+ padding:0 10px;
+ text-align:right;
+}
+
+th.left { border-left: solid thin black; }
+th.right { border-right: solid thin black; }
+
+.querkopf th.right { text-align:center; }
+.querkopf th {
+ border-top: solid thin black;
+ border-bottom:0;
+}
+
+/* Tabelleninhalt */
+td {
+ text-align:right;
+ padding:0 0.5em;
+}
+td.left { border-left: solid thin black; }
+td.right { border-right: solid thin black; }
+
+
+/* jede zweite Zeile grau hinterlegen */
+tr.grey {
+ background:#f0f0f0;
+}
+
+/* letzte Zeile in der Tabelle */
+#last td{ border-bottom: solid thin black; }
+
+/* Zwischensumme/-ueberschriften */
+tr.subtotal td { font-weight: bold; }
+
+/* Fusszeile unter der Tabelle */
+td.footer {
+ text-align:right;
+ font-size:smaller;
+}
+//-->
+</style>
+
+<table border=0 cellpadding=0 cellspacing=0>
+<tr class="headline">
+ <td class="left"><%company%></td>
+ <td class=center colspan="9">
+ <h1>Kurzfristige Erfolgsrechnung <%period%></h1>
+ <h2>SKR3 BWA</h2>
+ </td>
+ <td class="right">Blatt 1</td>
+</tr>
+
+
+</tr>
+<tr class="querkopf">
+ <th class="left"> </th>
+ <th class="center" colspan="5">Im Betrachtungszeitraum</th>
+ <th class="right" colspan="5">Kumuliert seit Jahresanfang</th>
+</tr>
+
+<tr>
+ <th class="left">Bezeichnung</th>
+ <th>Wert</th>
+ <th>% Ges.- Leistg.</th>
+ <th>% Ges.- Kosten</th>
+ <th>% Pers.- Kosten</th>
+ <th>Aufschlag</th>
+ <th>Wert</th>
+ <th>% Ges.- Leistg.</th>
+ <th>% Ges.- Kosten</th>
+ <th>% Pers.- Kosten</th>
+ <th class="right">Aufschlag</th>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Umsatzerlöse</nobr></td>
+ <td><nobr><%jetzt1%></nobr></td>
+ <td><nobr><%jetztgl1%></nobr></td>
+ <td></td>
+ <td></td>
+ <td></td>
+ <td><nobr><%kumm1%></nobr></td>
+ <td><nobr><%kummgl1%></nobr></td>
+ <td></td>
+ <td></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Best.Verdg. FE/UE</nobr></td>
+ <td><nobr><%jetzt2%></nobr></td>
+ <td><nobr><%jetztgl2%></nobr></td>
+ <td></td>
+ <td></td>
+ <td></td>
+ <td><nobr><%kumm2%></nobr></td>
+ <td><nobr><%kummgl2%></nobr></td>
+ <td></td>
+ <td></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Akt.Eigenleistungen</nobr></td>
+ <td><nobr><%jetzt3%></nobr></td>
+ <td><nobr><%jetztgl3%></nobr></td>
+ <td></td>
+ <td></td>
+ <td></td>
+ <td><nobr><%kumm3%></nobr></td>
+ <td><nobr><%kummgl3%></nobr></td>
+ <td></td>
+ <td></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Gesamtleistung</nobr></td>
+ <td><nobr><%jetztgesamtleistung%></nobr></td>
+ <td><nobr><%jetztglgesamtleistung%></nobr></td>
+ <td><nobr><%jetztgkgesamtleistung%></nobr></td>
+ <td><nobr><%jetztpkgesamtleistung%></nobr></td>
+ <td></td>
+ <td><nobr><%kummgesamtleistung%></nobr></td>
+ <td><nobr><%kummglgesamtleistung%></nobr></td>
+ <td><nobr><%kummgkgesamtleistung%></nobr></td>
+ <td><nobr><%kummpkgesamtleistung%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Mat./Wareneinkauf</nobr></td>
+ <td><nobr><%jetzt4%></nobr></td>
+ <td><nobr><%jetztgl4%></nobr></td>
+ <td><nobr><%jetztgk4%></nobr></td>
+ <td><nobr><%jetztpk4%></nobr></td>
+ <td><nobr><%jetztauf4%></nobr></td>
+ <td><nobr><%kumm4%></nobr></td>
+ <td><nobr><%kummgl4%></nobr></td>
+ <td><nobr><%kummgk4%></nobr></td>
+ <td><nobr><%kummpk4%></nobr></td>
+ <td class="right"><nobr><%kummauf4%></nobr> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Rohertrag</nobr></td>
+ <td><nobr><%jetztrohertrag%></nobr></td>
+ <td><nobr><%jetztglrohertrag%></nobr></td>
+ <td><nobr><%jetztgkrohertrag%></nobr></td>
+ <td><nobr><%jetztpkrohertrag%></nobr></td>
+ <td><nobr><%jetztaufrohertrag%></nobr></td>
+ <td><nobr><%kummrohertrag%></nobr></td>
+ <td><nobr><%kummglrohertrag%></nobr></td>
+ <td><nobr><%kummgkrohertrag%></nobr></td>
+ <td><nobr><%kummpkrohertrag%></nobr></td>
+ <td class="right"><nobr><%kummaufrohertrag%></nobr> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey">
+ <td class="left"><nobr>So.betr.Erlöse</nobr></td>
+ <td><nobr><%jetzt5%></nobr></td>
+ <td><nobr><%jetztgl5%></nobr></td>
+ <td><nobr><%jetztgk5%></nobr></td>
+ <td><nobr><%jetztpk5%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm5%></nobr></td>
+ <td><nobr><%kummgl5%></nobr></td>
+ <td><nobr><%kummgk5%></nobr></td>
+ <td><nobr><%kummpk5%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Betriebl. Rohertrag</nobr></td>
+ <td><nobr><%jetztbetriebrohertrag%></nobr></td>
+ <td><nobr><%jetztglbetriebrohertrag%></nobr></td>
+ <td><nobr><%jetztgkbetriebrohertrag%></nobr></td>
+ <td><nobr><%jetztpkbetriebrohertrag%></nobr></td>
+ <td><nobr><%jetztaufbetriebrohertrag%></nobr></td>
+ <td><nobr><%kummbetriebrohertrag%></nobr></td>
+ <td><nobr><%kummglbetriebrohertrag%></nobr></td>
+ <td><nobr><%kummgkbetriebrohertrag%></nobr></td>
+ <td><nobr><%kummpkbetriebrohertrag%></nobr></td>
+ <td
+class="right"><nobr><%kummaufbetriebrohertrag%></nobr> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left">Kostenarten:</td>
+ <td class="right" colspan="10"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Personalkosten</nobr></td>
+ <td><nobr><%jetzt10%></nobr></td>
+ <td><nobr><%jetztgl10%></nobr></td>
+ <td><nobr><%jetztgk10%></nobr></td>
+ <td><nobr><%jetztpk10%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm10%></nobr></td>
+ <td><nobr><%kummgl10%></nobr></td>
+ <td><nobr><%kummgk10%></nobr></td>
+ <td><nobr><%kummpk10%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Raumkosten</nobr></td>
+ <td><nobr><%jetzt11%></nobr></td>
+ <td><nobr><%jetztgl11%></nobr></td>
+ <td><nobr><%jetztgk11%></nobr></td>
+ <td><nobr><%jetztpk11%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm11%></nobr></td>
+ <td><nobr><%kummgl11%></nobr></td>
+ <td><nobr><%kummgk11%></nobr></td>
+ <td><nobr><%kummpk11%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Betriebl.Steuern</nobr></td>
+ <td><nobr><%jetzt12%></nobr></td>
+ <td><nobr><%jetztgl12%></nobr></td>
+ <td><nobr><%jetztgk12%></nobr></td>
+ <td><nobr><%jetztpk12%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm12%></nobr></td>
+ <td><nobr><%kummgl12%></nobr></td>
+ <td><nobr><%kummgk12%></nobr></td>
+ <td><nobr><%kummpk12%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Versich./Beiträge</nobr></td>
+ <td><nobr><%jetzt13%></nobr></td>
+ <td><nobr><%jetztgl13%></nobr></td>
+ <td><nobr><%jetztgk13%></nobr></td>
+ <td><nobr><%jetztpk13%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm13%></nobr></td>
+ <td><nobr><%kummgl13%></nobr></td>
+ <td><nobr><%kummgk13%></nobr></td>
+ <td><nobr><%kummpk13%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Kfz-Kosten (o.St.)</nobr></td>
+ <td><nobr><%jetzt14%></nobr></td>
+ <td><nobr><%jetztgl14%></nobr></td>
+ <td><nobr><%jetztgk14%></nobr></td>
+ <td><nobr><%jetztpk14%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm14%></nobr></td>
+ <td><nobr><%kummgl14%></nobr></td>
+ <td><nobr><%kummgk14%></nobr></td>
+ <td><nobr><%kummpk14%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Werbe-/Reisekosten</nobr></td>
+ <td><nobr><%jetzt15%></nobr></td>
+ <td><nobr><%jetztgl15%></nobr></td>
+ <td><nobr><%jetztgk15%></nobr></td>
+ <td><nobr><%jetztpk15%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm15%></nobr></td>
+ <td><nobr><%kummgl15%></nobr></td>
+ <td><nobr><%kummgk15%></nobr></td>
+ <td><nobr><%kummpk15%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Kosten Warenabgabe</nobr></td>
+ <td><nobr><%jetzt16%></nobr></td>
+ <td><nobr><%jetztgl16%></nobr></td>
+ <td><nobr><%jetztgk16%></nobr></td>
+ <td><nobr><%jetztpk16%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm16%></nobr></td>
+ <td><nobr><%kummgl16%></nobr>
+</td>
+ <td><nobr><%kummgk16%></nobr></td>
+ <td><nobr><%kummpk16%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Abschreibungen</nobr></td>
+ <td><nobr><%jetzt17%></nobr></td>
+ <td><nobr><%jetztgl17%></nobr></td>
+ <td><nobr><%jetztgk17%></nobr></td>
+ <td><nobr><%jetztpk17%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm17%></nobr></td>
+ <td><nobr><%kummgl17%></nobr></td>
+ <td><nobr><%kummgk17%></nobr></td>
+ <td><nobr><%kummpk17%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Reparatur/Instandh.</nobr></td>
+ <td><nobr><%jetzt18%></nobr></td>
+ <td><nobr><%jetztgl18%></nobr></td>
+ <td><nobr><%jetztgk18%></nobr></td>
+ <td><nobr><%jetztpk18%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm18%></nobr></td>
+ <td><nobr><%kummgl18%></nobr></td>
+ <td><nobr><%kummgk18%></nobr></td>
+ <td><nobr><%kummpk18%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Sonstige Kosten</nobr></td>
+ <td><nobr><%jetzt20%></nobr></td>
+ <td><nobr><%jetztgl20%></nobr></td>
+ <td><nobr><%jetztgk20%></nobr></td>
+ <td><nobr><%jetztpk20%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm20%></nobr></td>
+ <td><nobr><%kummgl20%></nobr></td>
+ <td><nobr><%kummgk20%></nobr></td>
+ <td><nobr><%kummpk20%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Gesamtkosten</nobr></td>
+ <td><nobr><%jetztgesamtkosten%></nobr></td>
+ <td><nobr><%jetztglgesamtkosten%></nobr></td>
+ <td><nobr><%jetztgkgesamtkosten%></nobr></td>
+ <td><nobr><%jetztpkgesamtkosten%></nobr></td>
+ <td></td>
+ <td><nobr><%kummgesamtkosten%></nobr></td>
+ <td><nobr><%kummglgesamtkosten%></nobr></td>
+ <td><nobr><%kummgkgesamtkosten%></nobr></td>
+ <td><nobr><%kummpkgesamtkosten%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+
+<tr class="grey subtotal">
+<td class="left"><nobr>Betriebsergebnis</nobr></td>
+ <td><nobr><%jetztbetriebsergebnis%></nobr></td>
+ <td><nobr><%jetztglbetriebsergebnis%></nobr>
+</td>
+ <td><nobr><%jetztgkbetriebsergebnis%></nobr></td>
+ <td><nobr><%jetztpkbetriebsergebnis%></nobr></td>
+ <td></td>
+ <td><nobr><%kummbetriebsergebnis%></nobr></td>
+ <td><nobr><%kummglbetriebsergebnis%></nobr>
+</td>
+ <td><nobr><%kummgkbetriebsergebnis%></nobr></td>
+ <td><nobr><%kummpkbetriebsergebnis%></nobr></td>
+ <td class="right"> </td>
+ </tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Zinsaufwand</nobr></td>
+ <td><nobr><%jetzt30%></nobr></td>
+ <td><nobr><%jetztgl30%></nobr></td>
+ <td><nobr><%jetztgk30%></nobr></td>
+ <td><nobr><%jetztpk30%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm30%></nobr></td>
+ <td><nobr><%kummgl30%></nobr></td>
+ <td><nobr><%kummgk30%></nobr></td>
+ <td><nobr><%kummpk30%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Übrige Steuern</nobr></td>
+ <td><nobr><%jetzt19%></nobr></td>
+ <td><nobr><%jetztgl19%></nobr></td>
+ <td><nobr><%jetztgk19%></nobr></td>
+ <td><nobr><%jetztpk19%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm19%></nobr></td>
+ <td><nobr><%kummg191%></nobr></td>
+ <td><nobr><%kummgk19%></nobr></td>
+ <td><nobr><%kummpk19%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Sonst. neutr. Aufwand</nobr></td>
+ <td><nobr><%jetzt31%></nobr></td>
+ <td><nobr><%jetztgl31%></nobr></td>
+ <td><nobr><%jetztgk31%></nobr></td>
+ <td><nobr><%jetztpk31%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm31%></nobr></td>
+ <td><nobr><%kummgl31%></nobr></td>
+ <td><nobr><%kummgk31%></nobr></td>
+ <td><nobr><%kummpk31%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white subtotal">
+<td class="left"><nobr>Neutraler Aufwand</nobr></td>
+ <td><nobr><%jetztneutraleraufwand%></nobr></td>
+ <td><nobr><%jetztglneutraleraufwand%></nobr></td>
+ <td><nobr><%jetztgkneutraleraufwand%></nobr></td>
+ <td><nobr><%jetztpkneutraleraufwand%></nobr></td>
+ <td></td>
+ <td><nobr><%kummneutraleraufwand%></nobr></td>
+ <td><nobr><%kummglneutraleraufwand%></nobr></td>
+ <td><nobr><%kummgkneutraleraufwand%></nobr></td>
+ <td><nobr><%kummpkneutraleraufwand%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="white">
+ <td class="left"><nobr>Zinserträge</nobr></td>
+ <td><nobr><%jetzt32%></nobr></td>
+ <td><nobr><%jetztgl32%></nobr></td>
+ <td><nobr><%jetztgk32%></nobr></td>
+ <td><nobr><%jetztpk32%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm32%></nobr></td>
+ <td><nobr><%kummgl32%></nobr></td>
+ <td><nobr><%kummgk32%></nobr></td>
+ <td><nobr><%kummpk32%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Sonst. neutr. Ertr.</nobr></td>
+ <td><nobr><%jetzt33%></nobr></td>
+ <td><nobr><%jetztgl33%></nobr></td>
+ <td><nobr><%jetztgk33%></nobr></td>
+ <td><nobr><%jetztpk33%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm33%></nobr></td>
+ <td><nobr><%kummgl33%></nobr></td>
+ <td><nobr><%kummgk33%></nobr></td>
+ <td><nobr><%kummpk33%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white">
+ <td class="left"><nobr>Verr.kalk.Kosten</nobr></td>
+ <td><nobr><%jetzt34%></nobr></td>
+ <td><nobr><%jetztgl34%></nobr>
+ <td><nobr><%jetztgk34%></nobr></td>
+ <td><nobr><%jetztpk34%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm34%></nobr></td>
+ <td><nobr><%kummgl34%></nobr></td>
+ <td><nobr><%kummgk34%></nobr></td>
+ <td><nobr><%kummpk34%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Neutraler Ertrag</nobr></td>
+ <td><nobr><%jetztneutralerertrag%></nobr></td>
+ <td><nobr><%jetztglneutralerertrag%></nobr></td>
+ <td><nobr><%jetztgkneutralerertrag%></nobr></td>
+ <td><nobr><%jetztpkneutralerertrag%></nobr></td>
+ <td></td>
+ <td><nobr><%kummneutralerertrag%></nobr></td>
+ <td><nobr><%kummglneutralerertrag%></nobr></td>
+ <td><nobr><%kummgkneutralerertrag%></nobr></td>
+ <td><nobr><%kummpkneutralerertrag%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Ergebnis vor Steuern</nobr></td>
+ <td><nobr><%jetztergebnisvorsteuern%></nobr></td>
+ <td><nobr><%jetztglergebnisvorsteuern%></nobr></td>
+ <td><nobr><%jetztgkergebnisvorsteuern%></nobr></td>
+ <td><nobr><%jetztpkergebnisvorsteuern%></nobr></td>
+ <td></td>
+ <td><nobr><%kummergebnisvorsteuern%></nobr></td>
+ <td><nobr><%kummglergebnisvorsteuern%></nobr></td>
+ <td><nobr><%kummgkergebnisvorsteuern%></nobr></td>
+ <td><nobr><%kummpkergebnisvorsteuern%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey">
+ <td class="left"><nobr>Steuern Eink.u.Ertr.</nobr></td>
+ <td><nobr><%jetzt35%></nobr></td>
+ <td><nobr><%jetztgl35%></nobr></td>
+ <td><nobr><%jetztgk35%></nobr></td>
+ <td><nobr><%jetztpk35%></nobr></td>
+ <td></td>
+ <td><nobr><%kumm35%></nobr></td>
+ <td><nobr><%kummgl35%></nobr></td>
+ <td><nobr><%kummgk35%></nobr></td>
+ <td><nobr><%kummpk35%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white"><td class="left right" colspan="11"> </td></tr>
+
+<tr class="grey subtotal">
+ <td class="left"><nobr>Vorläufiges Ergebnis</nobr></td>
+ <td><nobr><%jetztergebnis%></nobr></td>
+ <td><nobr><%jetztglergebnis%></nobr></td>
+ <td><nobr><%jetztgkergebnis%></nobr></td>
+ <td><nobr><%jetztpkergebnis%></nobr></td>
+ <td></td>
+ <td><nobr><%kummergebnis%></nobr></td>
+ <td><nobr><%kummglergebnis%></nobr></td>
+ <td><nobr><%kummgkergebnis%></nobr></td>
+ <td><nobr><%kummpkergebnis%></nobr></td>
+ <td class="right"> </td>
+</tr>
+
+<tr class="white" id=last><td class="left right"
+colspan="11"> </td></tr>
+
+<tr>
+ <td colspan=11 class=footer>Währung: Euro - FiBu: LX Office ERP
+(Version <%version%>) - Formular: 11.01.2007</td>
+</tr>
+
+</table>
+</body>
--- /dev/null
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\setlength{\voffset}{0.4cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.0cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.5cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+\begin{document}
+
+
+\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
+
+\parbox[t]{12cm}{
+ <%company%>
+
+ <%address%>}
+\hfill
+\parbox[t]{6cm}{\hfill <%source%>}
+
+\vspace*{0.6cm}
+
+<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
+
+\vspace{0.5cm}
+
+\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
+
+\vspace{0.5cm}
+
+<%name%>
+
+<%street%>
+
+<%zipcode%>
+
+<%city%>
+
+<%country%>
+
+\vspace{2.8cm}
+
+<%company%>
+
+\vspace{0.5cm}
+
+<%name%> \hfill <%datepaid%> \hfill <%source%>
+
+\vspace{0.5cm}
+\begin{tabularx}{\textwidth}{lXrr@{}}
+\textbf{Rechnung} & \textbf{Ausgestellt}
+ & \textbf{Fällig} & \textbf{Verrechnet} \\
+<%foreach invnumber%>
+<%invnumber%> & <%invdate%> \dotfill
+ & <%due%> & <%paid%> \\
+<%end invnumber%>
+\end{tabularx}
+
+\vfill
+
+\end{document}
+
--- /dev/null
+% credit_note.tex
+% Verkauf Gutschrift
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 16. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in lxbriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Rechnungsvariablen ----------
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\invnumbercreditnote}{$(invnumber_for_credit_note)$} %Rechnungsnummer Gutschrift
+\newcommand{\docnumber}{Rechnungsnummer: \invnumber}
+\newcommand{\quodate}{$(quodate)$} % Angebotsdatum
+\newcommand{\orddate}{$(orddate)$} % Auftragsdatum
+\newcommand{\reqdate}{$(reqdate)$} % gewuenschtes Lieferdatum
+\newcommand{\deliverydate}{$(deliverydate)$} % Lieferdatum
+\newcommand{\invdate}{$(invdate)$} % Rechnungsdatum
+\newcommand{\terms}{$(terms)$} % Zahlungsfrist
+\newcommand{\duedate}{$(duedate)$} % Fälligkeitsdatum
+\newcommand{\invtotal}{$(invtotal)$} % Gesamtbetrag
+\newcommand{\paid}{$(paid)$} % Schon bezahlt
+\newcommand{\total}{$(total)$} % Restbetrag
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{lxbriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Gutschrift Nr. \invnumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \invdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \nonemptyline{\textbf{Auftrag Nr.} &}{\ordnumber}
+ \nonemptyline{\textbf{Rechnung Nr.} &}{\invnumbercreditnote}
+ \nonemptyline{\textbf{Gutschrift Nr.} &}{\invnumber}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+%\lettergreeting
+Hiermit erstatten wir Ihnen zur Rechnung Nr. \invnumbercreditnote{ } die nachfolgenden Positionen.\\
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.
+%\\[0.4\baselineskip]
+\ifthenelse{\isempty{$(notes)$}}{}{
+ $(notes)$
+ }%
+\vspace{1\baselineskip}\\
+%Mit freundlichen Grüßen\\[1\baselineskip]
+%\employeename\\[1\baselineskip]
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+%\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{~\currency}}]}}
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+$(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+% \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+% \renewcommand{\baselinestretch}{1}\footnotesize
+% {\footnotesize $(longdescription)$
+% \renewcommand{\baselinestretch}{1}\normalsize
+% }}
+ \ifthenelse{\equal{$(deliverydate_oe)$}{\leer}}{}{
+ \newline Lieferdatum:~$(deliverydate_oe)$}
+ &
+ $(qty)$ &
+ $(unit)$ &
+ \ifthenelse{\isempty{$(sellprice)$}}{&}{
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ }\\ %
+ $(end number)$
+
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+%---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+%---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Rechnungsbetrag:}} & \bfseries\numprint{\invtotal} & \textbf{\currency}\\
+% ---------- Wenn bereits etwas gezahlt wurde ----------
+$(if invtotal != total)$
+ $(foreach payment)$
+ abzgl. Zahlung vom {$(paymentdate)$}:& {\numprint{-$(payment)$}} & \currency\\
+ $(end paymentdate)$
+ \midrule
+ \textbf{Verbleibend: } & \textbf{\numprint{\total}} & \textbf{\currency}\\
+$(end)$
+\bottomrule
+ \end{tabular}
+} %Ende des Summenkasten
+\vfill
+% ---------- Nachbemerkung mit max. Abstand nach unten ----------
+{
+%Soweit nicht anders angegeben,
+%\ifthenelse{\equal{\deliverydate}{\leer}}
+% {entspricht das Leistungsdatum dem Rechnungsdatum.}
+% {wurde die Leistung am {\deliverydate} erbracht.}\\[0.5em]
+%Bitte überweisen Sie den Rechnungsbetrag in Höhe von
+%{\numprint{\total}~\currency} innerhalb von
+%\ifthenelse{\equal{\duedate}{\leer}}{{14}}{{\terms}}~Tagen
+%auf das unten angegebene Konto.
+%\ifthenelse{\equal{\duedate}{\leer}}{}
+% {Nach dem {\duedate} behalten wir uns Verzugszinsen vor.}
+Bitte nennen Sie uns eine Bankverbindung auf welche das Guthaben überwiesen werden soll.\\
+\vfil
+\footnotesize
+Bereits gelieferte Waren bleiben bis zur vollständigen Bezahlung der
+Rechnung unser Eigentum.
+}
+
+\end{document}
--- /dev/null
+<body>
+
+<h2 align=center>
+Einnahmenüberschußrechnung</h2>
+<h3 align=center>-EÜR- (Gewinnermittlung nach §4 Abs. 3 EStG)
+<br><%period%>
+</h3>
+
+<table width=100% border=0>
+<tr>
+ <td width=75% align=left colspan=2><font size="+1"><b>A. Betriebseinnahmen</font></b><br></td>
+ <td></td>
+</tr>
+
+<tr>
+ <td>
+ Umsatzerlöse
+ </td>
+ <td>
+ <%eur1%>
+ </td>
+</tr>
+<tr>
+ <td>
+ sonstige Erlöse
+ </td>
+ <td>
+ <%eur2%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Privatanteile
+ </td>
+ <td>
+ <%eur3%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Zinserträge
+ </td>
+ <td>
+ <%eur4%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Außerordentliche Erträge
+ </td>
+ <td>
+ <%eur5%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Vereinnahmte Umsatzsteuer
+ </td>
+ <td>
+ <%eur6%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Umsatzsteuererstattungen
+ </td>
+ <td>
+ <%eur7%>
+ </td>
+</tr>
+
+
+<tr>
+ <td> </td>
+ <td><hr noshade size=1></td>
+</tr>
+
+<tr valign=top>
+ <th align=left><b>Summe Einnahmen</b></th>
+ <td align=right><%sumeura%><hr noshade size=2></td>
+</tr>
+<tr>
+ <td></td>
+ <td><br><br></td>
+</tr>
+<tr>
+ <td align=left><font size="+1"><b>B. Betriebsausgaben</font></b><br></td>
+ <td></td>
+</tr>
+
+<tr>
+ <td>
+ Wareneingänge
+ </td>
+ <td>
+ <%eur8%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Löhne und Gehäter
+ </td>
+ <td>
+ <%eur9%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Gesetzlicher sozialer Aufwand
+ </td>
+ <td>
+ <%eur10%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Mieten
+ </td>
+ <td>
+ <%eur11%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Gas, Strom, Wasser
+ </td>
+ <td>
+ <%eur12%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Instandhaltung
+ </td>
+ <td>
+ <%eur13%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Steuern, Versicherungen, Beiträge
+ </td>
+ <td>
+ <%eur14%>
+ </td>
+</tr>
+<tr>
+ <td>
+ Kfz-Steuern
+ </td>
+ <td>
+ <%eur15%>
+ </td>
+</tr><tr>
+ <td>
+ Kfz-Versicherungen
+ </td>
+ <td>
+ <%eur16%>
+ </td>
+</tr><tr>
+ <td>
+ Sonstige Fahrzeugkosten
+ </td>
+ <td>
+ <%eur17%>
+ </td>
+</tr><tr>
+ <td>
+ Werbe- und Reisekosten
+ </td>
+ <td>
+ <%eur18%>
+ </td>
+</tr><tr>
+ <td>
+ Instandhaltung und Werkzeuge
+ </td>
+ <td>
+ <%eur19%>
+ </td>
+</tr><tr>
+ <td>
+ Fachzeitschriften, Bücher
+ </td>
+ <td>
+ <%eur20%>
+ </td>
+</tr><tr>
+ <td>
+ Miete für Einrichtungen
+ </td>
+ <td>
+ <%eur21%>
+ </td>
+</tr><tr>
+ <td>
+ Rechts- und Beratungskosten
+ </td>
+ <td>
+ <%eur22%>
+ </td>
+</tr><tr>
+ <td>
+ Bürobedarf, Porto, Telefon
+ </td>
+ <td>
+ <%eur23%>
+ </td>
+</tr><tr>
+ <td>
+ Sonstige Aufwendungen
+ </td>
+ <td>
+ <%eur24%>
+ </td>
+</tr><tr>
+ <td>
+ Abschreibungen auf Anlagevermögen
+ </td>
+ <td>
+ <%eur25%>
+ </td>
+</tr><tr>
+ <td>
+ Abschreibungen auf GWG
+ </td>
+ <td>
+ <%eur26%>
+ </td>
+</tr><tr>
+ <td>
+ Vorsteuer
+ </td>
+ <td>
+ <%eur27%>
+ </td>
+</tr><tr>
+ <td>
+ Umsatzsteuerzahlungen
+ </td>
+ <td>
+ <%eur28%>
+ </td>
+</tr><tr>
+ <td>
+ Zinsaufwand
+ </td>
+ <td>
+ <%eur29%>
+ </td>
+</tr><tr>
+ <td>
+ Außerordentlicher Aufwand
+ </td>
+ <td>
+ <%eur30%>
+ </td>
+</tr><tr>
+ <td>
+ Betriebliche Steuern
+ </td>
+ <td>
+ <%eur31%>
+ </td>
+</tr>
+
+
+<tr>
+ <td> </td>
+ <td><hr noshade size=1></td>
+</tr>
+
+<tr valign=top>
+ <th align=left><b>Summe Ausgaben</b></th>
+ <td align=right><%sumeurb%> <br><hr noshade size=2</td>
+</tr>
+<tr>
+ <td></td>
+ <td><br><br></td>
+</tr>
+<tr valign=top>
+ <td align=left>GEWINN / VERLUST</td>
+ <td align=right><%guvsumme%><br><hr noshade size=2></td>
+</tr>
+
+</table>
+
+</body>
+</html>
+
--- /dev/null
+% invoice.tex
+% Rechnung Verkauf
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 16. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Rechnungsvariablen ----------
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\docnumber}{Rechnung Nr. \invnumber}
+\newcommand{\quodate}{$(quodate)$} % Angebotsdatum
+\newcommand{\orddate}{$(orddate)$} % Auftragsdatum
+\newcommand{\reqdate}{$(reqdate)$} % gewuenschtes Lieferdatum
+\newcommand{\deliverydate}{$(deliverydate)$} % Lieferdatum
+\newcommand{\invdate}{$(invdate)$} % Rechnungsdatum
+\newcommand{\terms}{$(terms)$} % Zahlungsfrist
+\newcommand{\duedate}{$(duedate)$} % Fälligkeitsdatum
+\newcommand{\invtotal}{$(invtotal)$} % Gesamtbetrag
+\newcommand{\paid}{$(paid)$} % Schon bezahlt
+\newcommand{\total}{$(total)$} % Restbetrag
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Rechnung Nr. \invnumber}}
+{\tiny Bitte stets angeben}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \invdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \nonemptyline{\textbf{Auftrag Nr.} &}{\ordnumber}
+ \nonemptyline{\textbf{Rechnung Nr.} &}{\invnumber}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+\lettergreeting
+Hiermit erlauben wir uns, Ihnen die nachfolgenden Positionen $(if orddate)$gemäß
+Ihrem Auftrag vom \orddate{ }$(end)$in Rechnung zu stellen.\\
+
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel)
+oder per E-Mail (\employeeemail) gerne zur Verfügung.\\[1\baselineskip]
+\ifthenelse{\isempty{$(notes)$}}{}{
+ $(notes)$\\[1\baselineskip]
+ }%
+%Mit freundlichen Grüßen\\[1\baselineskip]
+%\employeename\\[1\baselineskip]
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+%\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{~\currency}}]}}
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+\endlastfoot
+% ---------- Positionen ----------
+$(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+% \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+% \renewcommand{\baselinestretch}{1}\footnotesize
+% {\footnotesize $(longdescription)$
+% \renewcommand{\baselinestretch}{1}\normalsize
+% }}
+ \ifthenelse{\equal{$(deliverydate_oe)$}{\leer}}{}{
+ \newline Lieferdatum:~$(deliverydate_oe)$}
+ &
+ $(qty)$ &
+ $(unit)$ &
+ \ifthenelse{\isempty{$(sellprice)$}}{&}{
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ }\\ %
+ $(end number)$
+
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+%---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+%---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}[b]{@{}r@{ }r@{ }l}
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Rechnungsbetrag:}} & \bfseries\numprint{\invtotal} & \textbf{\currency}\\
+% ---------- Wenn bereits etwas gezahlt wurde ----------
+$(if invtotal != total)$
+ $(foreach payment)$
+ Zahlung vom {$(paymentdate)$}: & {\numprint{-$(payment)$}} & \currency \\
+ $(end paymentdate)$
+ \midrule
+ \textbf{Offener Betrag: } & \textbf{\numprint{\total}} & \textbf{\currency}\\
+$(end)$
+\bottomrule
+\end{tabular}
+} %Ende des Summenkasten
+
+% ---------- Lieferadresse ----------
+\ifthenelse{%
+ \equal{\shiptoname}{\name} \AND
+ \equal{\shiptodepartmentone}{\leer} \AND
+ \equal{\shiptodepartmenttwo}{\leer} \AND
+ \equal{\shiptostreet}{\street} \AND
+ \equal{\shiptozipcode}{\zipcode} \AND
+ \equal{\shiptocity}{\city}
+ }{}
+{
+% ---------- Umbruch dazwischen verhindern ----------
+\vspace*{0.5em}
+\parbox{\textwidth}{
+% ---------- Bereich für Lieferadresse ----------
+\textbf{Leistungsempfänger:}\hfill\parbox[t]{0.7\textwidth}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+}% ende parbox
+}% ende ifthenelse
+% ---------- Nachbemerkung mit max. Abstand nach unten ----------
+$(if payment_terms)$
+\vspace*{0.5em}
+\textbf{Zahlungsbedingungen:}\hfill\parbox[t]{0.7\textwidth}{$(payment_terms)$}\\
+$(end)$
+\vspace*{0.5em}
+%Bitte überweisen Sie den Rechnungsbetrag in Höhe von
+%{\numprint{\total}~\currency} innerhalb von
+%%{\numprint{\total}~\currency}
+%\ifthenelse{\equal{\duedate}{\leer}}{{14}}{{\terms}}~Tagen
+%auf das unten angegebene Konto.
+%\ifthenelse{\equal{\duedate}{\leer}}{}\\ \vfil
+% {Nach dem {\duedate} behalten wir uns Verzugszinsen vor.}
+Soweit nicht anders angegeben, \ifthenelse{\equal{\deliverydate}{\leer}}
+ {entspricht das Leistungsdatum dem Rechnungsdatum.}
+ {wurde die Leistung am {\deliverydate} erbracht.}\\
+\vfill
+\footnotesize
+Bereits gelieferte Waren bleiben bis zur vollständigen Bezahlung der
+Rechnung unser Eigentum.
+%}
+
+\end{document}
--- /dev/null
+% kivitendobriefkopf.tex
+% Erstellt von Norbert Simon, n.simon@linet-services.de
+% Version 2.1 vom 21.Oktober 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\usepackage {color}
+% ---------- Farbe für die Falzmarkierung ----------
+\definecolor{linecolor}{gray}{.75}
+\definecolor{rulerlineFirst}{RGB}{95,115,5} % Linienfarben Seite 1
+\definecolor{rulerlinePages}{rgb}{0,0,0} % Linienfarben Folgeseiten
+% ---------- Helvetica-Font für Fancyhdr -------------------------
+\newcommand{\helv}{%
+\fontfamily{phv}\fontsize{8}{11}\selectfont}
+% ---------- Helvetica Font einstellen ----------------------------
+\renewcommand{\familydefault}{\sfdefault}
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% Modern
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Basiseinheiten für die Positionierung -----------------
+\newcommand{\vlogospacing}{63mm} % Erste Zeile unterhalb des Anschrift-Blocks
+\newcommand{\hlogospacing}{35mm} % Logo-Breite für Ausrichtung
+% ---------- Bankverbindung des Unternehmens ----------
+\newcommand{\companybank}{Bankname}
+\newcommand{\companybankcode}{xxx xxx xx}
+\newcommand{\companyaccountnumber}{xx xxx xxx xx}
+% ---------- Elemente nur dann ausgeben, wenn ein Wert gesetzt ist ----------
+\newcommand{\leer}{}
+\newcommand{\nonemptyline}[2]{\ifthenelse{\equal{#2}{\leer}}{}{#1#2\\}}
+\newcommand{\hasvalue}[2]{\ifthenelse{\equal{#1}{\leer}}{}{#2}}
+% ---------- Seitendefinition A4 ----------
+\setlength{\voffset}{-2.0cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0cm}
+\setlength{\oddsidemargin}{1.5cm}
+\setlength{\evensidemargin}{1.5cm}
+\setlength{\textwidth}{174mm}
+\setlength{\textheight}{24cm}
+\setlength{\footskip}{1.8cm}
+\setlength{\parindent}{0cm}
+\renewcommand{\baselinestretch}{1}
+% ---------- Abstand Tabellenzeilen erhöhen ----------
+\renewcommand{\arraystretch}{1.3}
+%\fontfamily{cmss}\fontshape{n}\selectfont
+%\fontfamily{phv}\fontshape{n}\selectfont
+% ---------- Seitenköpfe und -Füße ----------
+
+\newsavebox{\fusszeile}
+\sbox{\fusszeile}{
+ \tiny
+ \begin{minipage}[t]{\textwidth}
+ \renewcommand{\arraystretch}{0.9}
+ \hspace*{5mm}
+ \begin{tabular}[t]{l}
+ Firmenname 1 \\
+ Firmenname 2\\
+ Straße Nr\\
+ Plz Ort\\
+ \end{tabular}
+ \hfill
+ \begin{tabular}[t]{l}
+ \textbf{Sitz der Gesellschaft}\\
+ Plz Ort\\
+ \textbf{Geschäftsführer}\\
+ Vorname Name\\
+ \end{tabular}
+ \hfill
+ \begin{tabular}[t]{l}
+ \textbf{Handesregistereintrag}\\
+ Amtsgericht Woshaltis\\
+ HRB xxx\\
+ \end{tabular}
+ \hfill
+ \begin{tabular}[t]{l}
+ USt-ID-Nr. DE xxxxxxxxx\\
+ Steuer Nr. xx xxx xxxxx\\
+ \end{tabular}
+ \hfill
+ \begin{tabular}[t]{l}
+ \textbf{Bankverbindung}\\
+ \companybank\\
+ BLZ \companybankcode\\
+ Konto \companyaccountnumber\\
+ \end{tabular}
+ \renewcommand{\arraystretch}{1}
+ \end{minipage}
+}%Ende sbox
+% ---------- Seitenstil-Definitionen ----------
+% pagestyle "plain" umdefinieren:
+\fancypagestyle{plain}{%
+
+ \fancyhf{} % Erstmal alles löschen
+% \fancyfoot[OL,EL]{\usebox{\fusszeile}}
+ \fancyhead[L]{\usebox{\plainpages}}
+% \fancyhead[C]{\helv\footnotesize \docnumber}
+% \fancyhead[R]{\helv\footnotesize Seite \thepage/\pageref{LastPage}\hspace*{12mm}}
+ \fancyfoot[L]{\helv\footnotesize Seite \thepage/\pageref{LastPage}\hspace*{12mm}}
+ \fancyfoot[C]{\helv\footnotesize \docnumber}
+ \renewcommand{\headrulewidth}{0pt}
+ \renewcommand{\footrulewidth}{0pt}
+ \fancyfootoffset{10mm}
+ \fancyheadoffset{10mm}
+ }
+
+% pagestyle "briefkopf" definieren:
+\fancypagestyle{briefkopf}{%
+ \fancyhf{} % Erstmal alles löschen
+ \fancyhead[L]{\usebox{\kopf}}
+% \fancyfoot[OL,EL]{\usebox{\fusszeile}}
+ \renewcommand{\headrulewidth}{0pt}
+ \renewcommand{\footrulewidth}{0pt}
+ \fancyfootoffset{10mm}
+ \fancyheadoffset{10mm}
+ }
+
+\pagestyle{plain} % Alle Seiten bekommen plain als Default-Stil
+
+% ---------- Briefkopf ----------
+\newsavebox{\kopf}
+\sbox{\kopf}{
+ \setlength{\unitlength}{1mm} % In der picture-Umgebung sollen alle Zahlen die Einheit 1mm haben.
+
+\begin{picture}(0,0)
+% ---------- Logo ----------
+% Das Logo muss sich im lx-erp-Pfad im Ordner users/ befinden und kann das
+% Format PDF, JPG, PNG oder EPS haben. Mit einer EPS-Grafik kann lx nur einen
+% Ausdruck nach Postscript machen. Die anderen Grafik-Formate erlauben nur
+% einen PDF-Ausdruck.
+% Position (put) ist abhängig von der Größe
+%
+
+ \put(-12.5,-288){\includegraphics*{kivitendo-seite1.pdf}}
+
+
+% ---------- mit Latex gesetzter Briefkopf, rechtsbündig ----------
+% \put(146,-45){
+% \begin{minipage}[t]{35mm}
+% \tiny \raggedright
+% \small \raggedright
+% \footnotesize \raggedright
+% Firmenname 1\\
+% Firemnname 2\\
+% Straße Nr\\
+% PLZ Ort\\
+% \vspace{2mm}
+% Telefon +49 xxx xxx xxx\\
+% Telefax +49 xxx xxx xxx\\
+% \vspace{2mm}
+% E-Mail info@firma.de\\
+% Web www.firma.de
+% \end{minipage}
+% }%Ende put
+
+% ---------- Adressat ----------
+% \put(10,-45){\parbox{8cm}{
+% \begin{raggedright}
+% \tiny{\hspace*{2mm}Firma~\textbullet~Straße Nr~\textbullet~Plz Ort}
+% \small{\hspace*{2mm}Firma~\textbullet~Straße Nr~\textbullet~Plz Ort}
+% \end{raggedright}
+% }%parbox
+% }%put
+
+% \put(10,-47){\color{rulerlineFirst}\rule{80mm}{0.3pt}}
+ \put(10,-52){
+ \parbox[t]{8cm}{
+ \normalsize
+ \name \\
+ \nonemptyline{\cpgreeting{ }\cptitle{ }\cpgivenname{ }}{\cpname}
+ \nonemptyline{}{\departmentone}
+ \nonemptyline{}{\departmenttwo}
+ \street \\
+ \country{ }\zipcode{ }\city\par
+ \vspace{3mm}
+ \nonemptyline{\small Fax:}{\fax}
+ \nonemptyline{\small Tel:}{\phone}
+ }%Ende parbox
+ }%Ende put
+ % Falzlinien - Werte ergeben sich aus topoffset etc. - im PDF ausgemessen und für gut befunden
+% \put(-5,-95){\color{rulerlineFirst}\rule{2mm}{0.15pt}}
+% \put(-8,-138){\color{rulerlineFirst}\rule{3mm}{0.2pt}}
+% \put(-5,-200){\color{rulerlineFirst}\rule{2mm}{0.15pt}}
+% \put(7,-265){\color{rulerlineFirst}\rule{\textwidth}{0.2pt}}%Trennline Fußzeile
+\end{picture}
+}%Ende sbox
+
+%%%%%%%%%%%%% Ende des Briefkopfes %%%%%%%%%%%
+% ---------- Gestaltungselemente Plainseiten ----------
+\newsavebox{\plainpages}
+\sbox{\plainpages}{
+ \setlength{\unitlength}{1mm} % In der picture-Umgebung sollen alle Zahlen die Einheit 1mm haben.
+ \begin{picture}(0,0)
+ \put(-12.5,-288){\includegraphics*{kivitendo-seiteff.pdf}}
+ \end{picture}
+}%Ende Sbox
--- /dev/null
+% overdue-notice-a.tex
+% Verkauf Mahnung
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 16. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+
+% ---------- Rechnungsvariablen ----------
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\docnumber}{Rechnungsnummer: \invnumber}
+\newcommand{\quodate}{$(quodate)$} % Angebotsdatum
+\newcommand{\orddate}{$(orddate)$} % Auftragsdatum
+\newcommand{\reqdate}{$(reqdate)$} % gewuenschtes Lieferdatum
+\newcommand{\deliverydate}{$(deliverydate)$} % Lieferdatum
+\newcommand{\invdate}{$(invdate)$} % Rechnungsdatum
+\newcommand{\terms}{$(terms)$} % Zahlungsfrist
+\newcommand{\duedate}{$(duedate)$} % Fälligkeitsdatum
+\newcommand{\invtotal}{$(invtotal)$} % Gesamtbetrag
+\newcommand{\paid}{$(paid)$} % Schon bezahlt
+\newcommand{\total}{$(total)$} % Restbetrag
+\newcommand{\dunningid}{$(dunning_id)$} % ID Zahlungserinnerung
+\newcommand{\dunningdate}{$(dunning_date)$} % Datum der Zahlungserinnerung
+
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Mahnung}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \dunningdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Rechnung Nr.} & \invnumber\\
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+\lettergreeting
+Leider haben Sie unsere vorangegangene Zahlungserinnerung ignoriert. Das ist
+bedauerlich, denn dadurch sind uns Kosten entstanden, die wir nun an Sie
+weitergeben müssen. Damit keine weiteren Kosten für Sie entstehen, begleichen
+Sie bitte die nachfolgend ausgewiesenen offenen Posten schnellstmöglich,
+spätestens bis zum $(duedate)$.\\ %[1em plus 3em minus 1em]
+\vspace*{1em} \\
+Mit freundlichen Grüßen\\[1em]
+$(employee_name)$\\[2em]
+\textbf{Offenen Forderungen}\\[0.5em]
+
+\setlength{\tabcolsep}{0mm}
+\begin{tabular*}{\textwidth}{c@{\extracolsep\fill}c@{\extracolsep\fill}c@{\extracolsep\fill}r@{\extracolsep\fill}r@{\extracolsep\fill}r@{\extracolsep\fill}r}
+ \textbf{Rechnungs-Nr.} & \textbf{Datum} & \textbf{fällig am} &
+ \textbf{Betrag} & \textbf{Gebühr} & \textbf{Zinsen} & \textbf{zu zahlen} \\[1pt]
+\hline\\
+$(foreach dn_invnumber)$
+ $(dn_invnumber)$ & $(dn_transdate)$ & $(dn_duedate)$ &
+ $(dn_amount)$ \euro & $(dn_fee)$ \euro & $(dn_interest)$ \euro & $(dn_linetotal)$ \euro \\[1pt]
+$(end dn_invnumber)$
+\cline{1-7}\\
+ Insgesamt: & & & $(total_open_amount)$ \euro & $(fee)$ \euro & $(total_interest)$ \euro & \textbf{$(total_amount)$ \euro}
+\end{tabular*}
+\rule{\textwidth}{0.5pt}
+
+\vspace{0.5cm}
+
+\hfill \textbf{Bitte zahlen Sie umgehend $(total_amount)$ \euro}
+\end{document}
--- /dev/null
+% overdue-notice-a.tex
+% Verkauf Mahnung
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 16. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+
+% ---------- Rechnungsvariablen ----------
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\docnumber}{Rechnungsnummer: \invnumber}
+\newcommand{\quodate}{$(quodate)$} % Angebotsdatum
+\newcommand{\orddate}{$(orddate)$} % Auftragsdatum
+\newcommand{\reqdate}{$(reqdate)$} % gewuenschtes Lieferdatum
+\newcommand{\deliverydate}{$(deliverydate)$} % Lieferdatum
+\newcommand{\invdate}{$(invdate)$} % Rechnungsdatum
+\newcommand{\terms}{$(terms)$} % Zahlungsfrist
+\newcommand{\duedate}{$(duedate)$} % Fälligkeitsdatum
+\newcommand{\invtotal}{$(invtotal)$} % Gesamtbetrag
+\newcommand{\paid}{$(paid)$} % Schon bezahlt
+\newcommand{\total}{$(total)$} % Restbetrag
+\newcommand{\dunningid}{$(dunning_id)$} % ID Zahlungserinnerung
+\newcommand{\dunningdate}{$(dunning_date)$} % Datum der Zahlungserinnerung
+
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Mahnrechnung Nr. \invnumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \invdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Rechnung Nr.} & \invnumber\\
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+\lettergreeting
+
+Hiermit erlauben wir uns, Ihnen zu Mahnung $(dunning_id)$
+die nachfolgenden Positionen in Rechnung zu stellen.\\
+
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel)
+oder per E-Mail (\employeeemail) gerne zur Verfügung.\\[1\baselineskip]
+
+\vspace*{0.5cm}
+
+Bitte begleichen Sie diese Forderung bis zum $(duedate)$.
+
+\vspace*{0.5cm}
+
+\begin{tabularx}{\textwidth}{Xr}
+ \textbf{Posten} & \multicolumn{1}{l}{\textbf{Betrag}}\\
+ \hline
+ Mahngebühren & $(fee)$ EUR \\
+ Zinsen & $(interest)$ EUR \\
+ \cline{2-2}
+ Gesamtsumme & $(invamount)$ EUR\\
+\end{tabularx}
+
+\end{document}
--- /dev/null
+\ProvidesFile{versionEins.sty}
+\usepackage[utf8]{inputenc}
+\usepackage{german}
+\usepackage{graphicx}
+% \usepackage{colortbl}
+% \usepackage{lastpage}
+% \usepackage{tabularx}
+
+% \pageref
+
+\setlength{\voffset}{-0.3cm}
+\setlength{\hoffset}{-2.5cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{2cm}
+\setlength{\textwidth}{16.4cm}
+\setlength{\textheight}{20.5cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+
+\setlength{\tabcolsep}{0.2cm}
+\setlength{\unitlength}{1cm}
+
+\newcommand{\myhead}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+ \begin{picture}(0,0)
+ \put(-2.025,-26.95){\includegraphics*{kivitendo-seite1.pdf}}
+ \end{picture}
+}
+
+\newcommand{\myfoot}{%
+}
+
+\newcommand{\plainfoot}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+ \begin{minipage}[t][1cm][t]{\textwidth}
+ \begin{minipage}[t][1cm][t]{5cm}
+ \refnr
+ \end{minipage} \hspace*{10.25cm}
+ \begin{minipage}[t][1cm][t]{2cm}
+ Seite \thepage \\
+ \end{minipage}
+ \end{minipage}
+}
+
+\newcommand{\plainhead}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+ \begin{picture}(0,0)
+ \put(-2.025,-26.95){\includegraphics*{kivitendo-seiteff.pdf}}
+ \end{picture}
+}
+
+
+\renewcommand{\ps@headings}{%
+ \renewcommand{\@oddhead}{\myhead}
+ \renewcommand{\@evenhead}{\@oddhead}%
+ \renewcommand{\@oddfoot}{\myfoot}
+ \renewcommand{\@evenfoot}{\@oddfoot}%
+}
+
+\renewcommand{\ps@plain}{%
+ \renewcommand{\@oddhead}{\plainhead}
+ \renewcommand{\@evenhead}{\@oddhead}%
+ \renewcommand{\@oddfoot}{\plainfoot}
+ \renewcommand{\@evenfoot}{\@oddfoot}%
+}
--- /dev/null
+\ProvidesFile{ohneBriefpapier.sty}
+\usepackage[utf8]{inputenc}
+\usepackage{german}
+\usepackage{graphicx}
+% \usepackage{colortbl}
+% \usepackage{lastpage}
+% \usepackage{tabularx}
+
+% \pageref
+
+\setlength{\voffset}{-0.3cm}
+\setlength{\hoffset}{-2.5cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{2cm}
+\setlength{\textwidth}{16.4cm}
+\setlength{\textheight}{20.5cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+
+\setlength{\tabcolsep}{0.2cm}
+\setlength{\unitlength}{1cm}
+
+\newcommand{\myhead}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+ \begin{picture}(0,0)
+ \put(13.3,-23.8){\includegraphics*[width=3.6cm,keepaspectratio=true]{PNG/hinweis-rechts-unten.png}}
+ \end{picture}
+}
+
+\newcommand{\myfoot}{%
+}
+
+\newcommand{\plainfoot}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+ \begin{minipage}[t][1cm][t]{\textwidth}
+ \begin{minipage}[t][1cm][t]{5cm}
+ \refnr
+ \end{minipage} \hspace*{10.25cm}
+ \begin{minipage}[t][1cm][t]{2cm}
+ Seite \thepage \\
+ \end{minipage}
+ \end{minipage}
+}
+
+\newcommand{\plainhead}{%
+ \fontfamily{cmss}\fontsize{10pt}{10pt}\fontseries{m}\selectfont
+
+}
+
+
+\renewcommand{\ps@headings}{%
+ \renewcommand{\@oddhead}{\myhead}
+ \renewcommand{\@evenhead}{\@oddhead}%
+ \renewcommand{\@oddfoot}{\myfoot}
+ \renewcommand{\@evenfoot}{\@oddfoot}%
+}
+
+\renewcommand{\ps@plain}{%
+ \renewcommand{\@oddhead}{\plainhead}
+ \renewcommand{\@evenhead}{\@oddhead}%
+ \renewcommand{\@oddfoot}{\plainfoot}
+ \renewcommand{\@evenfoot}{\@oddfoot}%
+}
--- /dev/null
+% pick_list.tex
+% Sammelliste Verkauf
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 16.Oktober 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\usepackage{graphicx}
+\setlength{\voffset}{0.5cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.7cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+
+\begin{document}
+
+\newlength{\descrwidth}\setlength{\descrwidth}{9cm}
+\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
+
+\pagestyle{myheadings}
+\thispagestyle{empty}
+
+\vspace*{-1.3cm}
+
+\parbox{\textwidth}{
+ \parbox[b]{.42\textwidth}{
+ $(company)$
+
+ $(address)$
+ }\hfill
+ \begin{tabular}[b]{rr@{}}
+ Tel & $(tel)$\\
+ Fax & $(fax)$
+ \end{tabular}
+
+ \rule[1.5ex]{\textwidth}{0.5pt}
+}
+
+
+%$(pagebreak 90 27 37)$
+%\end{tabular*}
+
+%\newpage
+
+\markboth{$(company)$\hfill $(ordnumber)$}{$(company)$\hfill $(ordnumber)$}
+
+\vspace*{-12pt}
+
+%\begin{tabular*}{\textwidth}{@{}lp{\descrwidth}@{\extracolsep\fill}rcll@{}}
+% \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} &
+% \textbf{Menge} & \textbf{Lagerausgang} & & \textbf{Lagerplatz} \\
+%$(end pagebreak)$
+
+
+\vspace*{0.5cm}
+
+\parbox[t]{1cm}{\hfill}
+\parbox[t]{.5\textwidth}{
+ \textbf{Lieferanschrift}
+} \hfill
+
+\vspace{0.7cm}
+
+\parbox[t]{1cm}{\hfill}
+\parbox[t]{.5\textwidth}{
+
+$(shiptoname)$ \\
+$(shiptostreet)$ \\
+$(shiptozipcode)$ \\
+$(shiptocity)$ \\
+$(shiptocountry)$
+}
+\parbox[t]{.4\textwidth}{
+ $(shiptocontact)$
+
+ $(if shiptophone)$
+ Tel: $(shiptophone)$
+ $(end shiptophone)$
+
+ $(if shiptofax)$
+ Fax: $(shiptofax)$
+ $(end shiptofax)$
+
+ $(shiptoemail)$
+}
+\hfill
+
+\vspace{1cm}
+
+\textbf{S A M M E L L I S T E}
+\hfill
+
+\vspace{1cm}
+\typeout{hier?}
+\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
+ \textbf{BestellNr. \#} &
+ \textbf{Datum} &
+ \textbf{Kontakt} &
+ $(if warehouse)$ \textbf{Lager} & $(end warehouse)$
+ \textbf{Lagerplatz} &
+ \textbf{Lieferung mit} \\ [0.5em]
+ \hline
+ $(ordnumber)$ &
+ $(if shippingdate)$ $(shippingdate)$ &$(end shippingdate)$
+ $(if not shippingdate)$ $(orddate)$ &$(end shippingdate)$
+ $(employee)$ &
+ $(if warehouse)$ $(warehouse)$ &$(end warehouse)$
+ $(shippingpoint)$ &
+ $(shipvia)$ \\
+ \hline
+\end{tabularx}
+
+\vspace{1cm}
+
+%\begin{tabular*}{\textwidth}{@{}rlp{\descrwidth}@{\extracolsep\fill}rcll@{}}
+\setlength{\tabcolsep}{0mm}
+\begin{tabularx}{\textwidth}{p{1.5cm}p{6cm}p{2cm}p{2cm}p{4cm}p{1.5cm}}
+ \textbf{Art-Nr} &
+ \textbf{Beschreibung} &
+ \textbf{Serien-Nr} &
+ \textbf{Menge} &
+ \textbf{Lager} &
+ \textbf{Lagerplatz} \\
+$(foreach number)$
+ $(if si_qty)$
+ $(foreach si_number)$
+ $(si_number)$ &
+ $(si_description)$ &
+ $(si_chargenumber)$ &
+ \hfill $(si_qty)$ $(si_unit)$ &
+ $(si_warehouse)$ &
+ $(si_bin)$\\[1em]
+ $(end si_number)$
+ $(else)$
+ $(number)$ &
+ $(description)$ &
+ &
+ \hfill $(qty)$ $(unit)$ &
+ & \\[1em]
+ $(end si_qty)$
+$(end number)$
+\end{tabularx}
+
+\parbox{\textwidth}{
+\rule{\textwidth}{2pt}
+}
+
+\end{document}
--- /dev/null
+% proforma.tex für LX-Office ab V2.6.3
+% Proforma Rechnung Verkauf
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen für kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- eigene Bankverbindung falls nicht im Briefkopf ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\docnumber}{Proforma ReNr. {\ordnumber}} % \quonumber
+\newcommand{\quodate}{$(quodate)$}
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\reqdate}{$(reqdate)$}
+\newcommand{\transdate}{$(transdate)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währung setzen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur auf Seite 1 ----------
+ \thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern unterhalb des Briefkopfs ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\ifthenelse{\isempty{\invnumber}}
+{\sperren{\textbf{Proforma-Rechnung Nr. \quonumber}}}
+{\sperren{\textbf{Proforma-Rechnung Nr. \invnumber}}}
+{\tiny Bitte stets angeben}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \transdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \ifthenelse{\isempty{\invnumber}}
+ {\textbf{Proforma-Rechnung Nr.} & \quonumber\\}
+ {\textbf{Proforma-Rechnung Nr.} & \invnumber\\}
+ \nonemptyline{\textbf{Vorraussichliches Lieferdatum:} &}{\reqdate}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+\lettergreeting
+bitte überweisen Sie den ausgewiesenen Rechnungsbetrag für Ihre
+nachfolgend aufgeführte Bestellung auf das unten angegebene Konto.
+\ifthenelse{\isempty{$(notes)$}}{}{
+ \newline
+ $(notes)$
+ }
+\vspace{5mm}
+
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+%\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{~\currency}}]}}
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+ \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+ \renewcommand{\baselinestretch}{1}\footnotesize
+ {\footnotesize $(longdescription)$
+ \renewcommand{\baselinestretch}{1}\normalsize
+ }} &
+ $(qty)$ &
+ $(unit)$ &
+ \ifthenelse{\isempty{$(sellprice)$}}{&}{
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ }\\ %
+ $(end number)$
+
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+%---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+%---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+% \toprule
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ \ifthenelse{\isempty{$(ordtotal)$}}
+ {{\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(invtotal)$} & \textbf{\currency}\\}
+ {{\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(ordtotal)$} & \textbf{\currency}\\}
+ \bottomrule
+\end{tabular}
+}
+% ---------- Transportmittel ----------
+$(if shipvia)$
+Lieferung per $(shipvia)$.\\[1em]
+$(end)$
+% ---------- Lieferadresse ----------
+\ifthenelse{%
+ \equal{\shiptoname}{\name} \AND
+ \equal{\shiptodepartmentone}{\leer} \AND
+ \equal{\shiptodepartmenttwo}{\leer} \AND
+ \equal{\shiptostreet}{\street} \AND
+ \equal{\shiptozipcode}{\zipcode} \AND
+ \equal{\shiptocity}{\city}
+ }{}{
+% ---------- Umbruch dazwischen verhindern ----------
+\parbox{\textwidth}{
+% ---------- Bereich für Lieferadresse ----------
+\textbf{Lieferanschrift:}\hfill\parbox[t]{0.7\textwidth}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+}% ende parbox
+}% ende ifthenelse
+% ---------- Nachbemerkung mit variablem Abstand ----------
+$(if reqdate)$
+\vspace*{0.5em}
+\textbf{Das Angebot ist gültig bis zum \reqdate.}\\
+$(end)$
+$(if payment_terms)$
+\vspace*{0.5em}
+\textbf{Zahlungsbedingungen:}\hfill\parbox[t]{0.7\textwidth}{$(payment_terms)$}\\
+$(end)$
+\vspace*{0.5em}
+Die Ware bleibt bis zur vollständigen Bezahlung unser Eigentum.
+$(if reqdate)$
+\vspace*{0.5em}
+Sollte bis zum \reqdate{ }kein Zahlungseingang erfolgen, ist der Vertrag hinfällig.
+$(end)$
+\vspace*{0.5em}
+Nutzen Sie bitte für Fragen oder Änderungswünsche die oben angegebenen Kontaktmöglichkeiten.\\ \vfil
+\parbox{\textwidth}{
+\vspace*{1em}
+Mit freundlichen Grüßen\\ \vfil
+\employeename
+} % parbox
+\vfill
+\footnotesize
+Es gelten unsere AGB, die wir Ihnen -- falls nicht zur Hand oder unbekannt -- gern zusenden.
+
+\end{document}
--- /dev/null
+% purchase_delivery_order.tex für LX-Office ab V2.6.3
+% Bestell-Eingangslieferschein
+% ----------
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.1 vom 21.Oktober 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\usepackage{graphicx}
+\setlength{\voffset}{0.5cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.7cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+
+\begin{document}
+
+\pagestyle{myheadings}
+\thispagestyle{empty}
+
+\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
+
+\markboth{$(company)$\hfill $(ordnumber)$}{$(company)$\hfill $(ordnumber)$}
+
+\vspace*{0.5cm}
+
+\parbox[t]{1cm}{\hfill}
+\parbox[t]{.5\textwidth}{
+\textbf{Von}
+\vspace{0.7cm}
+
+$(name)$ \\
+$(street)$ \\
+$(zipcode)$ \\
+$(city)$ \\
+$(country)$
+}
+\hfill
+
+\vspace{1cm}
+
+\textbf{Eingangslieferschein}
+\hfill
+
+\vspace{1cm}
+
+\begin{tabularx}{\textwidth}{*{6}{|X}|} \hline
+ \textbf{BestellNr. \#} & \textbf{Datum} & \textbf{Kontakt}
+ $(if warehouse)$
+ & \textbf{Lager}
+ $(end warehouse)$
+ & \textbf{Lagerplatz} & \textbf{Lieferung mit} \\ [0.5em]
+ \hline
+
+ $(ordnumber)$
+ $(if shippingdate)$
+ & $(shippingdate)$
+ $(end shippingdate)$
+ $(if not shippingdate)$
+ & $(orddate)$
+ $(end shippingdate)$
+ & $(employee)$
+ $(if warehouse)$
+ & $(warehouse)$
+ $(end warehouse)$
+ & $(shippingpoint)$ & $(shipvia)$ \\
+ \hline
+\end{tabularx}
+
+\vspace{1cm}
+
+\begin{tabularx}{\textwidth}{@{}rlXllrrll@{}}
+ \textbf{Pos} & \textbf{Nummer} & \textbf{Beschreibung} & \textbf{Seriennumner} & & \textbf{Menge} & \textbf{Erh} & & \textbf{Lagerplatz} \\
+
+$(foreach number)$
+ $(runningnumber)$ & $(number)$ & $(description)$ & $(serialnumber)$ &
+ $(deliverydate)$ & $(qty)$ & $(ship)$ & $(unit)$ & $(bin)$ \\
+$(end number)$
+\end{tabularx}
+
+
+\rule{\textwidth}{2pt}
+
+\end{document}
--- /dev/null
+% purchase_order.tex für LX-Office ab V2.6.3
+% Einkauf - Bestellung
+% ----------
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15.November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\quonumber}{$(quonumber)$}
+\newcommand{\docnumber}{Bestellung Nr. \ordnumber}
+\newcommand{\vendornumber}{$(vendornumber)$}
+\newcommand{\reqdate}{$(reqdate)$}
+\newcommand{\orddate}{$(orddate)$}
+\newcommand{\ordnumber}{$(ordnumber)$}
+\newcommand{\transdate}{$(transdate)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Bestellung Nr. \ordnumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \orddate \\
+ \nonemptyline{\textbf{Lieferung bis} &}{\reqdate}
+ \nonemptyline{\textbf{Unsere Kunden Nr.} &}{\vendornumber}
+ \textbf{Bestellung Nr.} & \ordnumber\\
+ \nonemptyline{\textbf{Terminwunsch} &}{\reqdate}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+
+
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{5mm}
+\lettergreeting
+gemäß Ihrem Angebot
+\ifthenelse{\equal{\orddate}{\leer}}{}{vom \orddate{}}%
+, beauftragen wir Sie mit der nachstehenden Lieferung.
+Bei Fragen zur Bestellung, steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.\\
+
+%\\[1\baselineskip]
+
+% ---------- Bemerkung übernehmen ----------
+\ifthenelse{\isempty{$(notes)$}}{}{
+ \vspace{ 5mm}
+ $(notes)$
+ \vspace*{5mm}
+ }
+
+
+% ---------- Die eigentliche-Tabelle ----------
+
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+ \ifthenelse{\equal{$(longdescription)$}{}}{}{$(longdescription)$} &
+ $(qty)$ &
+ $(unit)$ &
+ \numprint{$(sellprice)$} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ \\ %
+ $(end number)$
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+%---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+%---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+% \toprule
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(ordtotal)$} & \textbf{\currency}\\
+ \bottomrule
+\end{tabular}
+}
+\vfill
+Grundlage dieses Auftrages sind unsere Einkaufsbedingungen.
+Wir bitten um gleichlautende Auftragsbestätigung.\\
+\vspace{1.5\baselineskip}
+
+\nonemptyline{\textbf{Liefertermin: }}{\reqdate}
+
+% ---------- Lieferadresse ----------
+\ifthenelse{\equal{\shiptocity}{\leer}}{}{
+% ---------- Umbruch dazwischen verhindern ----------
+\parbox{\textwidth}{
+\textbf{Lieferanschrift:}
+%[7mm]
+% \rule{10em}{0mm}
+% ---------- Bereich für Lieferadresse ----------
+ \parbox[t]{7cm}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+}% ende parbox
+}% ende ifthenelse
+
+
+\end{document}
+
--- /dev/null
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\setlength{\voffset}{0.4cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.0cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.5cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+\begin{document}
+
+
+\fontfamily{cmss}\fontsize{9pt}{9pt}\selectfont
+
+\parbox[t]{12cm}{
+ <%company%>
+
+ <%address%>}
+\hfill
+\parbox[t]{6cm}{\hfill <%source%>}
+
+\vspace*{0.6cm}
+
+<%text_amount%> \dotfill <%decimal%>/100 \makebox[0.5cm]{\hfill}
+
+\vspace{0.5cm}
+
+\hfill <%datepaid%> \makebox[2cm]{\hfill} <%amount%>
+
+\vspace{0.5cm}
+
+<%name%>
+
+<%street%>
+
+<%zipcode%>
+
+<%city%>
+
+<%country%>
+
+\vspace{2.8cm}
+
+<%company%>
+
+\vspace{0.5cm}
+
+<%name%> \hfill <%datepaid%> \hfill <%source%>
+
+\vspace{0.5cm}
+\begin{tabularx}{\textwidth}{lXrr@{}}
+\textbf{Rechnung} & \textbf{Ausgestellt}
+ & \textbf{Fällig} & \textbf{Verrechnet} \\
+<%foreach invnumber%>
+<%invnumber%> & <%invdate%> \dotfill
+ & <%due%> & <%paid%> \\
+<%end invnumber%>
+\end{tabularx}
+
+\vfill
+
+\end{document}
+
--- /dev/null
+% request_quotation.tex für LX-Office ab V2.6.3
+% Anfrage - Einkauf
+% ----------
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\quonumber}{$(quonumber)$}
+\newcommand{\docnumber}{Anfrage Nr. {\quonumber}}
+\newcommand{\vendornumber}{$(vendornumber)$}
+\newcommand{\reqdate}{$(reqdate)$}
+\newcommand{\orddate}{$(orddate)$}
+\newcommand{\ordnumber}{$(ordnumber)$}
+\newcommand{\transdate}{$(transdate)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Anfrage Nr. \quonumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \transdate \\
+ \nonemptyline{\textbf{Unsere Kunden Nr.} &}{\vendornumber}
+ \textbf{Anfrage Nr.} & \quonumber\\
+ \nonemptyline{\textbf{Terminwunsch} &}{\reqdate}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\normalsize
+\renewcommand{\arraystretch}{1}
+
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace*{5mm}
+\lettergreeting
+hiermit bitten wir um ein für uns freibleibendes und kostenloses Angebot für die nachfolgenden Positionen.
+Eventuell preisgünstigere Alternativen bitten wir gesondert anzubieten.
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.\\[1\baselineskip]
+\ifthenelse{\isempty{$(notes)$}}{}{
+ $(notes)$\\[1\baselineskip]
+ }%
+%Mit freundlichen Grüßen\\[1\baselineskip]
+%\employeename\\[1\baselineskip]
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+ \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+ \renewcommand{\baselinestretch}{1}\footnotesize
+ {\footnotesize $(longdescription)$
+ \renewcommand{\baselinestretch}{1}\normalsize
+ }} &
+ $(qty)$ &
+ $(unit)$ &
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$} \\ %
+ $(end number)$
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+ %---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+ %---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+% \toprule
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(ordtotal)$} & \textbf{\currency}\\
+ \bottomrule
+\end{tabular}
+}
+% ---------- Lieferadresse ----------
+\ifthenelse{%
+ \equal{\shiptoname}{\name} \AND
+ \equal{\shiptodepartmentone}{\leer} \AND
+ \equal{\shiptodepartmenttwo}{\leer} \AND
+ \equal{\shiptostreet}{\street} \AND
+ \equal{\shiptozipcode}{\zipcode} \AND
+ \equal{\shiptocity}{\city}
+ }{}{
+% ---------- Umbruch dazwischen verhindern ----------
+\parbox{\textwidth}{
+\ifthenelse{\equal{$(shipvia)$}{\leer}}{}{Lieferung vorzugsweise mit $(shipvia)$.\\[1em]}
+
+\textbf{Lieferanschrift:} \hspace{2mm}
+% \rule{10em}{0mm}
+% ---------- Bereich für Lieferadresse ----------
+ \parbox[t]{7cm}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+}% ende parbox
+}% ende ifthenelse
+
+%Mit freundlichen Grüßen\\[1\baselineskip]
+%\employeename\\[1\baselineskip]
+
+\end{document}
+
--- /dev/null
+% sales_delivery_order.tex
+% Verkauf - Lieferschein
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15.Oktober 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[0.3em]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\ordnumber}{$(ordnumber)$}
+\newcommand{\donumber}{$(donumber)$}
+%\newcommand{\donumber}{Lieferschein zu Auftrag Nr. \ordnumber}
+\newcommand{\deldate}{\the\day.\the\month.\the\year}
+\newcommand{\orddate}{$(orddate)$}
+\newcommand{\quodate}{$(quodate)$}
+\newcommand{\reqdate}{$(reqdate)$}
+\newcommand{\kundennummer}{$(customernumber)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Lieferschein Nr. \donumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \deldate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Auftrag Nr.} & \ordnumber\\
+ \textbf{Lieferschein Nr.} & \donumber\\
+ \nonemptyline{\textbf{Vorraussichtl. Lieferdatum:} &}{\reqdate}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+%\lettergreeting
+Wir liefern Ihnen gemäß Ihrem Auftrag %
+\ifthenelse{\equal{\orddate}{\leer}}{}{vom \orddate{ }}%
+die unten aufgeführten Positionen.\\
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügnung.\par
+
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- Spaltendefinition ----------
+\begin{longtable}{@{}rlX@{ }rl@{}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} \\
+ \midrule
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$ &
+ $(qty)$ &
+ $(unit)$
+ \\ %
+ $(end number)$
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+
+\vfill
+
+Lieferung entgegengenommen:\\[3em]
+\rule{20em}{0.1pt}\\
+\hspace*{5em}Datum, Unterschrift \\
+
+\vfill
+\tiny
+Die zur Zeit gültigen Allgemeinen Auftrags- und Verkaufsbedingungen wurden zur Kenntnis genommen.\\
+
+Beanstandungen sind innerhalb von fünf Werktagen bekanntzugeben. Später eingehende Beanstandungen können nicht mehr berücksichtigt werden. Bitte dokumentieren Sie eventuelle Verpackungs- und Transportschäden der Lieferung anhand von Fotos.
+
+\end{document}
--- /dev/null
+% sales_order.tex
+% Auftragsbestätigung Verkauf
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\quonumber}{$(quonumber)$}
+\newcommand{\ordnumber}{$(ordnumber)$}
+\newcommand{\docnumber}{{\quonumber}}
+\newcommand{\orddate}{$(orddate)$}
+\newcommand{\quodate}{$(quodate)$}
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\reqdate}{$(reqdate)$}
+\newcommand{\transdate}{$(transdate)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Auftragsbestätigung Nr. \ordnumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \orddate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Angebot Nr.} & \docnumber\\
+ \textbf{Auftragsbestätigung Nr.} & \ordnumber\\
+ \nonemptyline{\textbf{Vorraussichtl. Lieferdatum} &}{\reqdate}
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{5mm}
+\lettergreeting
+wir bedanken uns für Ihren Auftrag %
+\ifthenelse{\equal{\orddate}{\leer}}{}{vom \orddate{ }}%
+und bestätigen Ihnen diesen wie folgt.\\
+%Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.\\[1\baselineskip]
+\ifthenelse{\isempty{$(notes)$}}{}{
+ $(notes)$\\[1\baselineskip]
+ }%
+%Mit freundlichen Grüßen\\[1\baselineskip]
+%\employeename\\[1\baselineskip]
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+%\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{~\currency}}]}}
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+ \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+ \renewcommand{\baselinestretch}{1}\footnotesize
+ {\footnotesize $(longdescription)$
+ \renewcommand{\baselinestretch}{1}\normalsize
+ }}
+ \ifthenelse{\equal{$(deliverydate_oe)$}{\leer}}{}{
+ \newline Lieferdatum:~$(deliverydate_oe)$} &
+ $(qty)$ &
+ $(unit)$ &
+ \ifthenelse{\isempty{$(sellprice)$}}{&}{
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ }\\ %
+ $(end number)$
+
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+\parbox{\textwidth}{
+%---------- Summenbereich nach recht schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+% \toprule
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(ordtotal)$} & \textbf{\currency}\\
+ \bottomrule
+\end{tabular}
+}
+% ---------- Transportmittel ----------
+$(if shipvia)$
+Lieferung per $(shipvia)$.\\[1em]
+$(end)$
+% ---------- Lieferadresse ----------
+\ifthenelse{%
+ \equal{\shiptoname}{\name} \AND
+ \equal{\shiptodepartmentone}{\leer} \AND
+ \equal{\shiptodepartmenttwo}{\leer} \AND
+ \equal{\shiptostreet}{\street} \AND
+ \equal{\shiptozipcode}{\zipcode} \AND
+ \equal{\shiptocity}{\city}
+ }{}{
+% ---------- Umbruch dazwischen verhindern ----------
+\vspace*{0.5em}
+\parbox{\textwidth}{
+% ---------- Bereich für Lieferadresse ----------
+\textbf{Lieferanschrift:}\hfill\parbox[t]{0.7\textwidth}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+}% ende parbox
+}% ende ifthenelse
+$(if payment_terms)$
+\vspace*{0.5em}
+\textbf{Zahlungsbedingungen:}\hfill\parbox[t]{0.7\textwidth}{$(payment_terms)$}\\[1em]
+$(end)$
+\vspace*{0.5em}
+%Nutzen Sie bitte für Fragen oder Änderungswünsche die oben angegebenen Kontaktmöglichkeiten.\\ \vfil
+\parbox{\textwidth}{
+Für Nachfragen steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.\\
+
+Wir sichern Ihnen eine termin- und fachgerechte Ausführung zu.\\
+
+\vspace{1.5\baselineskip}
+Mit freundlichen Grüßen\\ \vfil
+\employeename
+}% Ende Parbox
+\vfill
+\footnotesize
+Es gelten unsere Liefer- und Zahlungsbedingungen, die wir Ihnen auf Wunsch gerne zukommen lassen.
+\end{document}
--- /dev/null
+% salex_quotation.tex
+% Verkauf - Angebot
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.5 vom 15. November 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Bestellvariablen ----------
+\newcommand{\quonumber}{$(quonumber)$}
+\newcommand{\docnumber}{Angebot Nr. {\quonumber}}
+\newcommand{\quodate}{$(quodate)$}
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\reqdate}{$(reqdate)$}
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Angebot Nr. \quonumber}}
+\hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \quodate \\
+ \nonemptyline{\textbf{Gültig bis} &}{\reqdate}
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Angebot Nr.} & \quonumber\\
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{5mm}
+\lettergreeting
+wir bedanken uns für Ihre Anfrage und bieten Ihnen gemäß unserer Liefer- und Zahlungsbedingungen hiermit freibleibend die nachfolgenden Positionen an.
+\ifthenelse{\isempty{$(notes)$}}{}{
+ \newline
+ $(notes)$
+ }
+\vspace{5mm}
+
+% ---------- Die eigentliche-Tabelle ----------
+% ---------- Tabelle puffern ----------
+\begin{filecontents}{\employeetable}
+% ---------- globale Variable laufsumme deklarieren ----------
+\resetlaufsumme
+% ---------- Spaltendefinition ----------
+%\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{~\currency}}]}}
+\begin{longtable}{@{}rlX@{ }rlrr@{\makebox[\widthof{\textbf{}}]}}
+% ---------- Kopfzeile der Tabelle ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ \endfirsthead
+% ---------- Tabellenkopf nach dem Umbruch ----------
+ \textbf{Pos} &
+ \textbf{Art.Nr.} &
+ \textbf{Bezeichnung} &
+ \textbf{Menge} &
+ \textbf{ME} &
+ \textbf{EP/€} &
+ \textbf{GP/€} \\
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkUebertrPos\\[1.5em]
+ \endhead
+% ---------- Fuss der Teiltabellen ----------
+ \midrule
+ & & \multicolumn{4}{r}{} & \MarkZwsumPos \\
+ \endfoot
+% ---------- Das Ende der Tabelle ----------
+ \midrule
+% & & \multicolumn{4}{r}{ Nettobetrag:} & \MarkZwsumPos \\
+ \endlastfoot
+% ---------- Positionen ----------
+ $(foreach number)$
+ $(runningnumber)$ &
+ $(number)$ &
+ $(description)$
+ \ifthenelse{\equal{$(longdescription)$}{}}{}{\newline
+ \renewcommand{\baselinestretch}{1}\footnotesize
+ {\footnotesize $(longdescription)$
+ \renewcommand{\baselinestretch}{1}\normalsize
+ }} &
+ $(qty)$ &
+ $(unit)$ &
+ \ifthenelse{\isempty{$(sellprice)$}}{&}{
+ \numprint{$(sellprice)$}
+ \ifthenelse{\equal{$(p_discount)$}{0}}{}{ -$(p_discount)$\%} &
+ \numprint{$(linetotal)$}\Wert{$(linetotal NOFORMAT)$}
+ }\\ %
+ $(end number)$
+
+\end{longtable}
+% ---------- Ende der Hilfsdatei ----------
+\end{filecontents}
+% ---------- Puffertabelle öffnen ----------
+\LTXtable{\textwidth}{\employeetable}
+%---------- Bereich für die Summen ----------
+\parbox{\textwidth}{
+%---------- Summenbereich nach rechts schieben ----------
+\hfill
+\setlength{\tabcolsep}{0mm}
+\begin{tabular}{@{}r@{ }r@{ }l}
+% \toprule
+ {Nettobetrag:}& \numprint{$(subtotal)$}& \currency\\
+% ---------- Alle Steuern ausweisen ----------
+ $(foreach tax)$
+% {$(taxdescription)$ auf }\numprint{$(taxbase)$}~\currency: & \numprint{$(tax)$}& \\
+ {$(taxdescription)$}: & \numprint{$(tax)$}& \currency\\
+ $(end tax)$
+ \midrule
+ {\textbf{Gesamtbetrag:}} & \bfseries\numprint{$(ordtotal)$} & \textbf{\currency}\\
+ \bottomrule
+\end{tabular}
+}
+% ---------- Nachbemerkung mit variablem Abstand ----------
+\vfil
+$(if reqdate)$
+\vspace*{0.3em}
+\textbf{Das Angebot ist gültig bis zum \reqdate.}\\
+\vfil
+$(end)$
+$(if payment_terms)$
+\textbf{Zahlungsbedingungen:}\hfill\parbox[t]{0.7\textwidth}{$(payment_terms)$}\\
+\vfil
+$(end)$
+% ---------- Transportmittel ----------
+$(if shipvia)$
+Lieferung per $(shipvia)$.\\[1em]
+$(end)$
+% ---------- Lieferadresse ----------
+\ifthenelse{%
+ \equal{\shiptoname}{\name} \AND
+ \equal{\shiptodepartmentone}{\leer} \AND
+ \equal{\shiptodepartmenttwo}{\leer} \AND
+ \equal{\shiptostreet}{\street} \AND
+ \equal{\shiptozipcode}{\zipcode} \AND
+ \equal{\shiptocity}{\city}
+ }{}{
+% ---------- Umbruch dazwischen verhindern ----------
+\vspace*{0.5em}
+\parbox{\textwidth}{
+% ---------- Bereich für Lieferadresse ----------
+\textbf{Lieferanschrift:}\hfill\parbox[t]{0.7\textwidth}{
+ \shiptoname \\
+ \nonemptyline{}{\shiptodepartmentone}
+ \nonemptyline{}{\shiptodepartmenttwo}
+ \shiptostreet \\
+ \shiptocountry{ }\shiptozipcode{ }\shiptocity\\[1mm]
+ \nonemptyline{Tel: }{\shiptophone}
+ \nonemptyline{Fax: }{\shiptofax}
+ }%ende parbox
+ }% ende parbox
+}% ende ifthenelse
+\vspace*{0.5em}
+\parbox{\textwidth}{
+Sollten Sie Fragen zu unserem Angebot haben, steht Ihnen \employeename \ per Telefon (\employeetel) oder per E-Mail (\employeeemail) gerne zur Verfügung.
+Wir hoffen, dass unser Angebot Ihre Zustimmung findet und würden uns freuen Ihren Auftrag zu erhalten.\par
+\vspace{1.5\baselineskip}
+Mit freundlichen Grüßen\\ \vfil
+\employeename
+}% Ende parbox
+%\vspace{1.5\baselineskip}
+\vfill
+\textbf{Wollen Sie direkt bestellen?}\\[1.2em]
+\small{Machen Sie durch Ihren Stempel und Ihre Unterschrift unser Angebot Nr. \quonumber \ zum Auftrag.}\\[1.2em]
+\vspace{2.5\baselineskip}\\
+\rule{20em}{0.1pt}\\
+\hspace*{5em}Datum, Unterschrift \\
+\vfill
+\footnotesize
+Es gelten unsere Liefer- und Zahlungsbedingungen, die wir Ihnen auf Wunsch gerne zukommen lassen.
+\end{document}
--- /dev/null
+\documentclass[twoside]{scrartcl}
+\usepackage[frame]{xy}
+\usepackage{tabularx}
+\usepackage[utf8]{inputenc}
+\setlength{\voffset}{0.5cm}
+\setlength{\hoffset}{-2.0cm}
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0.5cm}
+\setlength{\headsep}{1cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{1.0cm}
+\setlength{\evensidemargin}{1.0cm}
+\setlength{\textwidth}{17cm}
+\setlength{\textheight}{24.5cm}
+\setlength{\footskip}{1cm}
+\setlength{\parindent}{0pt}
+\renewcommand{\baselinestretch}{1}
+\begin{document}
+
+\newlength{\descrwidth}\setlength{\descrwidth}{9cm}
+
+\newsavebox{\hdr}
+\sbox{\hdr}{
+ \fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
+
+ \parbox{\textwidth}{
+ \parbox[b]{12cm}{
+ <%company%>
+
+ <%address%>}\hfill
+ \begin{tabular}[b]{rrr@{}}
+ Tel & <%tel%>\\
+ Fax & <%fax%>
+ \end{tabular}
+
+ \rule[1.5ex]{\textwidth}{0.5pt}
+ }
+}
+
+\fontfamily{cmss}\fontshape{n}\selectfont
+
+\markboth{<%company%>\hfill <%statementdate%>}{\usebox{\hdr}}
+
+\pagestyle{myheadings}
+%\thispagestyle{empty} use this with letterhead paper
+
+\fontfamily{cmss}\fontsize{10pt}{12pt}\selectfont
+
+\vspace*{1.5cm}
+
+\parbox[t]{1cm}{\hfill}
+\parbox[t]{10.5cm}{
+
+<%name%>
+
+<%street%>
+
+<%zipcode%>
+
+<%city%>
+
+<%country%>
+
+}
+\parbox[t]{7.5cm}{
+<%if customerphone%>
+Tel: <%customerphone%>
+<%end customerphone%>
+
+<%if customerfax%>
+Fax: <%customerfax%>
+<%end customerfax%>
+
+<%email%>
+}
+\hfill
+
+\vspace{1cm}
+
+\textbf{S T A T E M E N T} \hfill
+
+\hfill <%statementdate%>
+
+\vspace{2cm}
+
+\begin{tabular*}{\textwidth}{@{}l@{\extracolsep\fill}ccrrrr@{}}
+ \textbf{Invoice \#} & \textbf{Date} & \textbf{Due} &
+ \textbf{Current} & \textbf{30} & \textbf{60} & \textbf{90+} \\
+<%foreach invnumber%>
+ <%invnumber%> & <%invdate%> & <%duedate%> &
+ <%c0%> & <%c30%> & <%c60%> & <%c90%> \\
+<%end invnumber%>
+\textbf{Subtotal} & & & <%c0total%> & <%c30total%> & <%c60total%> & <%c90total%>
+\end{tabular*}
+\rule{\textwidth}{1pt}
+
+\vspace{1cm}
+
+\hfill
+\begin{tabularx}{7cm}{Xr@{}}
+ \textbf{Total outstanding} & <%total%>
+\end{tabularx}
+
+\vfill
+
+Please make check payable to <%company%>
+
+\renewcommand{\thefootnote}{\fnsymbol{footnote}}
+
+\footnotetext[1]{\tiny
+}
+
+\end{document}
+
--- /dev/null
+;; This file was produced by lx-office
+;; for using in taxbird.
+;; You probably don't want to touch this
+;; file. In case you do want it anyway,
+;; be warned: BE CAREFUL!!
+;;
+'("Umsatzsteuervoranmeldung <%year%>" (
+("vend-id" . "74931")
+("land-lieferant" . "<%elsterland%>")
+("name-lieferant" . "<%company%>")
+("berufsbez" . "")
+("strasse-lieferant" . "<%co_street%>")
+("plz-lieferant" . "<%co_zip%> ")
+("ort-lieferant" . "<%co_city%>")
+("vorwahl" . "<%co_phone_prefix%>")
+("anschluss" . "<%co_phone%>")
+("land" . "<%taxbird_land_nr%>")
+("zeitraum" . "<%taxbird_period%>")
+("stnr" . "<%taxbird_steuernummer%>")
+
+<%foreach id%>
+("<%id%>" . "<%amount%>")<%end%>
+))
\ No newline at end of file
--- /dev/null
+% German USTVA template for taxreports
+% Contributed by Marcus Habermehl
+% Based on template by Jacky und Stefan Tenne (German-ustva-2008.tex)
+%
+%
+\documentclass[twoside]{scrartcl}
+\usepackage{a4,german}
+\usepackage[frame]{xy}
+\usepackage[utf8]{inputenc}
+\usepackage[german]{babel}
+\usepackage{graphicx}
+\usepackage{tabularx}
+\usepackage{times, german}
+\usepackage{german}
+\setlength{\voffset}{-0.7cm} %hier wird die Höhenverschiebung
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwärts
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0cm}
+\setlength{\headsep}{0cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{0cm}
+\setlength{\evensidemargin}{0cm}
+\setlength{\textwidth}{20.9cm}
+\setlength{\textheight}{29.6cm}
+\setlength{\footskip}{-0cm}
+\setlength{\parindent}{1mm}
+
+\begin{document}
+
+\fontfamily{cmss}\fontshape{n}\large\selectfont
+\pagestyle{myheadings}
+\markboth{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 54 783 700 790,page=2]{ustva-2012.pdf}}}%Seite 2
+{\protect\scalebox{1.045}[1.045]{\protect\includegraphics[viewport = 70 700 700 790,page=1]{ustva-2012.pdf}}}%Seite 1
+\hspace{1mm}
+\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{7mm}p{28mm}p{3mm}}
+\multicolumn{7}{c}{}\\[-2mm]
+ & \multicolumn{6}{l}{<%steuernummer%>}\\
+\multicolumn{7}{c}{}\\[15mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
+\multicolumn{2}{p{7.5cm}}{} & & & & &\\[3mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[3mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%co_street%>}}& & & & &\\[-1mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%co_city%>}}& & & &<%FA_10%> &\\[1mm]
+\multicolumn{2}{p{7.5cm}}{
+<%if tel%>
+\small{Tel: <%tel%>}~--~
+<%else%>
+\small{~}
+<%end tel%>
+<%if fax%>
+\small{Fax: <%fax%>}
+<%else%>
+\small{~}
+<%end fax%>
+}& & & & &\\[1.8mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}&~& & & &\\[-1mm]
+\end{tabular}\\[2.5mm]
+\begin{tabular}[b]{p{99mm}p{26.5mm}p{4.55mm}p{4mm}p{35mm}}
+&&&&\\[9.5mm]
+\multicolumn{2}{r}{<%41%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%44%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%49%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%43%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%48%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%81%>} & & \multicolumn{2}{r}{<%811%>}\\[1.8mm]
+\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%861%>}\\[1.8mm]
+\multicolumn{2}{r}{<%35%>} & & \multicolumn{2}{r}{<%36%>}\\[1.8mm]
+\multicolumn{2}{r}{<%77%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%76%>} & & \multicolumn{2}{r}{<%80%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%91%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%89%>} & & \multicolumn{2}{r}{<%891%>}\\[1.8mm]
+\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%931%>}\\[1.8mm]
+\multicolumn{2}{r}{<%95%>} & & \multicolumn{2}{r}{<%98%>}\\[1.8mm]
+\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%42%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%60%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%21%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{<%45%>} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z43%>}\\
+\end{tabular}
+\newpage
+
+\vspace*{-9.5mm}\hspace{27mm}<%steuernummer%>\\[-2.7mm]
+\begin{tabular}[b]{p{99mm}p{25.2mm}p{2.55mm}p{10mm}p{32mm}}
+&&&&\\
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z45%>}\\[13.5mm]
+\multicolumn{2}{r}{<%46%>} & & \multicolumn{2}{r}{<%47%>}\\[1.8mm]
+\multicolumn{2}{r}{<%52%>} & & \multicolumn{2}{r}{<%53%>}\\[1.8mm]
+\multicolumn{2}{r}{<%73%>} & & \multicolumn{2}{r}{<%74%>}\\[1.8mm]
+\multicolumn{2}{r}{<%84%>} & & \multicolumn{2}{r}{<%85%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%65%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z53%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%61%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%67%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%63%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%64%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%59%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%Z62%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%69%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%39%>}\\[1.8mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%83%>}}\\[25.6mm]
+\end{tabular}\\[35mm]
+<%if FA_steuerberater%>
+\vspace{11mm}
+\begin{list}{}{
+\setlength{\leftmargin}{2mm}
+\setlength{\itemsep}{0mm}
+\setlength{\parsep}{0mm}
+%\setlength{\topsep}{0mm}
+%\setlength{\parskip}{0mm}
+%\setlength{\partopsep}{0mm}
+}
+\begin{small}
+\item <%FA_steuerberater_name%>
+\item <%FA_steuerberater_street%>
+\item <%FA_steuerberater_city%>
+\item Tel:~<%FA_steuerberater_tel%>
+\end{small}\\[15mm]
+\item <%Datum_heute%>,
+\end{list}
+<%end FA_steuerberater%>
+<%if not FA_steuerberater%>
+\begin{list}{}{
+\setlength{\leftmargin}{2mm}
+\setlength{\itemsep}{0mm}
+\setlength{\parsep}{0mm}
+%\setlength{\topsep}{0mm}
+%\setlength{\parskip}{0mm}
+%\setlength{\partopsep}{0mm}
+}
+\begin{small}
+\item ~
+\item ~
+\item ~
+\item ~
+\end{small}\\[26mm]
+\item <%Datum_heute%>,
+\end{list}
+<%end FA_steuerberater%>
+\end{document}
--- /dev/null
+<!DOCTYPE html PUBLIC "-//W3C//DTD HTML 4.01 Transitional//EN">
+<html>
+<head>
+ <meta content="text/html; charset=utf-8" http-equiv="content-type">
+ <title>Vorschau: UStVa</title>
+<!--
+Optik an Formulare angepasst: Hartmut Goebel <h.goebel@goebel-consult.de>
+Variablen hinzugefügt: Udo Spallek <udono@gmx.net>
+Text-Erklärung und unterschiedliche Zeilenfärbung ergänzt: Kai-Martin Knaak <kmk@familieknaak.de>
+-->
+ <style>
+table {
+ text-align: right;
+ border:0;
+ border-collapse:collapse;
+}
+td {
+ font-size:100%;
+ vertical-align:top;
+}
+td.text {
+ text-align: left;
+ background-color:#BDBEBD;
+}
+td.text2 {
+ text-align: left;
+ background-color:#ADBEBD;
+}
+td.spalte,
+td.zeile,
+td.betrag {
+ border:solid thin black;
+}
+td.spalte { font-weight:bold; font-size:120%; }
+td.zeile { font-weight:bold; }
+td.betrag { width:10em; }
+td.summe { border:solid medium black; }
+td.spacer { border:0 }
+
+tr.uebertrag td { border-top:solid medium black; }
+b.h3 { font-size:120%; }
+.ausfuellen { background-color:#FFFFC0; }
+.nodis { display:none; }
+ </style>
+</head>
+<body>
+<h1>Vorschau Umsatzsteuer-Voranmeldung</h1>
+<h2>Zeitraum vom <%fromdate%> bis <%todate%> </h2>
+
+<!-- Diese HTML-Formular ist nicht selbstrechnend.
+<p><small>Wenn ein (selbstrechnendes) Formular verwendet wird, genügt es, die
+gelb hinterlegten Felder auszufüllen. Die anderen Felder werden dann
+automatisch berechnet.</small></p>
+-->
+
+<table width="100%">
+<tr align="left">
+ <td class="text">Steuernummer: <%steuernummer%></td>
+ <td class="text" width="100px"> </td>
+ <td class="text" align="right">Datum (<%Datum_heute%>)</td>
+</tr>
+<tr>
+ <td class="text" colspan="3"><br /></td>
+</tr>
+<tr align="left">
+ <td class="text">
+ Finanzamt <%FA_Name%><br />
+ <%FA_Strasse%><br />
+ <%FA_PLZ%> <%FA_Ort%><br />
+ Fax: <%FA_FAX%>
+ </td>
+ <td class="text"> </td>
+ <td class="text">
+ Firma <%company%><br />
+ <%if company_street%>
+ <%company_street%><br />
+ <%company_city%><br />
+ <%end company_street%>
+ <%if not company_street%>
+ <%address%><!--used Address-->
+ <%end company_street%>
+ </td>
+</tr>
+<tr>
+ <td class="text" colspan="3"><br />
+ </td>
+</tr>
+</table>
+<table border="0" cellspacing="2" cellpadding="2">
+ <tbody>
+ <tr>
+ <td class="text"><b class="h3">I. Anmeldung der
+Umsatzsteuer-Vorauszahlung </b></td>
+ <td colspan="4"></td>
+ </tr>
+ <tr>
+ <td class="text"><b class="h4">Lieferungen und sonstige Leistungen</b></td>
+ <td colspan="4"></td>
+ </tr>
+ <tr>
+ <td class="text2">an innergemeinschaftliche Abnehmer <b>mit</b> USt-IdNr</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>41<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%41%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text">neuer Fahrzeuge an Abnehmer <b>ohne</b> USt-IdNr</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>44<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%44%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text2">neuer Fahrzeuge außerhalb eines Unternehmens</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>49<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%49%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text">Weitere steuerfreie Umsätze mit Vorsteuerabzug</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>43<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%43%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text2">Steuerfreie Umsätze ohne
+Vorsteuerabzug. </b><br />Umsätze nach § 4 Nr. 8 bis 20 UStG</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>48<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%48%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+
+ <tr>
+ <td class="text"><b class="h4">Steuerpflichtige Umsätze</b></td>
+ <td colspan="4"></td>
+ </tr>
+<%if not year2007%>
+ <tr>
+ <td class="text2">zum Steuersatz von 16 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>51<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%51%><br></td>
+ <td class="spalte"><span class="nodis">(Spalte 51 rechts)</span></td>
+ <td class="betrag"><%511%></td>
+ </tr>
+<%end year2007%>
+<%if year2007%>
+ <tr>
+ <td class="text2">zum Steuersatz von 19 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>81<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%81%><br></td>
+ <td class="spalte"><span class="nodis">(Spalte 81 rechts)</span></td>
+ <td class="betrag"><%811%></td>
+ </tr>
+<%end year2007%>
+
+ <tr>
+ <td class="text">zum Steuersatz von 7 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>86<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%86%></td>
+ <td class="spalte"><span class="nodis">(Spalte 86 rechts)</span></td>
+ <td class="betrag"><%861%></td>
+ </tr>
+ <tr>
+ <td class="text2">andere Steuersätze</td>
+ <td class="spalte ausfuellen"><span class="nodis"></span>35 <span class="nodis"></span></td>
+ <td class="betrag ausfuellen"><%35%></td>
+ <td class="spalte">36</td>
+ <td class="betrag ausfuellen"><%36%></td>
+ </tr>
+ <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
+ <tr>
+ <td class="text">Lieferungen in das übrige Gemeinschaftsgebiet <b>mit</b> USt-IdNr</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>77<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%77%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text2">Umsätze, nach §24 UStG (Sägewerkserzeugnisse, alkoholische Getränke etc.)</td>
+ <td class="spalte ausfuellen"><span class="nodis"></span>76 <span class="nodis"></span></td>
+ <td class="betrag ausfuellen"><%76%></td>
+ <td class="spalte">80</td>
+ <td class="betrag ausfuellen"><%80%></td>
+ </tr>
+ <tr><td class="text"> </td><td class="spacer" colspan="4"></td></tr>
+ <tr>
+ <td class="text"><b class="h3">Innergemeinschaftliche Erwerbe</b></td>
+ <td colspan="4"></td>
+ </tr>
+ <tr>
+ <td class="text2">Steuerfrei nach §4b UStG</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>91<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen" width="70"><%91%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+<%if not year2007%>
+ <tr>
+ <td class="text">Steuerpflichtige zum Steuersatz von 16 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>97<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%97%><br></td>
+ <td class="spalte"><span class="nodis">(Spalte 97 rechts)</span></td>
+ <td class="betrag"><%971%></td>
+ </tr>
+<%end if year2007%>
+<%if year2007%>
+ <tr>
+ <td class="text">Steuerpflichtige zum Steuersatz von 19 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>89<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%89%><br></td>
+ <td class="spalte"><span class="nodis">(Spalte 89 rechts)</span></td>
+ <td class="betrag"><%891%></td>
+ </tr>
+<%end if year2007%>
+ <tr>
+ <td class="text2">zum Steuersatz von 7 v.H.</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>93<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%93%></td>
+ <td class="spalte"><span class="nodis">(Spalte 93 rechts)</span></td>
+ <td class="betrag"><%931%></td>
+ </tr>
+ <tr>
+ <td class="text">zu anderen Steuersätzen</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>95<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%95%></td>
+ <td class="spalte">98</td>
+ <td class="betrag"><%98%></td>
+ </tr>
+ <tr>
+ <td class="text2"><b class="h4">neuer Fahrzeuge von Lieferern</b>
+ von Lieferanten <b>ohne</b> USt.IdNr. <br class="nodis" />
+ zum allgemeinen Steuersatz</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>94<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%94%></td>
+ <td class="spalte"><span class="nodis">(Spalte </span>96<span class="nodis">)</span></td>
+ <td class="betrag"><%96%></td>
+ </tr>
+ <tr><td class="text"> </td><td colspan="4"></td></tr>
+ <tr>
+ <td class="text">Lieferungen des ersten Abnehmers bei
+ innergemeinschaftlichen Dreiecksgeschften (§25b Abs. 2 UStG)</td>
+ <td class="spalte ausfuellen">42</td>
+ <td class="betrag ausfuellen" width="70"><%42%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+ <tr>
+ <td class="text2">Steuerpflichtige Umstze im Sinne, für die der
+ <b>Leistungsempfänger die Steuer schuldet</b></td>
+ <td class="spalte ausfuellen">60</td>
+ <td class="betrag ausfuellen" width="70"><%60%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+<%if year2010%>
+ <tr>
+ <td class="text2"><b>Nicht steuerbare Leistungen</b> gem. § 18b Satz 1 Nr. 2 UStG</td>
+ <td class="spalte ausfuellen">21</td>
+ <td class="betrag ausfuellen" width="70"><%21%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+<%end if year2010%>
+ <tr>
+ <td class="text">Im Inland nicht steuerbare Umsätze</td>
+ <td class="spalte ausfuellen">45</td>
+ <td class="betrag ausfuellen" width="70"><%45%><br></td>
+ <td class="spalte"><span class="nodis"></span></td>
+ <td class="betrag"></td>
+ </tr>
+
+ <tr><td class="text"> </td><td class="spacer" colspan="2"></td><td colspan="2"></td></tr>
+
+ <tr>
+ <td class="text" colspan="3"><b class="h3">Übertrag</td>
+ <td class="zeile"><span class="nodis">(</span>Zeile 43<span class="nodis">)</span></td>
+ <td class="betrag"><%Z43%></td>
+ </tr>
+
+ <tr class="uebertrag">
+ <td class="text" colspan="3"><b class="h3">Übertrag</td>
+ <td class="zeile"><span class="nodis">(</span>Zeile 45<span class="nodis">)</span></td>
+ <td class="betrag"><%Z45%></td>
+ </tr>
+
+<%if year2010%>
+ <tr>
+ <td class="text2">Im Inland steuerpflichtige sonstige Leistungen von im übrigen Gemeinschaftsgebiet ansässigen Unternehmen (§13b Abs. 1 UStG)</td>
+ <td class="spalte ausfuellen">46</td>
+ <td class="betrag ausfuellen"><%46%></td>
+ <td class="spalte">47</td>
+ <td class="betrag"><%47%></td>
+ </tr>
+<%end if year2010%>
+ <tr>
+ <td class="text2">Leistungen eines im Ausland ansässigen Unternehmers</td>
+ <td class="spalte ausfuellen">52</td>
+ <td class="betrag ausfuellen"><%52%></td>
+ <td class="spalte">53</td>
+ <td class="betrag"><%53%></td>
+ </tr>
+ <tr>
+ <td class="text">Lieferungen sicherungsbereigneter Gegenstände und
+ Umsätze, die unter das GrEStG fallen.</td>
+ <td class="spalte ausfuellen">73</td>
+ <td class="betrag ausfuellen"><%73%></td>
+ <td class="spalte">74</td>
+ <td class="betrag"><%74%></td>
+ </tr>
+ <tr>
+ <td class="text2">Bauleistungen eines im Inland ansässigen Unternehmers</td>
+ <td class="spalte ausfuellen">84</td>
+ <td class="betrag ausfuellen"><%84%></td>
+ <td class="spalte">85</td>
+ <td class="betrag"><%85%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Steuer wegen Wechsel der Besteuerungsform und
+ Nachsteuer auf versteuerte Anzahlungen wegen Steuersatzerhöhung.</td>
+ <td class="spalte ausfuellen">65</td>
+ <td class="betrag ausfuellen"><%65%></td>
+ </tr>
+
+
+
+ <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
+
+ <tr>
+ <td class="text2" colspan="3"><b class="h3">Umsatzsteuer</td>
+ <td class="zeile"><span class="nodis">(</span>Zeile 53<span class="nodis">)</span></td>
+ <td class="betrag"><%Z53%></td>
+ </tr>
+
+ <tr><td class="text" colspan="3"> </td><td class="spacer" colspan="4"></td></tr>
+
+ <tr>
+ <td class="text" colspan="3"><b class="h3">Abziehbare Vorsteuerbeträge</b></td>
+ <td colspan="2"></td></tr>
+ </tr>
+
+ <tr>
+ <td class="text2" colspan="3">Vorsteuerbeträge von Rechnungen von anderen Unternehmern</td>
+ <td class="spalte ausfuellen"><span class="nodis">(Spalte </span>66<span class="nodis">)</span></td>
+ <td class="betrag ausfuellen"><%66%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Vorsteuerbeträge aus dem innergemeinschaftlichen Erwerb</td>
+ <td class="spalte ausfuellen">61</td>
+ <td class="betrag ausfuellen"><%61%></td>
+ </tr>
+ <tr>
+ <td class="text2" colspan="3">Entrichtete Einfuhrumsatzsteuer</td>
+ <td class="spalte ausfuellen">62</td>
+ <td class="betrag ausfuellen"><%62%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Vorsteuerbeträge aus Leistungen im Sinne
+ des §13b Abs. 1 UStG</td>
+ <td class="spalte ausfuellen">67</td>
+ <td class="betrag ausfuellen"><%67%></td>
+ </tr>
+ <tr>
+ <td class="text2" colspan="3">Vorsteuerbeträge, die nach allgemeinen
+ Durchschnittsästzen berechnet sind </td>
+ <td class="spalte ausfuellen">63</td>
+ <td class="betrag ausfuellen"><%63%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Berichtigung des Vorsteuerabzugs</td>
+ <td class="spalte ausfuellen">64</td>
+ <td class="betrag ausfuellen"><%64%></td>
+ </tr>
+ <tr>
+ <td class="text2" colspan="3">Vorsteuerabzug für innergemeinschaftliche Lieferungen
+ neuer Fahrzeuge außerhalb eines Unternehmens sowie von Kleinunternehmern</td>
+ <td class="spalte ausfuellen">59</td>
+ <td class="betrag ausfuellen"><%59%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Verbleibender Betrag</td>
+ <td class="zeile"><span class="nodis">(</span>Zeile 62<span class="nodis">)</span></td>
+ <td class="betrag"><%Z62%></td>
+ </tr>
+
+ <tr>
+ <td class="text2" colspan="3"><b class="h3">Andere Steuerbeträge</b></td>
+ <td colspan="2"></td></tr>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">in Rechnungen unrichtig oder unberechtigt ausgewiesene
+ Steuerbeträge sowie Steuerbeträge, die nach
+ §4 Nr. 4a, § 6a Abs. 4, §7 oder §25b UStG geschuldet werden</td>
+ <td class="spalte ausfuellen">69</td>
+ <td class="betrag ausfuellen"><%69%></td>
+ </tr>
+
+ <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
+
+ <tr>
+ <td class="text2" colspan="3"><b class="h3">Umsatzsteuer-Vorauszahlung/Überschuss</b></td>
+ <td class="zeile"><span class="nodis">(</span>Zeile 65<span class="nodis">)</span></td>
+ <td class="betrag"><%Z65%></td>
+ </tr>
+ <tr>
+ <td class="text" colspan="3">Anrechnung (Abzug) der festgesetzten Sondervorauszahlung
+ für Dauerfristverlängerung (nur in der letzten Voranmeldung des
+ Besteuerungszeitraums, ausfüllen)</td>
+ <td class="spalte ausfuellen">39</td>
+ <td class="betrag ausfuellen"><%39%></td>
+ </tr>
+
+ <tr><td class="text" colspan="3"> </td><td colspan="4"></td></tr>
+
+ <tr class="noborder">
+ <td class="text2" colspan="3"><b class="h3">Verbleibende Umsatzsteuer-Vorauszahlung bzw.
+ Verbleibender Überschuss</b></td>
+ <td class="spalte ausfuellen">83</td>
+ <td class="summe"><%83%></td>
+ </tr>
+
+ </tbody>
+</table>
+<%if FA_steuerberater%>
+<p>
+Steuerberater:<br />
+<%FA_steuerberater_name%><br />
+<%FA_steuerberater_street%><br />
+<%FA_steuerberater_city%><br />
+Tel: <%FA_steuerberater_tel%></p>
+<%end FA_steuerberater%>
+</body>
+</html>
--- /dev/null
+% German USTVA template for taxreports
+%
+% Contributed by Jens Koerner, Peter Schorer, Udo Spallek
+%
+%
+\documentclass[twoside]{scrartcl}
+\usepackage{a4,german}
+\usepackage[frame]{xy}
+\usepackage[utf8]{inputenc}
+\usepackage[german]{babel}
+\usepackage{graphicx}
+\usepackage{tabularx}
+\usepackage{times, german}
+\usepackage{german}
+\setlength{\voffset}{-0.8cm} %hier wird die Höhenverschiebung getÀtigt
+\setlength{\hoffset}{-1cm} %und hier die Verschiebung seitwÀrts
+\setlength{\topmargin}{0cm}
+\setlength{\headheight}{0cm}
+\setlength{\headsep}{0cm}
+\setlength{\topskip}{0pt}
+\setlength{\oddsidemargin}{0cm}
+\setlength{\evensidemargin}{0cm}
+\setlength{\textwidth}{20.9cm}
+\setlength{\textheight}{29.6cm}
+\setlength{\footskip}{-0cm}
+\setlength{\parindent}{0pt}
+
+\begin{document}
+
+\fontfamily{cmss}\fontshape{n}\large\selectfont
+\pagestyle{myheadings}
+\markboth{\hspace{7mm}\protect\includegraphics[viewport = 60 700 700 790]{ustva2.pdf}}
+{\protect\includegraphics[viewport = 60 700 700 790]{ustva1.pdf}}
+\hspace{1mm}
+\begin{tabular}[b]{p{7mm}p{5cm}p{22.5mm}p{24mm}p{5mm}p{27mm}p{3mm}}
+\multicolumn{7}{c}{}\\[-2mm]
+ & \multicolumn{6}{l}{<%steuernummer%>}\\
+\multicolumn{7}{c}{}\\[15mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_Name%>} & & & & &\\[-4mm]
+\multicolumn{2}{p{7.5cm}}{} & & & & &\\[1mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_Strasse%>} & &<%0401%>&<%0407%>&&<%0441%>\\[1.2mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0402%>&<%0408%>&&<%0442%>\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{<%FA_PLZ%> <%FA_Ort%>} & &<%0403%>&<%0409%>&&<%0443%>\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0404%>&<%0410%>&&<%0444%>\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{} & &<%0405%>&<%0411%>&&\\[1.25mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%company%>}} & &<%0406%>&<%0412%>&&\\[-1mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%company_street%>}}& & & & &\\[-1mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%company_city%>}}& & & & &\\[1mm]
+\multicolumn{2}{p{7.5cm}}{
+<%if tel%>
+\small{Tel: <%tel%>}~--~
+<%end tel%>
+<%if fax%>
+\small{Fax: <%fax%>}
+<%end fax%>
+}& & & &<%FA_10%> &\\[-1mm]
+\multicolumn{2}{p{7.5cm}}{\small{<%email%>}}& & & & &\\[-1mm]
+\end{tabular}\\[28.5mm]
+\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
+&&&&\\[42mm]
+\multicolumn{2}{r}{<%51%>} & & \multicolumn{2}{r}{<%51r%>}\\[1.5mm]
+\multicolumn{2}{r}{<%86%>} & & \multicolumn{2}{r}{<%86r%>}\\[46mm]
+\multicolumn{2}{r}{<%97%>} & & \multicolumn{2}{r}{<%97r%>}\\[1.5mm]
+\multicolumn{2}{r}{<%93%>} & & \multicolumn{2}{r}{<%93r%>}\\[7.9mm]
+\multicolumn{2}{r}{<%94%>} & & \multicolumn{2}{r}{<%96%>}\\[14mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\
+%\multicolumn{2}{||r|}{1000} & & & \\
+%\multicolumn{2}{||r|}{1000} & & \multicolumn{2}{r}{100.000.000~~00}\\
+%\multicolumn{3}{||r|}{1.000.000.000~~00} & \multicolumn{2}{r}{100.000.000~~00}\\
+\end{tabular}
+
+\newpage
+
+\vspace*{-10mm}\hspace{27mm}<%steuernummer%>\\[-2.5mm]
+\begin{tabular}[b]{p{95mm}p{28mm}p{2.55mm}p{4mm}p{35mm}}
+&&&&\\
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%45%>}\\[46mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%43%>}\\[7.9mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%66%>}\\[7.9mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{<%62%>}\\[58.5mm]
+\multicolumn{2}{r}{} & & \multicolumn{2}{r}{\textbf{<%67%>}}\\[26mm]
+\end{tabular}\\[35mm]
+<%if FA_steuerberater%>
+\vspace{11mm}
+\begin{list}{}{
+\setlength{\leftmargin}{2mm}
+\setlength{\itemsep}{0mm}
+\setlength{\parsep}{0mm}
+%\setlength{\topsep}{0mm}
+%\setlength{\parskip}{0mm}
+%\setlength{\partopsep}{0mm}
+}
+\begin{small}
+\item <%FA_steuerberater_name%>
+\item <%FA_steuerberater_street%>
+\item <%FA_steuerberater_city%>
+\item Tel:~<%FA_steuerberater_tel%>
+\end{small}\\[15mm]
+\item <%Datum_heute%>,
+\end{list}
+<%end FA_steuerberater%>
+<%if not FA_steuerberater%>
+\begin{list}{}{
+\setlength{\leftmargin}{2mm}
+\setlength{\itemsep}{0mm}
+\setlength{\parsep}{0mm}
+%\setlength{\topsep}{0mm}
+%\setlength{\parskip}{0mm}
+%\setlength{\partopsep}{0mm}
+}
+\begin{small}
+\item ~
+\item ~
+\item ~
+\item ~
+\end{small}\\[26mm]
+\item <%Datum_heute%>,
+\end{list}
+<%end FA_steuerberater%>
+\end{document}
--- /dev/null
+<?xml version="1.0" encoding="UTF-8" ?>
+<!-- Diese Datei ist mit Lx-Office <%version%> generiert -->
+<WinstonAusgang>
+ <Formular Typ="UST"></Formular>
+ <Ordnungsnummer><%elsterFFFF%><%elstersteuernummer%></Ordnungsnummer>
+ <AnmeldeJahr><%year%></AnmeldeJahr>
+ <AnmeldeZeitraum><%period%></AnmeldeZeitraum>
+
+<%foreach id%>
+ <Kennzahl nr="<%id%>"><%amount%></Kennzahl>
+<%end%>
+
+</WinstonAusgang>
+
--- /dev/null
+% zahlungserinnerung.tex
+% Zahlungserinnerung Verkauf
+% Überarbeitet von Norbert Simon, n.simon@linet-services.de
+% Version 2.1 vom 21.Oktober 2011
+% Basiert auf der Arbeit von kmk@lilalaser.de / 2007
+% Diese Vorlage steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+% ----------
+% config: tag-style=$( )$
+% ----------
+
+\documentclass[twoside]{scrartcl}
+\usepackage{fancyhdr} % Für den Seitenkopf und -Fuß
+\usepackage{ifpdf} % Erlaubt eine Code-Weiche für PDF, oder DVI Ausgabe
+\usepackage{xifthen} % Allgemeine Code-Weiche
+\usepackage{graphicx} % Fuer die Einbindung der Logo-Graphik
+\usepackage{german} % Deutsche Trenn-Tabelle
+\usepackage[utf8]{inputenc} % Umlaute direkt eingeben
+\usepackage{textcomp} % Sonderzeichen
+\usepackage{lastpage} % Fuer die Angabe "Seite 2 von 5"
+\usepackage{filecontents} % Um von latex aus eine Datei schreiben zu koennen
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage{ltxtable} % Mehrseiten-Tabellen mit variabler Spaltenbreite
+\usepackage{booktabs} % Striche in Tabellen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage[$(if myconfig_output_numberformat =~ "1.000,00")$german$(else)$$(if myconfig_output_numberformat =~ "1000,00")$germannosep$(else)$$(if myconfig_output_numberformat =~ "1,000.00")$english$(else)$englishnosep$(end)$$(end)$$(end)$]{zwischensumme} % Lokales Makro zur Berechnung der Zwischensummen
+\usepackage{microtype,relsize} %Feinpositionierung, Sperren von Text
+\newcommand*{\sperren}[1]{\normalsize\textls*[200]{#1}} %Sperrung Überrschriften
+
+% ---------- Report-Variablen zur Verwendung in kivitendobriefkopf.tex ----------
+% ---------- Die eigenen Daten ----------
+\newcommand{\employeename}{$(employee_name)$}
+\newcommand{\employeecompany}{$(employee_company)$}
+\newcommand{\employeeaddress}{$(employee_address)$}
+\newcommand{\employeetel}{$(employee_tel)$}
+\newcommand{\employeefax}{$(employee_fax)$}
+\newcommand{\employeeemail}{$(employee_email)$}
+\newcommand{\employeecoustid}{$(employee_co_ustid)$}
+\newcommand{\employeetaxnumber}{$(employee_taxnumber)$}
+\newcommand{\employeetable}{tabelle$(employee_login)$.tex}
+
+% ---------- Eigene Bankverbindung falls nicht im Briefkopf gesetzt ----------
+% \newcommand{\companybank}{$(company_bank)$}
+% \newcommand{\companybankcode}{$(company_bank_code)$}
+% \newcommand{\companyaccountnumber}{$(company_account_number)$}
+
+% ---------- Adressat ----------
+\newcommand{\name}{$(name)$}
+\newcommand{\departmentone}{$(department_1)$}
+\newcommand{\departmenttwo}{$(department_2)$}
+\newcommand{\cpgreeting}{$(cp_greeting)$}
+\newcommand{\cptitle}{$(cp_title)$}
+\newcommand{\cpgivenname}{$(cp_givenname)$}
+\newcommand{\cpname}{$(cp_name)$}
+\newcommand{\street}{$(street)$}
+\newcommand{\country}{$(country)$}
+\newcommand{\zipcode}{$(zipcode)$}
+\newcommand{\city}{$(city)$}
+\newcommand{\phone}{$(customerphone)$}
+\newcommand{\fax}{$(customerfax)$}
+\newcommand{\lettergreeting}{
+ \ifthenelse{\equal{$(cp_gender)$}{f}}
+ {Sehr geehrte Frau $(cp_name)$,}
+ {\ifthenelse{\equal{$(cp_gender)$}{m}}
+ {Sehr geehrter Herr $(cp_name)$,}
+ {Sehr geehrte Damen und Herren,}
+ }\\[1\baselineskip]
+}
+
+% ---------- Rechnungsvariablen ----------
+\newcommand{\kundennummer}{$(customernumber)$}
+\newcommand{\quonumber}{$(quonumber)$} % Angebotsnummer
+\newcommand{\ordnumber}{$(ordnumber)$} % Auftragsnummer bei uns
+\newcommand{\cusordnumber}{$(cusordnumber)$} % Auftragsnummer beim Kunden
+\newcommand{\invnumber}{$(invnumber)$} % Rechnungsnummer
+\newcommand{\docnumber}{Rechnungsnummer: \invnumber}
+\newcommand{\quodate}{$(quodate)$} % Angebotsdatum
+\newcommand{\orddate}{$(orddate)$} % Auftragsdatum
+\newcommand{\reqdate}{$(reqdate)$} % gewuenschtes Lieferdatum
+\newcommand{\deliverydate}{$(deliverydate)$} % Lieferdatum
+\newcommand{\invdate}{$(invdate)$} % Rechnungsdatum
+\newcommand{\terms}{$(terms)$} % Zahlungsfrist
+\newcommand{\duedate}{$(duedate)$} % Fälligkeitsdatum
+\newcommand{\invtotal}{$(invtotal)$} % Gesamtbetrag
+\newcommand{\paid}{$(paid)$} % Schon bezahlt
+\newcommand{\total}{$(total)$} % Restbetrag
+\newcommand{\dunningid}{$(dunning_id)$} % ID Zahlungserinnerung
+\newcommand{\dunningdate}{$(dunning_date)$} % Datum der Zahlungserinnerung
+
+% ---------- Lieferadresse ----------
+\newcommand{\shiptoname}{$(shiptoname)$}
+\newcommand{\shiptocontact}{$(shiptocontact)$}
+\newcommand{\shiptodepartmentone}{$(shiptodepartment_1)$}
+\newcommand{\shiptodepartmenttwo}{$(shiptodepartment_2)$}
+\newcommand{\shiptostreet}{$(shiptostreet)$}
+\newcommand{\shiptocity}{$(shiptocity)$}
+\newcommand{\shiptocountry}{$(shiptocountry)$}
+\newcommand{\shiptophone}{$(shiptophone)$}
+\newcommand{\shiptozipcode}{$(shiptozipcode)$}
+\newcommand{\shiptofax}{$(shiptofax)$}
+
+% ---------- Währungszeichen ----------
+\newcommand{\currency}{$(currency)$}
+\ifthenelse{\equal{\currency}{EUR}}{\let\currency\euro}{}
+\ifthenelse{\equal{\currency}{YEN}}{\let\currency\textyen}{}
+\ifthenelse{\equal{\currency}{GBP}}{\let\currency\pounds}{}
+\ifthenelse{\equal{\currency}{USD}}{\let\currency\$}{}
+
+% ---------- Ende Reportvariablen-Umsetzung ----------
+
+% ---------- Briefkopf dazuladen ----------
+\input{kivitendobriefkopf}
+
+\begin{document}
+% ---------- Schrift Hauptdokuments (Computermodern-sanserif) ----------
+% \fontfamily{cmss}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+% ---------- Schrift Helvetica ------------------------
+\fontfamily{phv}\fontsize{10}{12pt plus 0.12pt minus 0.1pt}\selectfont
+
+% ---------- Firmenlogo nur erste Seite ----------
+\thispagestyle{briefkopf}
+
+% ---------- Datum und Nummern ----------
+% Position unterhalb des Briefkopfs
+\vspace*{\vlogospacing}
+\renewcommand{\arraystretch}{0.9}
+\begin{minipage}[b]{177mm}
+\sperren{\textbf{Zahlungserinnerung}}
+ \hfill
+ \small
+ \begin{tabular}[b]{r@{\hspace{2mm}}p{\hlogospacing}}
+ \textbf{Seite} & {\thepage} von \pageref{LastPage}\\
+ \textbf{Datum} & \dunningdate \\
+ \textbf{Kunden Nr.} & \kundennummer\\
+ \textbf{Rechnung Nr.} & \invnumber\\
+ \textbf{Ansprechpartner} & \employeename\\
+ \nonemptyline{\textbf{Durchwahl} &}{\employeetel}
+ \nonemptyline{\textbf{E-Mail} &}{\employeeemail}
+ \end{tabular}\\[10mm plus 20mm minus 10mm]
+\end{minipage}
+\renewcommand{\arraystretch}{1}
+\normalsize
+% ---------- Begrüßung und Bemerkungen ----------
+\vspace{ 5mm}
+\lettergreeting
+man kann seine Augen nicht überall haben -- offensichtlich haben Sie übersehen, die folgenden Rechnungen zu begleichen: \\
+\vspace{0.5cm} \\
+\setlength{\tabcolsep}{0mm}
+%\begin{tabularx}{\textwidth}{l@{\hspace*{2cm}}X@{\hspace*{0.5cm}}r}
+\begin{tabularx}{\textwidth}{l@{\extracolsep\fill}c@{\extracolsep\fill}r}
+ \textbf{Rechnungsnummer} & \textbf{Rechnungsdatum} & \textbf{Rechnungsbetrag} \\ \hline && \\
+ $(foreach dn_invnumber)$
+ $(dn_invnumber)$ & $(dn_transdate)$ & $(dn_amount)$ \euro \\[0.1cm]
+ $(end dn_invnumber)$
+\end{tabularx}
+\vspace*{2em} \\
+Wir bitten Sie, diese bis zum $(dunning_duedate)$ zu begleichen.\\%[1em plus 3em minus 1em]
+\vspace*{1em} \\
+Zahlungseingänge wurden bis zum $(dunning_date)$ berücksichtigt.
+Sollten Sie zwischenzeitlich bezahlt haben, betrachten Sie diese
+Zahlungserinnerung bitte als gegenstandslos.\\%[1em plus 3em minus 1em]
+\vspace*{2em} \\
+Sollte es triftige Gründe für die Zahlungsverzögerung geben, setzen Sie sich
+bitte mit uns in Verbindung, damit wir gemeinsam eine Lösung finden.\\ %[1em plus 3em minus 1em]
+\vspace*{2em} \\
+Mit freundlichen Grüßen\\ %[1em plus 3em minus 1em]
+\vspace*{1em} \\
+$(employee_name)$
+\end{document}
--- /dev/null
+%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
+% Makros zur Berechnung und Ausgabe einer Zwischensumme bei langen Tabellen
+% Der Hack der longtable Ausgabe ist von Heiko Oberdiek, das Paket zref auch.
+% ---<(kaimartin)>---(August, 2007)
+%Angepasst an 2.6.3 von n.simon@linet-services.de, 15. November 2011
+%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
+% Diese Datei steht unter der GPL-Lizenz, Version 3
+% siehe http://www.gnu.de/licenses/gpl-3.0.html
+%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
+
+\usepackage{etex} % Damit Marken verwendet werden koennen
+\usepackage[savepos,user]{zref} % Um die jeweils aktuelle Position zu merken
+\usepackage{fltpoint} % Rechnen mit Komma-Zahlen
+\usepackage{numprint} % Zahlen formatiert ausgeben
+\usepackage{eurosym} % Das Euro-Zeichen
+\usepackage{calc} % Fuer das Makro \widthof{}
+
+% Globale Einstellungen fuer numprint
+\nprounddigits{2} % Zwei Nachkommasstellen
+%% ",00" nicht durch ",--" ersetzen
+\npprintnull
+
+\fpDecimalSign{.}
+
+\newcommand{\lxNumberFormatGermanInput}{\makeatletter\renewcommand*\nprt@ignorelist{.}\renewcommand*\nprt@dotlist{,}\makeatother}
+\newcommand{\lxNumberFormatEnglishInput}{\makeatletter\renewcommand*\nprt@ignorelist{,}\renewcommand*\nprt@dotlist{.}\makeatother}
+
+\newcommand{\lxNumberFormatGerman}{\lxNumberFormatGermanInput\npthousandsep{.}\npdecimalsign{,}}
+\newcommand{\lxNumberFormatGermanNoSeparator}{\lxNumberFormatGermanInput\npthousandsep{}\npdecimalsign{,}}
+
+\newcommand{\lxNumberFormatEnglish}{\lxNumberFormatEnglishInput\npthousandsep{,}\npdecimalsign{.}}
+\newcommand{\lxNumberFormatEnglishNoSeparator}{\lxNumberFormatEnglishInput\npthousandsep{}\npdecimalsign{.}}
+
+\newcommand{\lxNumberFormatToUse}{\lxNumberFormatGerman}
+
+% Paketoptionen: Dezimaltrennzeichen und Tausendertrennzeichen
+\DeclareOption{german}{\renewcommand{\lxNumberFormatToUse}{\lxNumberFormatGerman}}
+\DeclareOption{germannosep}{\renewcommand{\lxNumberFormatToUse}{\lxNumberFormatGermanNoSeparator}}
+\DeclareOption{english}{\renewcommand{\lxNumberFormatToUse}{\lxNumberFormatEnglish}}
+\DeclareOption{englishnosep}{\renewcommand{\lxNumberFormatToUse}{\lxNumberFormatEnglishNoSeparator}}
+
+\ProcessOptions
+
+\lxNumberFormatToUse
+
+%%%%%%%%%%%%%%Befehle zur Berechnung der Zwischensumme%%%%%%%%%%%%%%%%%%%%%%%
+\newcommand*\laufsumme{0}
+\newcommand*\resetlaufsumme{\global\def\laufsumme{0}}
+\newcommand*\addlaufsumme[1]{\fpAdd{\laufsumme}{\laufsumme}{#1}%
+ \global\let\laufsumme\laufsumme}
+\newcommand*\printwert[1]{%
+\lxNumberFormatToUse%
+\lxNumberFormatEnglishInput%
+\numprint{#1}%
+\lxNumberFormatToUse}
+
+%%%%%%%%Plaintex-Hack fuer Positionierung der Zwischensummen%%%%%%%%%%%%%%%%%%
+
+
+\makeatletter % Das at-Zeichen in Variablen zulassen
+
+% Variablen bereit stellen
+ \newdimen\drx
+ \newdimen\dry
+
+ \newmarks\ltm@marks
+ \def\ltm@setmarks#1{%
+ \marks\ltm@marks{#1}%
+ }
+ \def\ltm@getmarks{%
+ \botmarks\ltm@marks
+ }
+
+
+% Den aktuellen Wert der Laufsumme berechnen und merken
+\newcommand*{\Wert}[1]{%
+ \addlaufsumme{#1}% Den uebergebenen Wert zur Laufsumme addieren
+ \expandafter\ltm@setmarks\expandafter{\laufsumme}% Die Laufsumme merken
+}
+
+% Merken der aktuellen Position
+\newcommand*{\MarkZwsumPos}{%
+ \leavevmode
+ \zsavepos{zwsumpos\thepage}%
+ \zrefused{zwsumpos\thepage}%
+}
+
+\newcommand*{\MarkUebertrPos}{%
+ \leavevmode
+ \zsavepos{uebertrpos\thepage}%
+ \zrefused{uebertrpos\thepage}%
+}
+
+
+% Ausgabe der Zwischensumme
+\def\ltm@insertfoot#1{%
+ \vbox to\z@{%
+ \vss
+ \hb@xt@\z@{%
+ \color@begingroup
+ \zsavepos{tabende\thepage}% % Die aktuelle Position merken
+ \drx=0sp
+ \dry=0sp
+ % Die aktuelle Position abziehen und die gemerkte addieren
+ \advance \drx by -\zposx{tabende\thepage}sp
+ \advance \drx by \zposx{zwsumpos\thepage}sp
+ \advance \dry by -\zposy{tabende\thepage}sp
+ \advance \dry by \zposy{zwsumpos\thepage}sp
+ \smash{\kern\drx\raise\dry%
+ \hbox{\makebox[0cm][r]{Zwischensumme:\hspace*{2em}\printwert{#1} \currency}}%
+ }% end smash
+ \color@endgroup
+ }%
+ }%
+}
+
+% Ausgabe des Uebertrags
+% Wie die Ausgabe der Zwischensumme, nur ohne neu gemerkte Position
+\def\ltm@inserthead#1{%
+ \vbox to\z@{%
+ \vss
+ \hb@xt@\z@{%
+ \color@begingroup
+ \zsavepos{tabstart\thepage}% % Die aktuelle Position merken
+ \drx=0sp
+ \dry=0sp
+ % Die Position des Tabellenendes abziehen und zur gemerkten gehen
+ \advance \drx by -\zposx{tabstart\thepage}sp
+ \advance \drx by \zposx{uebertrpos\thepage}sp
+ \advance \dry by -\zposy{tabstart\thepage}sp
+ \advance \dry by \zposy{uebertrpos\thepage}sp
+ \smash{\kern\drx\raise\dry%
+ \hbox{\makebox[0cm][r]{Übertrag:\hspace*{2em}\printwert{#1} \currency}}%
+ }% end smash
+ \color@endgroup
+ }%
+ }%
+}
+
+\def\ltm@lastfoot{}
+\def\ltm@foot{\ltm@insertfoot{\ltm@getmarks}}
+\def\ltm@head{\ltm@inserthead{\ltm@getmarks}}
+
+
+% Ueberschreiben der Output-Routine von longtable
+\def\LT@output{%
+ \ifnum\outputpenalty <-\@Mi
+ \ifnum\outputpenalty > -\LT@end@pen
+ \LT@err{floats and marginpars %
+ not allowed in a longtable}\@ehc
+ \else
+ \setbox\z@\vbox{\unvbox\@cclv}%
+ \ifdim \ht\LT@lastfoot>\ht\LT@foot
+ \dimen@\pagegoal
+ \advance\dimen@-\ht\LT@lastfoot
+ \ifdim\dimen@<\ht\z@
+ \setbox\@cclv\vbox{%
+ \unvbox\z@\copy\LT@foot\ltm@foot\vss
+ }%
+ \@makecol
+ \@outputpage
+ \setbox\z@\vbox{\box\LT@head}%
+ \fi
+ \fi
+ \global\@colroom\@colht
+ \global\vsize\@colht
+ \vbox{%
+ \unvbox\z@
+ \box\ifvoid\LT@lastfoot
+ \LT@foot\ltm@foot
+ \else
+ \LT@lastfoot\ltm@lastfoot
+ \fi
+ }%
+ \fi
+ \else
+ \setbox\@cclv\vbox{%
+ \unvbox\@cclv\copy\LT@foot\ltm@foot\vss
+ }%
+ \@makecol
+ \@outputpage
+ \global\vsize\@colroom
+ \copy\LT@head\ltm@head
+ \fi
+}
+
+\makeatother % Das at-Zeichen in Variablen wieder verbieten
+%%%%%%%%%%%%%%%%%%%%Ende plaintex-Hack%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%
+++ /dev/null
-README lx-office Fancy-LaTeX (f-tex)
-
-# Revision 1.1-u (03.02.2012)
-# Revision 1.0-u (16.11.2011)
-# Revision 0.9 (13.11.2011)
-# Revision 0.8 (12.09.2011)
-# Revision 0.7 (12.07.2011)
-# Revision 0.6 (16.06.2011)
-# Revision 0.5 (15.04.2011)
-# Revision 0.4 (14.02.2011)
-# Revision 0.3 (03.01.2011)
-# Revision 0.2 (24.12.2010)
-# Revision 0.1 (03.11.2009)
-
-
-
-# Feature Uebersicht
-
- - einfach Nutzung durch mitgeliefertes Setup-Script
- - Keine Retundanz. Es wird ein und die selbe Latex-Vorlage fuer alle
- briefartigen Dokumente verwendet. Also Angebot, Rechnung,
- Performarechnung, Lieferschein, aber eben nicht fuer Paketaufkleber
- etc..
- - Leichte Anpassung an das Firmen Layout durch verwendung eines Hintergrund-PDF
- dieses kann leicht mit dem eigenen Lieblingsprogramm erstellt werden
- (Openoffice, Inkscape, Gimp, Adobe*)
- - Hintergrundpdf um schaltbar auf "nur erste Seite" (default) oder "alle Seiten"
- (option "bgPdfFirstPageOnly" in Datei letter.lco)
- - Hintergrundpdf fuer Ausdruck auf bereits bedrucktem Briefpapier Abschaltbar,
- es wird dann nur bei per email versendeten Dokumenten eingebunden.
- (Option "bgPdfEmailOnly" in Datei letter.lco)
- - Nutzung der Layout-Funktionen von Latex fuer Seitenumbruch,
- wiederholung von Kopfzeilen, Zwischensummen etc. (danke an Kai-Martin fuer
- die Vorarbeit)
- - Anzeige des Empfaengerlandes im Adressfeld nur, wenn es vom Land des
- eigenen Unternehmens abweicht (also die Rechnung das Land verlaesst).
- - Multisprachfaehig leicht um weitere Sprachen zu erweitern, alle
- Übersetzungen in der Datei translatinos.tex.
- - Auflistung von Bruttopreisen fuer Endverbraucher.
-
-
-
-
-# die Installation
-
- Wenn es noch keine LaTeX installation gibt, installiere die folgenden Pakete
- (Debian)
- aptitude install \
- texlive-base-bin \
- texlive-latex-recommended \
- texlive-fonts-recommended \
- texlive-latex-extra \
- texlive-lang-german \
- texlive-generic-extra
-
- Die Abhaengigkeiten kann man mit
- /scripts/installation_check.pl -l pruefen (z.Z. noch nicht eingecheckt)
-
- Ein Vorlagenverzeichniss kannst Du direkt unter admin.pl Benutzeradministration erstellen:
- Benutze Vorlagen: f-tex
- Erzeuge Vorlagen, Name: <DEIN_WUNSCHNAME>
- Das Verzeichniss templates muss dafuer fuer den Webserver schreibbar sein.
-
- Erstelle eine pdf-Hintergrund Datei und verlinke sie nach ./letter_head.pdf
-
- Editiere den Bereich "settings" in der datei letter.lco ""
-
- # oder etwas Detaillierter:
- Es wird eine Datei sample.lco erstellt und diese nach letter.lco verlinkt.
- Eigentlich ist dies die Datei die fuer die Firmenspezifischen Anpassungen
- gedacht ist. Da die Einstiegshuerde in LaTeX nicht ganz niedrig ist, wird in
- dieser Datei auf ein Hintergrundpdf verwiesen. Ich empfehle ueber dieses pdf
- die persoenlichen Layoutanpassungen vorzunehmen und sample.lco unveraendert zu
- lassen. Die die Anpassung ueber eine *.lco Datei die letztlich auf letter.lco
- verlinkt ist ist aber auch moeglich.
-
- Es wird eine Datei sample_head.pdf mit ausgeliefert, diese wird nach
- letter_head.pdf verlinkt. Damit gibt es schon mal eine Funktionsfaehige
- Vorlage. Schau Dir nach Abschluss der Installation die Datei sample_haed.pdf
- an und erstelle ein entsprechendes pdf passend zum Briefkopf Deiner Firma,
- diese dann im Template Verzeichniss ablegen und statt sample_head.pdf nach
- letter_head.pdf verlinken.
-
- letzlich muss ./letter_head.pdf auf das passende Hintergrundpdf verweisen,
- welches gewuenschten Briefkopf enthaelt. Bei Updates oder nach erneutem
-
- Es wird eine Datei mydata.tex.example ausgeliefert die nach mytdata.tex
- verlinkt ist. Bei verwendetem Hintergrundpdf wird nur der Eintrag fuer das
- Land verwendet die Datei muss also nicht angefasst werden. Die Anderen Werte
- sind fuer das Modul lp (Label Print in erp -- zur Zeit nicht im
- oeffentlichen Zweig).
-
- Alle Anpassungen zum Briefkopf, Fusszeilen, Firmenlogos, etc.
- sollten ueber die Hintergrund pdf datei oder die *.lco Datei erfolgen.
-
-
-# einheitliche Latex-Vorlagen -- Background
-
- Das Konzept von lx-office sieht vor, fuer jedes Dokument
- (Auftragsbestaetigung, Lieferschein, Rechnung, etc.) eine
- Latex-Vorlage vorzuhalten, dies ist sehr Wartungsunfreundlich. Auch
- das Einlesen einer einheitlichen Quelle fuer den Briefkopf bringt nur
- bedingte Vorteile, da hier leicht die Pflege der Artikel-Tabellen aus
- dem Ruder laeuft. Bei dem vorliegenden Ansatz wird fuer alle
- Briefartigen Dokumente mit Artikel-Tabellen eine einheitliche
- Latexvorlage verwendet, welche ueber Codeweichen die Besonderheiten
- der jeweiligen Dokumente Beruecksichtigt
- - Tabellen mit oder ohne Preis
- - Sprache der Tabellenueberschriften etc.
- - Anpassung der Bezugs-Zeile (z.B. Rechnungsnummer versus
- Angebotsnummer)
- - Darstellung von Brutto oder Netto-Preisen in der Auflistung
- (Endverbraucher versus Gewerblicher Kunde)
- Seit Version 2.7 ist das ohne Kunstgriff moeglich, da im bei nicht vorhanden
- Dokumenten auf default.tex zurueckgegriffen wird.
-
-
- Nachteil:
- Ja, alles hat seinen Preis ...
- Latex hat ohnehin eine sehr steile Lehrnkurve. Die Datei letter.tex
- ist sehr komplex und verstaerkt damit diesen Effekt noch einmal erheblich.
- Wer Latex-Erfahrung hat, oder geuebt ist Scriptsparachen nachzuvollziehen kann
- natuerlich auch innerhalb der Tabellendarstellung gut persoenliche Anpassungen
- vornehmen. Aber man kann sich hier bei Veraenderungen sehr schnell haeftig in
- den Fuss schiessen.
- Wer nicht so tief in die Materie einsteigen will oder leicht zu
- frustrieren ist, sollte sein Hintergrund PDF auf Basis der mitglieferten
- Datei sample_head.pdf erstellen, und sich an der Form der dargestellten Tabellen
- wie sie ausgeliefert werden, erfreuen.
- Kleiner Tipp:
-
- Nicht zu viel auf einmal wollen, lieber kleine kontinuierliche
- Schritte gehen.
-
- Alternativ kann man sich natuerlich fuer die Latex-Vorlagen
- professionelle Hilfe hohlen.
-
-
-Bruttopreise fuer Endvorbraucher
- Der auszuweisende Bruttopreis wird innerhalb der LaTeX Umgebung berechnet.
-
- - Background:
- es gibt zwar ein Feld um bei Auftraegen "alle Preise Brutto" auszuwaehlen,
- aber:
- - hierfuer muessen die Preise auch in Brutto in der Datenbank stehen
- (ja -- das laesst sich ueber die Preisgruppen und die Zuordung einer Default-Preisgruppe
- handhaben)
- - man darf beim Anlegen des Vorgangs nicht vergessen Dieses Haekchen zu setzen.
- (das ist in der Praxis wenn man sowohl Endverbraucher- wie Gewerbekunden beliefert
- der eigentliche Knackpunkt)
-
- Es gibt mit f-tex eine weitere Alternative. Die Information ob Brutto oder
- Nettorechnung wird mit den Zahlarten verknuepft. Zahlarten bei denen
- Rechnungen, Angebote, etc, in Brutto ausgegeben werden sollen enden mit "_E"
- (fuer Endverbraucher) Falls identische Zahlarten fuer Gewerbekunden und
- Endverbraucher vorhanden sind legt man diese einfach doppelt an (einmal mit
- der Namensendung "_E")
- - Gewinn:
- - die Entscheidung ob Netopreise ausgewiesen werden ist nicht mehr fix
- mit einer Preisliste Verbunden.
- - die Default-Zahlart kann im Kundendatensatz hinterlegt werden und man
- muss nicht mehr daran denken "alle Preise Netto" auszuwaehlen.
- - Die Entscheidung ob Netto/Oder Bruttopreise ausgewiesen werden kann direkt
- beim Drucken reviediert werden, ohne dass sich der Auftragswert aendert.
-
-Lieferadressen
-
- - in Lieferscheinen kommen shipto* -Variablen im Adressfeld zum Einsatz
- - wenn die shipto*variable leer ist wird die entsprechende
- Adressvariable eingesetzt. Wenn Also die Lieferadresse in Strasse,
- Hausnummer und Ort abweicht, muessen auch nur diese Felder in der
- Lieferadresse ausgefuellt werden. Fuer den Firmenname wird der Wert der
- Hauptadresse angezeigt.
-
-Troubleshooting -- Fehler suchen:
- Wenn sich das Problem nicht auf Grund der ausgabe im Webbrowser verifizieren laesst:
-
- editiere [flxo-home]/config/lx_office.conf und aendere "keep_tmp_files" auf 1
- keep_temp_files = 1;
-
- bei fastcgi oder mod_perl den Webserver neu Starten
-
- Nochmal einen Druckversuch im Webfrontend ausloesen
-
- wechsele in das users Verzeichnis von lxo
- cd [lxo-home]/users
-
- LaTeX Suchpfad anpassen:
- export TEXINPUTS=".:[lxo-home]/templates/[aktuelles_template_verzeichniss]:"
-
- Finde herraus welche datei lxo beim letzten Durchlauf erstellt hat
- ls -lahtr ./1*.tex
- Es sollte die letzte Datei ganz unten sein
-
- fuer besseren Hinweis auf Fehler texdatei nochmals uebersetzen
- pdflatex ./1*.tex
-
- in der *.tex datei nach dem Fehler suchen.
-
-
-
%======Die eigentliche-Tabelle========================================
% temporaere Datei mit Tabelle anlegen
-\begin{filecontents}{<%tmpfile%>.table.tex}
+\begin{filecontents}{<%template_meta.tmpfile NOESCAPE%>.table.tex}
\mainfont
\resetlaufsumme
}
\end{filecontents} % Ende der Hilfsdatei.
-\LTXtable{\textwidth}{<%tmpfile%>.table.tex}
+\LTXtable{\textwidth}{<%template_meta.tmpfile NOESCAPE%>.table.tex}
\rule{\textwidth}{0pt} % Ein (unsichtbarer) Strich quer ueber die Seite
\vspace{ 5mm}
</table>
<p>
- [% 'If you want to change any of these parameters then press the "Back" button, edit the file "config/lx_office.conf" and login into the admin module again.' | $T8 %]
+ [% 'If you want to change any of these parameters then press the "Back" button, edit the file "config/kivitendo.conf" and login into the admin module again.' | $T8 %]
</p>
<form method="post" action="admin.pl">
<select name="inventory_system">
[% FOREACH row = INVENTORY_SYSTEMS %]<option value=[% HTML.escape(row.name) %] [% IF row.selected %]selected[% END %]>[% HTML.escape(row.name) | $T8 %]</option>[% END %]
</select>
- [% '* there are restrictions for the perpetual method, look at chapter "Bemerkungen zu Bestandsmethode" in' | $T8 %] <a href="doc/Lx-Office-Dokumentation.pdf">Lx-Office-Dokumentation.pdf</a>.
+ [% '* there are restrictions for the perpetual method, look at chapter "Bemerkungen zu Bestandsmethode" in' | $T8 %] <a href="doc/kivitendo-Dokumentation.pdf">kivitendo-Dokumentation.pdf</a>.
</td>
</tr>
</tr>
<tr>
<td colspan="2">
- [% '*) Since version 2.7 these parameters ares set in the client database and not in the lx-erp.conf / lx_office.conf file, details in chapter:' | $T8 %] <a href="doc/Lx-Office-Dokumentation.pdf">Kapitel Konfiguration zur Einnahmenüberschussrechnung/ Bilanzierung: EUR</a>
+ [% '*) Since version 2.7 these parameters ares set in the client database and not in the configuration file, details in chapter:' | $T8 %] <a href="doc/kivitendo-Dokumentation.pdf">Kapitel Konfiguration zur Einnahmenüberschussrechnung/ Bilanzierung: EUR</a>
</td>
</tr>
</table>
</tr>
<tr>
<th align="right">[% 'Setup Templates' | $T8 %]</th>
- <td>[% L.select_tag('mastertemplates', all_master_templates, default = 'German') %]</td>
+ <td>[% L.select_tag('mastertemplates', all_master_templates, default = 'Standard') %]</td>
</tr>
<tr>
<th align="right">[% 'Setup Menu' | $T8 %]</th>
});
-->
</script>
-
<input type="hidden" name="type" value="account">
<input type="hidden" name="orphaned" value="[% HTML.escape(orphaned) %]">
<input type="hidden" name="new_chart_valid" value="[% HTML.escape(new_chart_valid) %]">
-<input type="hidden" name="original_accno" value="[% HTML.escape(accno) %]">
<input type="hidden" name="inventory_accno_id" value="[% HTML.escape(inventory_accno_id) %]">
<input type="hidden" name="income_accno_id" value="[% HTML.escape(income_accno_id) %]">
<input type="hidden" name="expense_accno_id" value="[% HTML.escape(expense_accno_id) %]">
<hr height="3" noshade>
<p>
- (1) [% 'Enter up to 3 letters separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' | $T8 %]
+ (1) [% 'Enter the abbreviations separated by a colon (i.e CAD:USD:EUR) for your native and foreign currencies' | $T8 %]
[% 'IMPORTANT NOTE: You cannot safely change currencies, IF you have already booking entries!' | $T8 %]
</p>
</form>
-
<table border="0">
<tr>
<td align="right">[% 'Description' | $T8 %]</td>
- <td><input name="description" value="[% HTML.escape(description) %]"></td>
+ <td><input id="description" name="description" value="[% HTML.escape(description) %]"></td>
</tr>
<tr>
</p>
[% IF CAN_EDIT %]
- <p><textarea name="content" id="content" cols="100" rows="25">[% HTML.escape(content) %]</textarea></p>
+ <p><textarea name="content" id="edit_content" cols="100" rows="25">[% HTML.escape(content) %]</textarea></p>
<p>
<input type="hidden" name="save_nextsub" value="save_template">
<tr>
<td align="right">[% 'Description' | $T8 %]</td>
<td>
- <input name="description" size="60" value="[% HTML.escape(description) %]">
+ <input id='description' name="description" size="60" value="[% HTML.escape(description) %]">
<input type="hidden" name="orig_description" value="[% HTML.escape(description) %]">
</td>
</tr>
[%- IF id %]
<input type="submit" onclick="set_history_window([% id %]);" name="history" id="history" value="[% 'history' | $T8 %]">
- <input type="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% IF INSTANCE_CONF.get_ap_show_mark_as_paid %]
+ <input type="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% END %]
[%- END %]
</form>
<th align=right>[% 'Vendor' | $T8 %]</th>
<td colspan=3>
[%- INCLUDE 'generic/multibox.html'
+ id = 'vendor',
name = 'vendor',
default = oldvendor,
style = 'width: 250px',
<th align="right" nowrap>[% 'Customer' | $T8 %]</th>
<td colspan=3>
[%- IF selectcustomer %]
- <select name="customer" onchange="document.getElementById('update_button').click();">[% selectcustomer %]</select>
+ <select id='customer' name="customer" onchange="document.getElementById('update_button').click();">[% selectcustomer %]</select>
[%- ELSE %]
- <input name=customer value="[% customer | html %]" size=35>
+ <input id='customer' name=customer value="[% customer | html %]" size=35>
[%- END %]
<input type="button" value="[% 'Details (one letter abbreviation)' | $T8 %]" onclick="show_vc_details('customer')"></td>
[% L.hidden_tag('selectcustomer', selectcustomer) %]
<tr>
<th align=left width=1%>[% 'Notes' | $T8 %]</th>
<td align=left><textarea name=notes rows="[% rows %]" cols=50 wrap=soft>[% notes | html %]</textarea></td>
+
+ <th align=left width=1%>[% 'Notes for customer' | $T8 %]</th>
+ <td align=left><textarea name=intnotes rows="[% rows %]" cols=50 wrap=soft readonly>[% intnotes | html %]</textarea></td>
</tr>
</table>
</td>
<tr>
<th align="right">[%- LxERP.t8('Package name') %]</th>
- <td>[% L.input_tag("background_job.package_name", SELF.background_job.package_name, 'size' => 40) %]</td>
+ <td>[% L.select_tag("background_job.package_name", JOB_CLASSES, 'default' => SELF.background_job.package_name) %]</td>
</tr>
<tr>
[% L.hidden_tag('accno', accno) %]
[% L.hidden_tag('decription', description) %]
[% L.hidden_tag('sort', 'transdate') %]
-[% L.hidden_tag('eur', cash) %]
[% L.hidden_tag('accounttype', accounttype) %]
<table border=0 width=100%>
<tr>
<td colspan=5><hr size=3 noshade></td>
</tr>
- <tr>
- <th align=leftt>[% 'Method' | $T8 %]</th>
- <td colspan=3>[% L.radio_button_tag('method', value='accrual', checked=!cash, label=LxERP.t8('Accrual')) %]
- [% L.radio_button_tag('method', value='cash', checked=cash, label=LxERP.t8('EUR')) %]</td>
- </tr>
<tr>
<th align=right colspan=4>[% 'Decimalplaces' | $T8 %]</th>
<td><input name=decimalplaces size=3 value="2"></td>
<br>[% L.submit_tag('action', LxERP.t8('List Transactions')) %]
</form>
-
--- /dev/null
+[%- USE T8 %][%- USE L %][% USE LxERP %]
+
+<h1>[% title | html %]</h1>
+
+[% PROCESS 'common/flash.html' %]
+
+<form action='controller.pl' method='POST'>
+
+<table>
+
+ <tr class='listheading'>
+ <th colspan="3">[% 'Posting Configuration' | $T8 %]</th>
+ </tr>
+
+ <tr>
+ <td align="right">[% 'Sales invoices changeable' | $T8 %]</td>
+ <td>[% L.select_tag('is_changeable', SELF.posting_options, value_key => 'value', title_key => 'title', default => SELF.is_changeable) %]</td>
+ <td>[% 'Should sales invoices be and when should they be changeable or deleteable after posting?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Purchase invoices changeable' | $T8 %]</td>
+ <td>[% L.select_tag('ir_changeable', SELF.posting_options, value_key => 'value', title_key => 'title', default => SELF.ir_changeable) %]</td>
+ <td>[% 'Should purchase invoices be and when should they be deleteable after posting?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'AR transactions changeable' | $T8 %]</td>
+ <td>[% L.select_tag('ar_changeable', SELF.posting_options, value_key => 'value', title_key => 'title', default => SELF.ar_changeable) %]</td>
+ <td>[% 'Should ar transactions be and when should they be changeable or deleteable after posting?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'AP transactions changeable' | $T8 %]</td>
+ <td>[% L.select_tag('ap_changeable', SELF.posting_options, value_key => 'value', title_key => 'title', default => SELF.ap_changeable) %]</td>
+ <td>[% 'Should ap transactions be and when should they be changeable or deleteable after posting?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'GL transactions changeable' | $T8 %]</td>
+ <td>[% L.select_tag('gl_changeable', SELF.posting_options, value_key => 'value', title_key => 'title', default => SELF.gl_changeable) %]</td>
+ <td>[% 'Should gl transactions be and when should they be changeable or deleteable after posting?' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr>
+ <td align="right">[% 'Payments Changeable' | $T8 %]</td>
+ <td>[% L.select_tag('payments_changeable', SELF.payment_options, value_key => 'value', title_key => 'title', default => SELF.payments_changeable) %]</td>
+ <td>[% 'Should payments be and when should they be changeable after posting?' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr>
+ <td align="right">[% 'Show "mark as paid" in sales invoices' | $T8 %]</td>
+ <td>[% L.yes_no_tag('is_show_mark_as_paid', SELF.is_show_mark_as_paid) %]</td>
+ <td>[% 'Should the "mark as paid" button showed on sales invoices?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Show "mark as paid" in purchase invoices' | $T8 %]</td>
+ <td>[% L.yes_no_tag('ir_show_mark_as_paid', SELF.ir_show_mark_as_paid) %]</td>
+ <td>[% 'Should the "mark as paid" button showed in purchase invoices?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Show "mark as paid" in ar transactions' | $T8 %]</td>
+ <td>[% L.yes_no_tag('ar_show_mark_as_paid', SELF.ar_show_mark_as_paid) %]</td>
+ <td>[% 'Should the "mark as paid" button showed in ar transactions?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Show "mark as paid" in ap transactions' | $T8 %]</td>
+ <td>[% L.yes_no_tag('ap_show_mark_as_paid', SELF.ap_show_mark_as_paid) %]</td>
+ <td>[% 'Should the "mark as paid" button showed in ap transactions?' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr>
+ <td align="right">[% 'Accounting method' | $T8 %]</td>
+ <td>[% L.select_tag('accounting_method', SELF.accounting_options, value_key => 'value', title_key => 'title', default => SELF.accounting_method) %]</td>
+ <td>[% 'This option controls the posting and calculation behavior for the accounting method.' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Inventory system' | $T8 %]</td>
+ <td>[% L.select_tag('inventory_system', SELF.inventory_options, value_key => 'value', title_key => 'title', default => SELF.inventory_system) %]</td>
+ <td>
+ [% 'This option controls the inventory system.' | $T8 %]<br>
+ [% 'ATTENTION! You can not simply change it from periodic to perpetual once you started posting.' | $T8 %]
+ </td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Profit determination' | $T8 %]</td>
+ <td>[% L.select_tag('profit_determination', SELF.profit_options, value_key => 'value', title_key => 'title', default => SELF.profit_determination) %]</td>
+ <td>[% 'This option controls the method used for profit determination.' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr class='listheading'>
+ <th colspan="3">[% 'DATEV check configuration' | $T8 %]</th>
+ </tr>
+ <tr>
+ <td colspan="3">[% 'It is possible to make a quick DATEV export everytime you post a record to ensure things work nicely with their data requirements. This will result in a slight overhead though you can enable this for each type of record independantly.' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Check on sales invoice' | $T8 %]</td>
+ <td>[% L.yes_no_tag('datev_check_on_sales_invoice', SELF.datev_check_on_sales_invoice) %]</td>
+ <td>[% 'Perform check when a sales invoice or a payment for a sales invoice is posted?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Check on purchase invoice' | $T8 %]</td>
+ <td>[% L.yes_no_tag('datev_check_on_purchase_invoice', SELF.datev_check_on_purchase_invoice) %]</td>
+ <td>[% 'Perform check when a purchase invoice or a payment for a purchase invoice is posted?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Check on ar transaction' | $T8 %]</td>
+ <td>[% L.yes_no_tag('datev_check_on_ar_transaction', SELF.datev_check_on_ar_transaction) %]</td>
+ <td>[% 'Perform check when an ar transaction is posted?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Check on ap transaction' | $T8 %]</td>
+ <td>[% L.yes_no_tag('datev_check_on_ap_transaction', SELF.datev_check_on_ap_transaction) %]</td>
+ <td>[% 'Perform check when an ap transaction is posted?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Check on gl transaction' | $T8 %]</td>
+ <td>[% L.yes_no_tag('datev_check_on_gl_transaction', SELF.datev_check_on_gl_transaction) %]</td>
+ <td>[% 'Perform check when a gl transaction is posted?' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr class='listheading'>
+ <th colspan="3">[% 'Orders / Delivery Orders deleteable' | $T8 %]</th>
+ </tr>
+ <tr>
+ <td align="right">[% 'Sales Orders deleteable' | $T8 %]</td>
+ <td>[% L.yes_no_tag('sales_order_show_delete', SELF.sales_order_show_delete) %]</td>
+ <td>[% 'Show delete button in sales orders?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Purchase Orders deleteable' | $T8 %]</td>
+ <td>[% L.yes_no_tag('purchase_order_show_delete', SELF.purchase_order_show_delete) %]</td>
+ <td>[% 'Show delete button in purchase orders?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Sales Delivery Orders deleteable' | $T8 %]</td>
+ <td>[% L.yes_no_tag('sales_delivery_order_show_delete', SELF.sales_delivery_order_show_delete) %]</td>
+ <td>[% 'Show delete button in sales delivery orders?' | $T8 %]</td>
+ </tr>
+ <tr>
+ <td align="right">[% 'Purchase Delivery Orders deleteable' | $T8 %]</td>
+ <td>[% L.yes_no_tag('purchase_delivery_order_show_delete', SELF.purchase_delivery_order_show_delete) %]</td>
+ <td>[% 'Show delete button in purchase delivery orders?' | $T8 %]</td>
+ </tr>
+
+ <tr> </tr>
+ <tr> </tr>
+
+ <tr class='listheading'>
+ <th colspan="3">[% 'Warehouse' | $T8 %]</th>
+ </tr>
+ <tr>
+ <td align="right">[% 'Show Bestbefore' | $T8 %]</td>
+ <td>
+ [% L.yes_no_tag('show_bestbefore', SELF.show_bestbefore) %]
+ </td>
+ <td>
+ [% 'Show fields used for the best before date?' | $T8 %]<br>
+ [% 'ATTENTION! If you enabled this feature you can not simply turn it off again without taking care that best_before fields are emptied in the database.' | $T8 %]<br>
+ [% 'This can be done with the following query:' | $T8 %]<br>
+ <br>
+ UPDATE inventory SET bestbefore = NULL; <br>
+ <br>
+ [% 'Any stock contents containing a best before date will be impossible to stock out otherwise.' | $T8 %]
+ </td>
+ </tr>
+
+</table>
+
+<br>
+
+[%- L.hidden_tag('action', 'ClientConfig/dispatch') %]
+[%- L.submit_tag('action_save', LxERP.t8('Save')) %]
+
+<br><br>
+
+</form>
[% USE HTML %]
[% BLOCK jump_block %]
+[%- IF SHIPTO.size || CONTACTS.size %]
<p>
[% 'Jump to' | $T8 %] <a href="#billing">[% 'Billing Address' | $T8 %]</a>
[%- FOREACH shipto = SHIPTO %]
</p>
<hr>
+[%- END %]
[% END %]
</table>
[% END %]
-
[%- USE LxERP %]
<table width=100%>
<tr>
- <th class=listheading colspan="6">[% 'Invoices' | $T8 %]</th>
+ <th class=listheading colspan="7">[% 'Invoices' | $T8 %]</th>
</tr>
<tr>
+ <th nowrap class=listheading>[% 'Row number' | $T8 %]</th>
<th nowrap class=listheading>[% 'Invoice' | $T8 %]</th>
<th nowrap class=listheading width="15%">[% 'Date' | $T8 %]</th>
<th nowrap class=listheading width="15%">[% 'Amount' | $T8 %]</th>
</tr>
[%- FOREACH row = invoices %]
<tr class="listrow[% loop.count % 2 %]">
+ <td>[% loop.count %]</td>
<td>[% row.invnumber | html %][% L.hidden_tag('invnumber_' _ loop.count, row.invnumber); L.hidden_tag('id_' _ loop.count, row.id) %]</td>
<td>[% row.transdate | html %][% L.hidden_tag('transdate_' _ loop.count, row.transdate) %]</td>
<td class="numeric">[% LxERP.format_amount(row.amount, 2) %][% L.hidden_tag('amount_' _ loop.count, LxERP.format_amount(row.amount, 2)) %]</td>
</tr>
[%- END %]
<tr class='tisttotal'>
+ <td class="listtotal"> </td>
<td class="listtotal"> </td>
<td class="listtotal"> </td>
<td class="listtotal" align="right">[% LxERP.format_amount(totals.amount, 2) %]</td>
[%- LxERP.t8("If the article type is set to 'mixed' then a column called 'type' must be present.") %]
[% LxERP.t8("Type can be either 'part' or 'service'.") %]
</p>
+
+ <p>
+ [1]:
+ [% LxERP.t8('The three columns "make_X", "model_X" and "lastcost_X" with the same number "X" are used to import vendor part numbers and vendor prices.') %]
+ [% LxERP.t8('The column triplets can occur multiple times with different numbers "X" each time (e.g. "make_1", "model_1", "lastcost_1", "make_2", "model_2", "lastcost_2", "make_3", "model_3", "lastcost_3" etc).') %]
+ [% LxERP.t8('The items are imported accoring do their number "X" regardless of the column order inside the file.') %]
+ [% LxERP.t8('The column "make_X" can contain either a vendor\'s database ID, a vendor number or a vendor\'s name.') %]
+ </p>
[%- END %]
<p>
<tr>
<th align="left" nowrap>[% 'Birthday' | $T8 %]</th>
- <td><input id="cp_birthday" name="cp_birthday" size="40" value="[% HTML.escape(cp_birthday) %]"></td>
+ <td>
+ [% L.date_tag('cp_birthday', cp_birthday) %]
+ </td>
</tr>
<tr>
<tr>
<th align="right" nowrap>[% IF IS_CUSTOMER %][% 'Customer Name' | $T8 %][%- ELSE %][% 'Vendor Name' | $T8 %][%- END %]</th>
- <td><input name="name" size="35"></td>
+ <td><input id="name" name="name" size="35"></td>
</tr>
<tr>
--- /dev/null
+[%- USE HTML %]
+[%- USE L %]
+[%- USE LxERP %]
+
+<h1>[%- LxERP.t8('Conversion of "birthday" contact person attribute') %]</h1>
+
+<p>
+ [%- LxERP.t8('The contact person attribute "birthday" is converted from a free-form text field into a date field.') %]
+ [%- LxERP.t8('This requires you to manually correct entries for which an automatic conversion failed and to check those for which it succeeded.') %]
+</p>
+
+[% BLOCK birthday_table %]
+ <table>
+
+ <tr>
+ <th>[%- LxERP.t8('Database ID') %]</th>
+ <th>[%- LxERP.t8('Name') %]</th>
+ <th>[%- LxERP.t8('Given Name') %]</th>
+ <th>[%- LxERP.t8('Birthday (before conversion)') %]</th>
+ <th>[%- LxERP.t8('Birthday (after conversion)') %]</th>
+ </tr>
+
+ [% FOREACH row IN data %]
+ <tr class="listrow[% loop.count % 2 %]">
+ <input type="hidden" name="cp_id_[% row.row_index %]" value="[% row.cp_id %]">
+
+ <td>[% row.cp_id %]</td>
+ <td>[% row.cp_givenname | html %]</td>
+ <td>[% row.cp_name | html %]</td>
+ <td>[% row.cp_birthday_old | html %]</td>
+ <td>[% L.date_tag('cp_birthday_'_ row.row_index, row.cp_birthday) %]</td>
+ </tr>
+ [% END %]
+
+ </table>
+[% END %]
+
+<form action="[% script %]" method="POST">
+ <h2>[%- LxERP.t8('Entries for which automatic conversion failed:') %]</h2>
+ [% PROCESS birthday_table data = data %]
+
+ <h2>[%- LxERP.t8('Entries for which automatic conversion succeeded:') %]</h2>
+ [% PROCESS birthday_table data = auto_data %]
+
+ <input type="hidden" name="row_length" value="[% row_length %]">
+ <input type="hidden" name="action" value="LoginScreen/login">
+ <input type="submit" name="form_submitted" value="save">
+</form>
[%- USE T8 %]
[% USE HTML %]<p>[% '...done' | $T8 %]</p>
-<form action="[% IF is_admin %]admin.pl[% ELSE %][% login.pl %][% END %]">
+<form action="[% IF is_admin %]admin.pl[% ELSE %]login.pl[% END %]">
<input type="hidden" name="action" value="[% IF is_admin %]login[% ELSE %]company_logo[% END %]">
<p>
[% 'Workflow Delivery Order' | $T8 %]<br>
<input class="submit" type="submit" name="action_save_as_new" value="[% 'Save as new' | $T8 %]">
- [% UNLESS delivered %]
- <input class="submit" type="submit" name="action_delete" value="[% 'Delete' | $T8 %]">
+ [% UNLESS delivered || (vc == 'customer' && !INSTANCE_CONF.get_sales_delivery_order_show_delete) || (vc == 'vendor' && !INSTANCE_CONF.get_purchase_delivery_order_show_delete) %]
+ <input class="submit" type="submit" name="action_delete" value="[% 'Delete' | $T8 %]">
[% END %]
<input class="submit" type="submit" name="action_invoice" value="[% 'Invoice' | $T8 %]">
</p>
<th class="listheading">[% 'Warehouse' | $T8 %]</th>
<th class="listheading">[% 'Bin' | $T8 %]</th>
<th class="listheading">[% 'Charge Number' | $T8 %]</th>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<th class="listheading">[% 'Best Before' | $T8 %]</th>
[% END %]
<th align="right" class="listheading">[% 'Qty' | $T8 %]</th>
<td>[% HTML.escape(row.warehouse_description) %]</td>
<td>[% HTML.escape(row.bin_description) %]</td>
<td>[% HTML.escape(row.chargenumber) %]</td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>[% HTML.escape(row.bestbefore) %]</td>
[% END %]
<td>[% HTML.escape(LxERP.format_amount(row.qty)) %]</td>
<td><select name="bin_id_[% loop.count %]" id="bin_id_[% loop.count %]"></select></td>
<td><input name="chargenumber_[% loop.count %]" value="[% HTML.escape(row.chargenumber) %]"></td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>
[% L.date_tag('bestbefore_'_ loop.count, row.bestbefore) %]
</td>
<th class="listheading">[% 'Warehouse' | $T8 %]</th>
<th class="listheading">[% 'Bin' | $T8 %]</th>
<th class="listheading">[% 'Charge Number' | $T8 %]</th>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<th class="listheading">[% 'Best Before' | $T8 %]</th>
[% END %]
[%- UNLESS delivered %]
<td>[% HTML.escape(row.warehousedescription) %]</td>
<td>[% HTML.escape(row.bindescription) %]</td>
<td>[% HTML.escape(row.chargenumber) %]</td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>[% HTML.escape(row.bestbefore) %]</td>
[% END %]
[%- IF delivered %]
<input type="hidden" name="warehouse_id_[% loop.count %]" value="[% HTML.escape(row.warehouse_id) %]">
<input type="hidden" name="bin_id_[% loop.count %]" value="[% HTML.escape(row.bin_id) %]">
<input type="hidden" name="chargenumber_[% loop.count %]" value="[% HTML.escape(row.chargenumber) %]">
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<input type="hidden" name="bestbefore_[% loop.count %]" value="[% HTML.escape(row.bestbefore) %]">
[% END %]
[%- END %]
<tr>
<th align="right" nowrap>[% 'To' | $T8 %]</th>
- <td><input name="email" size="30" value="[% HTML.escape(email) %]"></td>
+ <td><input id="email" name="email" size="30" value="[% HTML.escape(email) %]"></td>
</tr>
<tr>
<th align="right" nowrap>[% 'Cc' | $T8 %]</th>
<tr>
<th align="right" nowrap>[% 'Subject' | $T8 %]</th>
- <td><input name="subject" size="30" value="[% HTML.escape(subject) %]"></td>
+ <td><input id="subject" name="subject" size="30" value="[% HTML.escape(subject) %]"></td>
</tr>
<tr>
<th align="right" nowrap>[% 'Attachment name' | $T8 %]</th>
<th class="listheading">[% 'Charge number' | $T8 %]</th>
[% END %]
[% IF has_bestbefore %]
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<th class="listheading">[% 'Best Before' | $T8 %]</th>
[% END %]
[% END %]
</td>
[% END %]
[% IF has_bestbefore %]
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>
<input type="hidden" name="new_bestbefore_id_[% loop.count %]" value="[% HTML.escape(part.bestbefore_id) %]">
<input type="hidden" name="new_bestbefore_[% loop.count %]" value="[% HTML.escape(part.bestbefore) %]">
<br>
[%- IF id %]
+ [% L.submit_tag('action', LxERP.t8('Update'), id='update_button') %]
- [%- IF !storno %]
- [% L.submit_tag('action', LxERP.t8('Storno')) %]
- [%- END %]
+ [% IF !locked && radieren %]
+ [% L.submit_tag('action', LxERP.t8('Post'), accesskey='b') %]
+ [% L.submit_tag('action', LxERP.t8('Delete')) %]
+ [%- END %]
- [% IF !locked && radieren %]
- [% L.submit_tag('action', LxERP.t8('Post'), accesskey='b') %]
- [% L.submit_tag('action', LxERP.t8('Delete')) %]
- [%- END %]
- [% L.submit_tag('action', LxERP.t8('Update'), id='update_button') %]
- [% L.submit_tag('action', LxERP.t8('Follow-Up'), onclick='follow_up_window()') %]
+ [%- IF !storno %]
+ [% L.submit_tag('action', LxERP.t8('Storno')) %]
+ [%- END %]
+ [% L.submit_tag('action', LxERP.t8('Follow-Up'), onclick='follow_up_window()') %]
[%- ELSE %]
[%- IF draft_id %]
[%- USE T8 %]
[%- USE LxERP %]
[%- USE HTML %]
+[%- USE L %]
<tr class=listheading>
<th class=listheading>[% 'Individual Items' | $T8 %]</th>
</tr>
[%- IF rcol.escape %]
<td[% ' align=' _ rcol.align IF rcol.align %]>[%- HTML.escape(rcol.data) %]</td>
[%- ELSE %]
- <td[% ' align=' _ rcol.align IF rcol.align %]>[%- rcol.data %]</td>
+ <td[% ' align=' _ rcol.align IF rcol.align %]>[%- IF rcol.link %][% L.link(rcol.link, rcol.data) %][% ELSE %][% rcol.data %][% END %]</td>
[%- END %]
[%- END %]
[%- FOREACH hidden = row.hiddens %]
<p><div class="listtop">[% title %] [% HTML.escape(partnumber) %] [% HTML.escape(description) %]</div></p>
+[% PROCESS 'common/flash.html' %]
+
<form method="post" name="ic" action="[% script %]">
<input name="id" type="hidden" value="[% HTML.escape(id) %]">
<input name="eur" type="hidden" value="[% HTML.escape(eur) %]">
<input name="language_values" type="hidden" value="[% HTML.escape(language_values) %]">
<input name="original_partnumber" type="hidden" value="[% HTML.escape(original_partnumber) %]">
+ <input name="currow" type="hidden" value="[% HTML.escape(currow) %]">
<ul id="maintab" class="shadetabs">
<li class="selected"><a href="#" rel="master_data">[% 'Basic Data' | $T8 %]</a></li>
<table>
<tr>
<th align="right">[% 'Part Number' | $T8 %]</th>
- <td><input name="partnumber" value="[% HTML.escape(partnumber) %]" size="40"></td>
+ <td><input id='partnumber' name="partnumber" value="[% HTML.escape(partnumber) %]" size="40"></td>
</tr>
<tr>
<th align="right">[% 'Part Description' | $T8 %]</th>
<table>
<tr>
<th align="left">[% 'Part Notes' | $T8 %]</th>
- [%- UNLESS is_service %]
<th align="left">[% 'Formula' | $T8 %]</th>
- [%- END %]
</tr>
<tr>
<td>
<textarea name="notes" rows="[% HTML.escape(notes_rows) %]" cols="45" wrap="soft">[% HTML.escape(notes) %]</textarea>
</td>
- [%- UNLESS is_service %]
<td>
<ilayer>
<layer onmouseover="this.T_STICKY=true;this.T_STATIC=true;return escape('[% 'The formula needs the following syntax:<br>For regular article:<br>Variablename= Variable Unit;<br>Variablename2= Variable2 Unit2;<br>...<br>###<br>Variable + ( Variable2 / Variable )<br><b>Please be beware of the spaces in the formula</b><br>' | $T8 %]')">
<textarea name="formel" rows="[% HTML.escape(notes_rows) %]" cols="30" wrap="soft">[% HTML.escape(formel) %]</textarea></layer></ilayer>
</td>
- [%- END %]
</tr>
</table>
</td>
[% HTML.escape(defaults.weightunit) %]
</td>
</tr>
- [%- END %]
<tr>
<th align="right" nowrap>[% 'On Hand' | $T8 %]</th>
<th align="left" nowrap class="plus[% IF onhand > 0 %]1[% ELSE %]0[% END %]"> [% LxERP.format_amount(onhand) %]</th>
<th align="right" nowrap="true">[% 'Bin' | $T8 %]</th>
<td><input name="bin" size="10" value="[% HTML.escape(bin) %]"></td>
</tr>
+ [%- END %]
<tr>
<th align="right" nowrap="true">[% 'Verrechnungseinheit' | $T8 %]</th>
<td><input name="ve" size="10" value="[% HTML.escape(ve) %]"></td>
<td><input name="obsolete" id="obsolete" type="checkbox" class="checkbox" value="1" [% IF obsolete %]checked[% END %]></td>
</tr>
[%- END %]
+ [%- UNLESS is_service %]
<tr>
<th align="right" nowrap><label for="has_sernumber">[% 'Has serial number' | $T8 %]</label></th>
<td><input class="checkbox" type="checkbox" name="has_sernumber" id="has_sernumber" value="1" [% IF has_sernumber %]checked[% END %]></td>
</tr>
+ [%- END %]
<tr>
<th align="right" nowrap><label for="shop">[% 'Shopartikel' | $T8 %]</label></th>
<td><input class="checkbox" type="checkbox" name="shop" id="shop" value="1" [% IF shop %]checked[% END %]></td>
</tr>
- [% UNLESS is_service %]
<tr>
<td>
<table>
</table>
</td>
</tr>
- [%- END %]
<script type="text/javascript">
<!-- Calendar.setup({ inputField : "priceupdate", ifFormat :"[% myconfig_jsc_dateformat %]", align : "BL", button : "trigger1" }); //-->
<input name="itemstatus" id="itemstatus_active" class="radio" type="radio" value="active" checked>
<label for="itemstatus_active">[% 'Active' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_onhand" class="radio" type="radio" value="onhand">
+ [%- UNLESS is_service %]
<label for="itemstatus_onhand">[% 'On Hand' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_short" class="radio" type="radio" value="short">
<label for="itemstatus_short">[% 'Short' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_obsolete" class="radio" type="radio" value="obsolete">
+ [%- END %]
<label for="itemstatus_obsolete">[% 'Obsolete' | $T8 %]</label>
<input name="itemstatus" id="itemstatus_orphaned" class="radio" type="radio" value="orphaned">
<label for="itemstatus_orphaned">[% 'Orphaned' | $T8 %]</label>
<input name="l_description" id="l_description" class="checkbox" type="checkbox" value="Y" checked>
<label for="l_description">[% 'Part Description' | $T8 %]</label>
</td>
+ [%- UNLESS is_service %]
<td>
<input name="l_serialnumber" id="l_serialnumber" class="checkbox" type="checkbox" value="Y">
<label for="l_serialnumber">[% 'Serial Number' | $T8 %]</label>
</td>
+ [%- END %]
<td>
<input name="l_unit" id="l_unit" class="checkbox" type="checkbox" value="Y" checked>
<label for="l_unit">[% 'Unit of measure' | $T8 %]</label>
<input name="l_deliverydate" id="l_deliverydate" class="checkbox" type="checkbox" value="Y">
<label for="l_deliverydate">[% 'deliverydate' | $T8 %]</label>
</td>
+ [%- UNLESS is_service %]
<td>
<input name="l_rop" id="l_rop" class="checkbox" type="checkbox" value="Y">
<label for="l_rop">[% 'ROP' | $T8 %]</label>
<input name="l_weight" id="l_weight" class="checkbox" type="checkbox" value="Y">
<label for="l_weight">[% 'Weight' | $T8 %]</label>
</td>
+ [%- END %]
</tr>
<tr>
</tr>
<tr>
+ [%- UNLESS is_service %]
<td>
<input name="l_onhand" id="l_onhand" class="checkbox" type="checkbox" value="Y">
<label for="l_onhand">[% 'Stocked Qty' | $T8 %]</label>
</td>
+ [%- END %]
<td>
<input name="l_projectnumber" id="l_projectnumber" class="checkbox" type="checkbox" value="Y">
<label for="l_projectnumber">[% 'Project Number' | $T8 %]</label>
<input class="submit" type="submit" name="action" value="[% 'TOP100' | $T8 %]">
</p>
</form>
-
[%#- button for saving history %]
<input type="button" class="submit" onclick="set_history_window([% id | html %]);" name="history" id="history" value="[% 'history' | $T8 %]">
- <input type="submit" class="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% IF INSTANCE_CONF.get_ir_show_mark_as_paid %]
+ <input type="submit" class="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% END %]
[% END %]
<input type="hidden" name="rowcount" value="[% rowcount %]">
<th align="right">[% 'Vendor' | $T8 %]</th>
<td>
[%- INCLUDE 'generic/multibox.html'
+ id = 'vendor',
name = 'vendor',
style = 'width: 250px',
DATA = ALL_VENDORS,
[% IF id %]
[%#- button for saving history %]
<input type="button" class="submit" onclick="set_history_window([% id | html %]);" name="history" id="history" value="[% 'history' | $T8 %]">
-
- <input type="submit" class="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% IF INSTANCE_CONF.get_is_show_mark_as_paid %]
+ <input type="submit" class="submit" name="action" value="[% 'mark as paid' | $T8 %]">
+ [% END %]
[% END %]
<input type="hidden" name="rowcount" value="[% rowcount %]">
<th align="right">[% 'Customer' | $T8 %]</th>
<td>
[%- INCLUDE 'generic/multibox.html'
+ id = 'customer',
name = 'customer',
style = 'width: 250px',
DATA = ALL_CUSTOMERS,
<th align="right" nowrap>[% 'Delivery Order Number' | $T8 %]</th>
<td colspan="3"><input size='11' name="donumber" value="[% HTML.escape(donumber) %]"></td>
</tr>
+[%- END %]
<tr>
<th align="right">[% 'Delivery Date' | $T8 %]</th>
<td>[% L.date_tag('deliverydate', deliverydate, cal_align='BL') %]</td>
</tr>
-[%- END %]
-
<tr>
<th align="right" nowrap>[% 'Order Number' | $T8 %]</th>
<td colspan="3"><input size='11' name="ordnumber" value="[% HTML.escape(ordnumber) %]"></td>
-function fokus(){ [% IF focus %]$('[% focus %]').focus()[% ELSE %][% fokus %].focus()[% END %] }
+function fokus(){ [% IF focus %]$('[% focus %]').focus()[% END %] }
<p><b>[% LxERP.t8('Error!') %]</b></p>
<p>
- [% LxERP.t8('Kivitendo needs to update the authentication database before you can proceed.') %]
+ [% LxERP.t8('kivitendo needs to update the authentication database before you can proceed.') %]
[% LxERP.t8('Please log in to the administration panel.') %]
- [% LxERP.t8('Kivitendo will then update the database automatically.') %]
+ [% LxERP.t8('kivitendo will then update the database automatically.') %]
</p>
<hr>
<p>
- [% LxERP.t8('For further information read this: ') %] <a href="doc/html/index.html" target="_blank">Kivitendo Installation</a><br>
- [% LxERP.t8('Or download the whole Installation Documentation as PDF (350kB) for off-line study (currently in German Language): ') %] <a href="doc/Kivitendo-Dokumentation.pdf" target="_blank">Kivitendo-Dokumentation.pdf</a>
+ [% LxERP.t8('For further information read this: ') %] <a href="doc/html/index.html" target="_blank">kivitendo Installation</a><br>
+ [% LxERP.t8('Or download the whole Installation Documentation as PDF (350kB) for off-line study (currently in German Language): ') %] <a href="doc/kivitendo-Dokumentation.pdf" target="_blank">kivitendo-Dokumentation.pdf</a>
</p>
<hr>
<a href="controller.pl?action=show" target="_top">[% LxERP.t8('Login') %]</a> |
<a href="admin.pl" target="_top">[% LxERP.t8('Administration') %]</a>
</p>
-
<p>[% 'If you want to set up the authentication database yourself then log in to the administration panel. kivitendo will then create the database and tables for you.' | $T8 %]</p>
<hr>
<p>[% 'For further information read this: ' | $T8 %] <a href="doc/html/index.html" target="_blank">kivitendo Installation</a><br>
- [% 'Or download the whole Installation Documentation as PDF (350kB) for off-line study (currently in German Language): ' | $T8 %] <a href="doc/Kivitendo-Dokumentation.pdf" target="_blank">Kivitendo-Dokumentation.pdf</a></p>
+ [% 'Or download the whole Installation Documentation as PDF (350kB) for off-line study (currently in German Language): ' | $T8 %] <a href="doc/kivitendo-Dokumentation.pdf" target="_blank">kivitendo-Dokumentation.pdf</a></p>
<hr>
<a href="controller.pl?action=LoginScreen/user_login" target="_top">[% 'Login' | $T8 %]</a> |
<a href="admin.pl" target="_top">[% 'Administration' | $T8 %]</a>
</p>
-
<p>
[%- LxERP.t8('Starting with version 2.6.3 the configuration files in "config" have been consolidated.') %]
- [%- LxERP.t8('The following old files whose settings have to be merged manually into the new configuration file "config/lx_office.conf" still exist:') %]
+ [%- LxERP.t8('The following old files whose settings have to be merged manually into the new configuration file "config/kivitendo.conf" still exist:') %]
</p>
<ul>
</p>
<p>
- [%- LxERP.t8('Which is located at doc/Kivitendo-Dokumentation.pdf. Click here: ') %] <a href ="doc/Kivitendo-Dokumentation.pdf">doc/Kivitendo-Dokumentation.pdf</a>
+ [%- LxERP.t8('Which is located at doc/kivitendo-Dokumentation.pdf. Click here: ') %] <a href ="doc/kivitendo-Dokumentation.pdf">doc/kivitendo-Dokumentation.pdf</a>
</p>
<p>
[%- END %]
<span class="frame-header-element frame-header-right">
[% 'User' | $T8 %]:
- [% MYCONFIG.login %]
+ [% MYCONFIG.login | html %]
[<a href="controller.pl?action=LoginScreen/logout" target="_top" title="[% 'Logout now' | $T8 %]">[% 'Logout' | $T8 %]</a>]
[% now.to_lxoffice %] -
[% now.hms %]
[%- HTML.escape(mainitem.title) %]
</a>
[%- IF mainitem.subitems %]
- <ul[%- IF force_ul_width %] width="[% mainitem.max_width * 12 %]"[% END %]>
+ <ul[%- IF force_ul_width %] width="[% mainitem.max_width * 10 %]"[% END %]>
[%- SET sub1_id = main_id * 100 %]
[%- FOREACH sub1item = mainitem.subitems %]
[%- SET sub1_id = sub1_id + 1 %]
[%- HTML.escape(sub1item.title) %]
</a>
[%- IF sub1item.subitems %]
- <ul[%- IF force_ul_width %] width="[% sub1item.max_width * 12 %]"[% END %]>
+ <ul[%- IF force_ul_width %] width="[% sub1item.max_width * 10 %]"[% END %]>
[%- SET sub2_id = sub1_id * 100 %]
[%- FOREACH sub2item = sub1item.subitems %]
[%- SET sub2_id = sub2_id + 1 %]
//-->
</script>
- <table border="0" width="100%" background="image/bg_titel.gif" cellpadding="0" cellspacing="0">
- <tr>
- <td style="color:white; font-family:verdana,arial,sans-serif; font-size: 12px;" nowrap>
-
+<div id="frame-header">
+ <span class="frame-header-element frame-header-left">
[<a href="login.pl?action=company_logo" target="_blank">[% 'new Window' | $T8 %]</a>]
-
[<a href="JavaScript:top.print()">[% 'print' | $T8 %]</a>]
-
[[% 'Search contacts' | $T8 %] <input size="15" name="search_term" id="search_term" onkeydown="return on_keydown_quicksearch(event)">]
- </td>
- <td align="right" style="vertical-align:middle; color:white; font-family:verdana,arial,sans-serif; font-size: 12px;" nowrap>
- [[% 'User' | $T8 %]: [% HTML.escape(login) %] -
+ </span>
+ <span class="frame-header-element frame-header-right">
+ [[% 'User' | $T8 %]: [% MYCONFIG.login | html %] -
<a href="controller.pl?action=LoginScreen/logout" target="_top">[% 'logout' | $T8 %]</a>]
[% date %] <span id='clock_id' style='position:relative'></span>
- </td>
- </tr>
- </table>
-
+ </span>
+</div>
<div id="menuv3">
[% menu %]
<br>[% label_workflow %]<br>
<input class="submit" type="submit" name="action_save_as_new" value="[% 'Save as new' | $T8 %]">
- <input class="submit" type="submit" name="action_delete" value="[% 'Delete' | $T8 %]">
+
+ [%- UNLESS (is_sales_ord && !INSTANCE_CONF.get_sales_order_show_delete) || (is_pur_ord && !INSTANCE_CONF.get_purchase_order_show_delete) %]
+ <input class="submit" type="submit" name="action_delete" value="[% 'Delete' | $T8 %]">
+ [%- END %]
[%- IF is_sales_quo %]
<input class="submit" type="submit" name="action_sales_order" value="[% 'Sales Order' | $T8 %]">
<th>[% 'Source' | $T8 %]</th>
<th>[% 'Description' | $T8 %]</th>
[%- IF is_asset %]
- <th>[% 'Deposit' | $T8 %]</th>
<th>[% 'Payment' | $T8 %]</th>
+ <th>[% 'Deposit' | $T8 %]</th>
[%- ELSE %]
<th>[% 'Decrease' | $T8 %]</th>
<th>[% 'Increase' | $T8 %]</th>
<th align=left>[% 'Method' | $T8 %]</th>
<td colspan=3>
[% L.radio_button_tag('method', value='accrual', checked=accrual, label=LxERP.t8('Accrual')) %]
- [% L.radio_button_tag('method', value='cash', checked=cash, label=LxERP.t8('EUR')) %]
+ [% L.radio_button_tag('method', value='cash', checked=cash, label=LxERP.t8('cash')) %]
</td>
</tr>
[%- END %]
<table border="0">
[%- IF selectdepartment %]
<tr>
- <th align=right nowrap>[% 'Department' | $T8 %]</th>
+ <th align="left" nowrap>[% 'Department' | $T8 %]</th>
<td colspan=3><select name=department>[% selectdepartment %]</select></td>
</tr>
[%- END %]
[%- IF is_aging %]
<tr>
- <th align=right>[% label %]</th>
+ <th align=left>[% label %]</th>
<td>[% vc %]</td>
</tr>
+</table>
+<table border="0">
+ <tr>
+ <td colspan=5><hr size=1 noshade></td>
+ </tr>
<tr>
- <td>[% 'Review of Aging list' | $T8 %]</td>
- <td><select name="review_of_aging_list">
+ <th align=left><input name=reporttype class=radio type=radio value="custom" checked><b>[% 'Reference day' | $T8 %]</b> </th>
+ <td align="right" colspan="4">[% 'Review of Aging list' | $T8 %] <select name="review_of_aging_list">
<option></option>
<option>0-30</option>
<option>30-60</option>
<option>60-90</option>
<option>90-120</option>
<option>> 120</option>
- </select>
+ </select> [% 'for date' | $T8 %] [% L.date_tag('fordate', today) %]
</td>
</tr>
<tr>
- <td align=left colspan=4>
+ <td colspan=5><hr size=3 noshade></td>
+ </tr>
+ <tr>
+ <th align=left><input name=reporttype class=radio type=radio value="free"><b>[% 'Free report period' | $T8 %]</b> </th>
+ <td align="right" colspan=4>
[% 'From' | $T8 %] [% L.date_tag('fromdate', fromdate) %]
[% 'Bis' | $T8 %] [% L.date_tag('todate') %]
</td>
<th align="right" nowrap>[% 'Charge Number' | $T8 %]:</th>
<td><input name="chargenumber" size=40></td>
</tr>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<tr>
<th align="right" nowrap>[% 'Best Before' | $T8 %]:</th>
<td>
<td nowrap><label for="l_partnumber">[% 'Part Number' | $T8 %]</label></td>
<td align="right"><input name="l_chargenumber" id="l_chargenumber" class="checkbox" type="checkbox" value="Y" checked></td>
<td nowrap><label for="l_chargenumber">[% 'Charge Number' | $T8 %]</label></td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td align="right"><input name="l_bestbefore" id="l_bestbefore" class="checkbox" type="checkbox" value="Y" checked></td>
<td nowrap><label for="l_bestbefore">[% 'Best Before' | $T8 %]</label></td>
[% END %]
<th class="listheading">[% 'Part Number' | $T8 %]</th>
<th class="listheading">[% 'Part Description' | $T8 %]</th>
<th class="listheading">[% 'Charge Number' | $T8 %]</th>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<th class="listheading">[% 'Best Before' | $T8 %]</th>
[% END %]
<th class="listheading">[% 'EAN' | $T8 %]</th>
<input type="hidden" name="partnumber_[% loop.count %]" value="[% HTML.escape(row.partnumber) %]">
<input type="hidden" name="partdescription_[% loop.count %]" value="[% HTML.escape(row.partdescription) %]">
<input type="hidden" name="chargenumber_[% loop.count %]" value="[% HTML.escape(row.chargenumber) %]">
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<input type="hidden" name="bestbefore_[% loop.count %]" value="[% HTML.escape(row.bestbefore) %]">
[% END %]
<input type="hidden" name="ean_[% loop.count %]" value="[% HTML.escape(row.ean) %]">
<td>[% HTML.escape(row.partnumber) %]</td>
<td>[% HTML.escape(row.partdescription) %]</td>
<td>[% HTML.escape(row.chargenumber) %]</td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>[% HTML.escape(row.bestbefore) %]</td>
[% END %]
<td>[% HTML.escape(row.ean) %]</td>
<th align="right" nowrap>[% 'Charge Number' | $T8 %]:</th>
<td><input name="chargenumber" size=40></td>
</tr>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<tr>
<th align="right" nowrap>[% 'Best Before' | $T8 %]:</th>
<td>
<td nowrap><label for="l_partnumber">[% 'Part Number' | $T8 %]</label></td>
<td align="right"><input name="l_chargenumber" id="l_chargenumber" class="checkbox" type="checkbox" value="Y" checked></td>
<td nowrap><label for="l_chargenumber">[% 'Charge Number' | $T8 %]</label></td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td align="right"><input name="l_bestbefore" id="l_bestbefore" class="checkbox" type="checkbox" value="Y" checked></td>
<td nowrap><label for="l_bestbefore">[% 'Best Before' | $T8 %]</label></td>
[% END %]
<th class="listheading">[% 'Part Number' | $T8 %]</th>
<th class="listheading">[% 'Part Description' | $T8 %]</th>
<th class="listheading">[% 'Charge Number' | $T8 %]</th>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<th class="listheading">[% 'Best Before' | $T8 %]</th>
[% END %]
<th class="listheading">[% 'EAN' | $T8 %]</th>
<input type="hidden" name="partnumber_[% loop.count %]" value="[% HTML.escape(row.partnumber) %]">
<input type="hidden" name="partdescription_[% loop.count %]" value="[% HTML.escape(row.partdescription) %]">
<input type="hidden" name="chargenumber_[% loop.count %]" value="[% HTML.escape(row.chargenumber) %]">
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<input type="hidden" name="bestbefore_[% loop.count %]" value="[% HTML.escape(row.bestbefore) %]">
[% END %]
<input type="hidden" name="ean_[% loop.count %]" value="[% HTML.escape(row.ean) %]">
<td>[% HTML.escape(row.partnumber) %]</td>
<td>[% HTML.escape(row.partdescription) %]</td>
<td>[% HTML.escape(row.chargenumber) %]</td>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<td>[% HTML.escape(row.bestbefore) %]</td>
[% END %]
<td>[% HTML.escape(row.ean) %]</td>
<td><input name="chargenumber" size="30"></td>
</tr>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<tr>
<th align="right" nowrap>[% 'Best Before' | $T8 %]</th>
<td>
<td><input name="chargenumber" size="30" value="[% HTML.escape(chargenumber) %]"></td>
</tr>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<tr>
<th align="right" nowrap>[% 'Best Before' | $T8 %]</th>
<td>
<td><input name="chargenumber" size="30" value="[% HTML.escape(chargenumber) %]"></td>
</tr>
- [% IF conf_show_best_before %]
+ [% IF INSTANCE_CONF.get_show_bestbefore %]
<tr>
<th align="right" nowrap>[% 'Best Before' | $T8 %]</th>
<td>